Basic Information | |
---|---|
Family ID | F073621 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 49 residues |
Representative Sequence | MEKTAEQVYTDLLRQLASPSASQPGVLADLFRDVERMHSMGHITDWQ |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 89.92 % |
% of genes near scaffold ends (potentially truncated) | 95.00 % |
% of genes from short scaffolds (< 2000 bps) | 91.67 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (54.167 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (11.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (61.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (76.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.67% β-sheet: 0.00% Coil/Unstructured: 57.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF13417 | GST_N_3 | 15.83 |
PF13410 | GST_C_2 | 10.00 |
PF00043 | GST_C | 4.17 |
PF03401 | TctC | 2.50 |
PF00795 | CN_hydrolase | 1.67 |
PF01019 | G_glu_transpept | 1.67 |
PF00892 | EamA | 1.67 |
PF13586 | DDE_Tnp_1_2 | 1.67 |
PF02371 | Transposase_20 | 1.67 |
PF07589 | PEP-CTERM | 1.67 |
PF13193 | AMP-binding_C | 1.67 |
PF13561 | adh_short_C2 | 0.83 |
PF04392 | ABC_sub_bind | 0.83 |
PF01436 | NHL | 0.83 |
PF01041 | DegT_DnrJ_EryC1 | 0.83 |
PF02540 | NAD_synthase | 0.83 |
PF06537 | DHOR | 0.83 |
PF03992 | ABM | 0.83 |
PF12244 | DUF3606 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 4.17 |
COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 4.17 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.50 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.67 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.67 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.83 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.83 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.83 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.83 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.83 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.83 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.83 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 54.17 % |
Unclassified | root | N/A | 45.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004156|Ga0062589_101815160 | Not Available | 612 | Open in IMG/M |
3300005290|Ga0065712_10257387 | Not Available | 928 | Open in IMG/M |
3300005328|Ga0070676_10293810 | Not Available | 1099 | Open in IMG/M |
3300005329|Ga0070683_102028666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 553 | Open in IMG/M |
3300005330|Ga0070690_101595431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 529 | Open in IMG/M |
3300005331|Ga0070670_100079746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2814 | Open in IMG/M |
3300005331|Ga0070670_101398011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
3300005333|Ga0070677_10139535 | Not Available | 1116 | Open in IMG/M |
3300005335|Ga0070666_10650584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
3300005344|Ga0070661_100422735 | Not Available | 1057 | Open in IMG/M |
3300005345|Ga0070692_10206458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 1154 | Open in IMG/M |
3300005345|Ga0070692_10437913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 834 | Open in IMG/M |
3300005354|Ga0070675_100164307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1911 | Open in IMG/M |
3300005354|Ga0070675_100297831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1420 | Open in IMG/M |
3300005364|Ga0070673_100859708 | Not Available | 840 | Open in IMG/M |
3300005366|Ga0070659_100894458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 776 | Open in IMG/M |
3300005366|Ga0070659_101408909 | Not Available | 620 | Open in IMG/M |
3300005456|Ga0070678_101085700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
3300005456|Ga0070678_102087462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
3300005543|Ga0070672_101156315 | Not Available | 689 | Open in IMG/M |
3300005543|Ga0070672_101408649 | Not Available | 623 | Open in IMG/M |
3300005564|Ga0070664_100633869 | Not Available | 993 | Open in IMG/M |
3300005577|Ga0068857_101409330 | Not Available | 678 | Open in IMG/M |
3300005614|Ga0068856_101360706 | Not Available | 725 | Open in IMG/M |
3300005616|Ga0068852_100249836 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
3300005616|Ga0068852_101979171 | Not Available | 605 | Open in IMG/M |
3300005618|Ga0068864_101167350 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300005834|Ga0068851_10271115 | Not Available | 968 | Open in IMG/M |
3300005834|Ga0068851_10727135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
3300006358|Ga0068871_100522156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 1072 | Open in IMG/M |
3300006358|Ga0068871_100756996 | Not Available | 893 | Open in IMG/M |
3300006854|Ga0075425_102549505 | Not Available | 565 | Open in IMG/M |
3300006871|Ga0075434_102514079 | Not Available | 516 | Open in IMG/M |
3300006904|Ga0075424_101667341 | Not Available | 675 | Open in IMG/M |
3300009094|Ga0111539_10643082 | Not Available | 1235 | Open in IMG/M |
3300009094|Ga0111539_12336136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
3300009101|Ga0105247_10507961 | Not Available | 879 | Open in IMG/M |
3300009177|Ga0105248_10018703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7660 | Open in IMG/M |
3300009177|Ga0105248_10111978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3079 | Open in IMG/M |
3300010397|Ga0134124_12596500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
3300010399|Ga0134127_11369447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 778 | Open in IMG/M |
3300010401|Ga0134121_11326572 | Not Available | 726 | Open in IMG/M |
3300011119|Ga0105246_11097740 | Not Available | 726 | Open in IMG/M |
3300012094|Ga0136638_10598857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
3300012531|Ga0136640_10316482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 661 | Open in IMG/M |
3300012668|Ga0157216_10222000 | Not Available | 888 | Open in IMG/M |
3300012900|Ga0157292_10178509 | Not Available | 696 | Open in IMG/M |
3300012902|Ga0157291_10272539 | Not Available | 573 | Open in IMG/M |
3300012905|Ga0157296_10176119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter | 662 | Open in IMG/M |
3300012905|Ga0157296_10202566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300012916|Ga0157310_10128551 | Not Available | 850 | Open in IMG/M |
3300012951|Ga0164300_11048943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium | 528 | Open in IMG/M |
3300012961|Ga0164302_11108882 | Not Available | 625 | Open in IMG/M |
3300012989|Ga0164305_10965561 | Not Available | 721 | Open in IMG/M |
3300013102|Ga0157371_10764620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
3300013296|Ga0157374_11798967 | Not Available | 638 | Open in IMG/M |
3300013308|Ga0157375_11813997 | Not Available | 723 | Open in IMG/M |
3300014325|Ga0163163_11106654 | Not Available | 855 | Open in IMG/M |
3300014325|Ga0163163_12472141 | Not Available | 577 | Open in IMG/M |
3300014745|Ga0157377_10779084 | Not Available | 703 | Open in IMG/M |
3300014969|Ga0157376_11916879 | Not Available | 630 | Open in IMG/M |
3300014969|Ga0157376_12560480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 550 | Open in IMG/M |
3300015201|Ga0173478_10115572 | Not Available | 1014 | Open in IMG/M |
3300015265|Ga0182005_1177794 | Not Available | 631 | Open in IMG/M |
3300015371|Ga0132258_11705301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1589 | Open in IMG/M |
3300015373|Ga0132257_104606448 | Not Available | 502 | Open in IMG/M |
3300017789|Ga0136617_11229353 | Not Available | 562 | Open in IMG/M |
3300017792|Ga0163161_12093180 | Not Available | 503 | Open in IMG/M |
3300018432|Ga0190275_12080698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
3300018476|Ga0190274_11438037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 779 | Open in IMG/M |
3300018481|Ga0190271_13412103 | Not Available | 532 | Open in IMG/M |
3300023073|Ga0247744_1036158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
3300023265|Ga0247780_1162154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 602 | Open in IMG/M |
3300023275|Ga0247776_10365842 | Not Available | 531 | Open in IMG/M |
3300025147|Ga0209511_1033969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2489 | Open in IMG/M |
3300025315|Ga0207697_10123778 | Not Available | 1114 | Open in IMG/M |
3300025581|Ga0208355_1101456 | Not Available | 609 | Open in IMG/M |
3300025908|Ga0207643_10765818 | Not Available | 625 | Open in IMG/M |
3300025913|Ga0207695_11029160 | Not Available | 703 | Open in IMG/M |
3300025914|Ga0207671_10946765 | Not Available | 680 | Open in IMG/M |
3300025923|Ga0207681_10232942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. WDL1 | 1430 | Open in IMG/M |
3300025925|Ga0207650_10094895 | Not Available | 2286 | Open in IMG/M |
3300025925|Ga0207650_10152050 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
3300025925|Ga0207650_11209624 | Not Available | 643 | Open in IMG/M |
3300025926|Ga0207659_10575700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 959 | Open in IMG/M |
3300025926|Ga0207659_10614124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 928 | Open in IMG/M |
3300025927|Ga0207687_10628703 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300025931|Ga0207644_10131675 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
3300025931|Ga0207644_10311802 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300025931|Ga0207644_11605364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
3300025933|Ga0207706_10479352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 1075 | Open in IMG/M |
3300025941|Ga0207711_10197163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1837 | Open in IMG/M |
3300025941|Ga0207711_10200723 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
3300025941|Ga0207711_10262925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 1586 | Open in IMG/M |
3300025941|Ga0207711_10358295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1351 | Open in IMG/M |
3300025945|Ga0207679_10947897 | Not Available | 788 | Open in IMG/M |
3300025945|Ga0207679_11302586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
3300025960|Ga0207651_10062161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Leptothrix → Leptothrix mobilis | 2601 | Open in IMG/M |
3300025960|Ga0207651_11029326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
3300025961|Ga0207712_11807526 | Not Available | 548 | Open in IMG/M |
3300026023|Ga0207677_10380806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1191 | Open in IMG/M |
3300026023|Ga0207677_11604962 | Not Available | 602 | Open in IMG/M |
3300026035|Ga0207703_10488599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1154 | Open in IMG/M |
3300026035|Ga0207703_12421662 | Not Available | 500 | Open in IMG/M |
3300026067|Ga0207678_10180239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. WDL1 | 1804 | Open in IMG/M |
3300026088|Ga0207641_10068325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3046 | Open in IMG/M |
3300026088|Ga0207641_10595897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1081 | Open in IMG/M |
3300026089|Ga0207648_10169065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1932 | Open in IMG/M |
3300026089|Ga0207648_11189560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
3300026118|Ga0207675_100976597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 865 | Open in IMG/M |
3300026142|Ga0207698_10044187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3345 | Open in IMG/M |
3300026142|Ga0207698_11686575 | Not Available | 649 | Open in IMG/M |
3300027907|Ga0207428_10406200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 997 | Open in IMG/M |
3300028379|Ga0268266_11397678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
3300028596|Ga0247821_10832687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
3300028608|Ga0247819_10718061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
3300030784|Ga0102758_10767323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 535 | Open in IMG/M |
3300031938|Ga0308175_102190432 | Not Available | 620 | Open in IMG/M |
3300033550|Ga0247829_10081902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 2378 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 11.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 6.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 6.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.17% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.33% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.50% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.50% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.83% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
3300012531 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06) | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300023073 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5 | Environmental | Open in IMG/M |
3300023265 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5 | Environmental | Open in IMG/M |
3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
3300025147 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaG (SPAdes) | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030784 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062589_1018151601 | 3300004156 | Soil | MEKSAEQVYTDLLRQLASPGTLQPSVLADTFRDVERMHSMGQITDWQLQNA* |
Ga0065712_102573872 | 3300005290 | Miscanthus Rhizosphere | MEKTAEQVYTDLLRQLASPSASQPGVLADLFRDVERMHSMGH |
Ga0070676_102938101 | 3300005328 | Miscanthus Rhizosphere | MEKTAEQVYTDLLRQLASPSASQPGVLADLFRDVERMHSMGHITDWQLE |
Ga0070683_1020286662 | 3300005329 | Corn Rhizosphere | MEKTAEQLYTDLLRLLASPSAVQPAVLADTLRDVERMHSMGHITDWQLEK |
Ga0070690_1015954312 | 3300005330 | Switchgrass Rhizosphere | MEKTAEQLYTDLLRLLGSPSAVQPAVLADSFRDVERMHSMGHIT |
Ga0070670_1000797464 | 3300005331 | Switchgrass Rhizosphere | VELRPEQVYTDLLRQWGSPAATAPEVLANAFRDVERMHSM |
Ga0070670_1013980112 | 3300005331 | Switchgrass Rhizosphere | MEKTAEQLYTDLLRQLASPSAVQPGVLADTFRDVERMHSMGHITDWQLHNAREAYAKTI |
Ga0070677_101395352 | 3300005333 | Miscanthus Rhizosphere | MEHSPEQVYTDLLRQLASPAGTDPEVLANTFRDVERMHSMGQ |
Ga0070666_106505841 | 3300005335 | Switchgrass Rhizosphere | MEKTAEQLYTDLLRLLGSPSAVQPAVLADSFRDVERMHSMGHITDWQ |
Ga0070661_1004227351 | 3300005344 | Corn Rhizosphere | MDESPEQVYTTLLRQLASPVGKEPEVLASLFRDVERMHAMGQITDWQLHNAREAYARTA |
Ga0070692_102064581 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKTAAQLYTDLLRLLASPSAIQPEILADTFRDVERMHSMGHITDWQLHNAREAYAKTIE |
Ga0070692_104379131 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKTAEQLYTDLLRQLANPSAIQPAVLADTFRDVERMHSMGHI |
Ga0070675_1001643071 | 3300005354 | Miscanthus Rhizosphere | MEKTAEQLYTDLLRLLASPSAVQPGVLADSFRDIERMHSMGHITDWQLHNAREA |
Ga0070675_1002978313 | 3300005354 | Miscanthus Rhizosphere | MEKTAEQLYSDLLRLLASPSAVQPGVLADSFRDIERMHSMGHITDWQLHNAREA |
Ga0070673_1008597082 | 3300005364 | Switchgrass Rhizosphere | MEKTAEQIYTDLLRQLASPSATQPGVLADMFRDVERMHSKGHITDW |
Ga0070659_1008944581 | 3300005366 | Corn Rhizosphere | MMVAKEIAVEKTAEQLYTDLLRQLASPSAVQPAVLAQAFRDVERLHSMGHITDWQLHQARDAYAKTIER |
Ga0070659_1014089091 | 3300005366 | Corn Rhizosphere | MEHSPEQVYTELLRQLASPAATAPEILANAFREVERMHSMGQITDWQLQNARE |
Ga0070678_1010857002 | 3300005456 | Miscanthus Rhizosphere | MEKTAEQLYTDLLRLLANPSAVQPAVLADTFRDVERMHSMGRITDWQLDKAREAYANTIDRDP |
Ga0070678_1020874622 | 3300005456 | Miscanthus Rhizosphere | MEKTAEQLYTDLLRQLASPSAIQPSVLADTFRDVERMHSMGHITDW |
Ga0070672_1011563151 | 3300005543 | Miscanthus Rhizosphere | MEHSPEQVYTDLLRQLASPAGTDPEVLANTFRDVERMH |
Ga0070672_1014086491 | 3300005543 | Miscanthus Rhizosphere | MEHNPEQVYTDLLRQLASPAGTAPEVLANAFRNVERMHSMGQITDWQLQNAREAYAR |
Ga0070664_1006338691 | 3300005564 | Corn Rhizosphere | MEHSPEQVYTDLLRQLASPAGTDPEVLANTFRDVAI* |
Ga0068857_1014093302 | 3300005577 | Corn Rhizosphere | MEHSPEQVYTDLLRQLANPSATQPGVLADMFRDVERMHSMGHITDWQLEN |
Ga0068856_1013607061 | 3300005614 | Corn Rhizosphere | MEKTAEQVYTDLLRELASPSAVQPAVLADAFRDVERMHSMGRITDWQL |
Ga0068852_1002498361 | 3300005616 | Corn Rhizosphere | MEKTAEQVYTDLLCQLANPGVTQPVVVADLFREVELMHSRARSRTGNL |
Ga0068852_1019791711 | 3300005616 | Corn Rhizosphere | MDESPEQVYTTLLRQLASPVGKEPEVLASLFRDVERMH |
Ga0068864_1011673501 | 3300005618 | Switchgrass Rhizosphere | MEKTPEHVYTDLLRQLASPSAVQPAVLADAFRDVERLHAMGHITDW |
Ga0068851_102711151 | 3300005834 | Corn Rhizosphere | MEKTAEQVYTDLLRQLASPSASQPGVLADLFRDVERMHSMGHITDWQ |
Ga0068851_107271352 | 3300005834 | Corn Rhizosphere | MIAMEKTAEQLYTDLLRQLASPSAVQPGVLADTFRDVERMHSMGHITDWQLH |
Ga0068871_1005221563 | 3300006358 | Miscanthus Rhizosphere | MIAMEKTAEQLYTDLLRQLASPSAIQPAVLADTFRDVERMHSMGHI |
Ga0068871_1007569961 | 3300006358 | Miscanthus Rhizosphere | MEETAEQVYTDLLRQLASPSAAQPGALAEMFRDIERLHPMGRITD |
Ga0075425_1025495051 | 3300006854 | Populus Rhizosphere | MEKTAEQVYTDLLRQLASPSAVQPAVLADAFRDVERLHAMGHITDWQL |
Ga0075434_1025140791 | 3300006871 | Populus Rhizosphere | MEKTAEQVYTDLLRQLASPSAVQPAVLADAFRDVERLHAMGHITDWQLRQARDA |
Ga0075424_1016673411 | 3300006904 | Populus Rhizosphere | MEKTAEQVYTDLLRELASPSAVQPAVLADAFRDVERMHSMGRITDWQLQRARDAYEKT |
Ga0111539_106430821 | 3300009094 | Populus Rhizosphere | MEKTAEQVYTDLLRQLARPSASQPSVLADLFRDVERMHSMGRIPDWQL |
Ga0111539_123361361 | 3300009094 | Populus Rhizosphere | MMITKEIAMEKTAEQLYTDLLRQLASPSAVQPGVLADTFRDVERMHSMGHITDWQL |
Ga0105247_105079611 | 3300009101 | Switchgrass Rhizosphere | MEKTAEQVYTDLLRQLASPSAVQPAVLADAFRDVERLHAMGHITD |
Ga0105248_100187037 | 3300009177 | Switchgrass Rhizosphere | MEKTAEQVYTDLLRQLASPAGTDPEVLANTFRDVAI* |
Ga0105248_101119781 | 3300009177 | Switchgrass Rhizosphere | MEKTAEQIYTDLLRQLASPSATQPGVLADMFRDVERMHSKG |
Ga0134124_125965002 | 3300010397 | Terrestrial Soil | MMIAKEIAMEKTAEQLYTDLLRQLASPSAVQPDVLADTFRDVERMHSMGHITDW |
Ga0134127_113694472 | 3300010399 | Terrestrial Soil | MMSVEEIAMEKTAEQLYTDLLRQLANPSAIQPAVLADTFRDVERMHSMGHITDWQLH |
Ga0134121_113265721 | 3300010401 | Terrestrial Soil | MEKTAEQVYTDLLRQLASPSAVQPAVLADAFRDVER |
Ga0105246_110977401 | 3300011119 | Miscanthus Rhizosphere | MEKTAEQVYTDLLRQLASPSAVQPAVLADALRDVERMHAMGHITDWQLRQAGDAYE* |
Ga0136638_105988571 | 3300012094 | Polar Desert Sand | MNAMEKTAEQLYTDLLLQLASPSAVQPALLADTFRDVE |
Ga0136640_103164822 | 3300012531 | Polar Desert Sand | MEQSPEQVYTDLLRQLASPAGTDPEVLANMFRDVERMHSMGQITDWQLQNAREAYARTPG |
Ga0157216_102220001 | 3300012668 | Glacier Forefield Soil | MEKTAEQVYTDLLRQLASPGAIPPGVLADTFREVERMHSTGQIADWQLENAREAYASTVSAAGS |
Ga0157292_101785091 | 3300012900 | Soil | MEKTAEQVYTDLLRQLASPSASRPGMLADLFRDVERMHSMGRITDWQLENAREAY |
Ga0157291_102725392 | 3300012902 | Soil | MEKTAEQIYTDLLRQLASPSPTQPGVLADMFRDVERMHSKGHITDWQLENAR |
Ga0157296_101761191 | 3300012905 | Soil | MEKTAEQIYTDLLRQLASPSATQPGVLADMFRDVERMHS |
Ga0157296_102025662 | 3300012905 | Soil | MMIAKEIVMEKTAEQLYTDLLRLLASPSAVQPAVLADTLR |
Ga0157310_101285511 | 3300012916 | Soil | MEKTAEQVYTDLLCQVASPSASQPGVLADLFRDVER |
Ga0164300_110489432 | 3300012951 | Soil | MMSVEEIAMEKTAEQLYTDLLRQLASPSAIQPTVLAETFRDVE |
Ga0164302_111088822 | 3300012961 | Soil | MEKTAEQVYTDLLRQLASPAGTDPEALANTFREVERM |
Ga0164305_109655613 | 3300012989 | Soil | MEKTAEQVYTDLLRQLASPAGTDPEALANTFREVERMHSIGQITDWQLQNAQEAY |
Ga0157371_107646201 | 3300013102 | Corn Rhizosphere | MIAKEIAMEKTAEQLYTDLLRQLASPSAIQPSVLADTFRDVERMHSMGHITDWQLHNAREAYAKTIE |
Ga0157374_117989671 | 3300013296 | Miscanthus Rhizosphere | MGKTAEQVYTDLLRQLANPGVAQPVVVADMFREVELM |
Ga0157375_118139973 | 3300013308 | Miscanthus Rhizosphere | MEKTAEQVYTDLLRQLASPAGTDPEALANTFREVERMHSIGQITDWQLQNAQEAYART |
Ga0163163_111066542 | 3300014325 | Switchgrass Rhizosphere | MEKTAEQVYTDLLRQLANPGVAQPVVVADMFREVELMH |
Ga0163163_124721412 | 3300014325 | Switchgrass Rhizosphere | MDESPEQVYTTLLRQLASPVGKEPEVLASLFRDVERMHAMGQITDWQLHNAREAYA |
Ga0157377_107790841 | 3300014745 | Miscanthus Rhizosphere | MEKTAEQVYTDLLRQVASPSASQPGVLADLFRDVERMHSMGHITDWQLE |
Ga0157376_119168791 | 3300014969 | Miscanthus Rhizosphere | MEHSPEQVYTDLLRQLASPAGTDPEVLAKTFHDVERMHSMG |
Ga0157376_125604801 | 3300014969 | Miscanthus Rhizosphere | MMSVEEIAMEKTAEQLYTDLLRQLASPSAIQPAVLADTFRDVERMHSMGHITDWQ |
Ga0173478_101155722 | 3300015201 | Soil | MEKTAEQVYTDLLCQVASPSASQPGVLADLFRDVERMHSMGHITDWQLE |
Ga0182005_11777941 | 3300015265 | Rhizosphere | MEKTAEQVYSDLLRELASPSAVQPAVLANAFRDVERMH |
Ga0132258_117053014 | 3300015371 | Arabidopsis Rhizosphere | MMRVEEIAMEKTAEQLYTDLLRQLASPSAIQPAVLAETFRDVERMHSMGHITDWQLHNAREAY |
Ga0132257_1046064481 | 3300015373 | Arabidopsis Rhizosphere | MEKTAEQVYTDLLCQLANPGVAQPVVVADLFREVELMHSAGQITDWQ |
Ga0136617_112293532 | 3300017789 | Polar Desert Sand | MEKTAEQIYIDLLRQLASPFGIPPGVLADAFREVEQMHSTGQITDWQLQNAREAYSRTVEREP |
Ga0163161_120931801 | 3300017792 | Switchgrass Rhizosphere | MEKTAEQVYTDLLRQLASPSAIQPAVLADLFRDVERMHSMGRITDWQLQNARE |
Ga0190275_120806981 | 3300018432 | Soil | MEKTAEQVYSDLLRQLATPSAIEPAVLADTFRDVERMHSMGRITDWQLRNAREAYAATI |
Ga0190274_114380371 | 3300018476 | Soil | MEKTAEQLYTDLLRLLADPSAVQPAVLADTFRDVERMH |
Ga0190271_134121031 | 3300018481 | Soil | MAKTAEQIYTDLLRQLASPSATQPGVLADMFRDVERMHSKGHITDWQLENAREAYA |
Ga0247744_10361582 | 3300023073 | Soil | MEKTAEQLYTDLLRQLASPSAIQPGVLADTFRDVERMHSMGHITDWQLDKAREAYAKTIE |
Ga0247780_11621541 | 3300023265 | Plant Litter | MEKTAEQLYTDLLRLLANPSAVQPAVLADTFRDVERMHSMGRITDWQLEKAREAYANTI |
Ga0247776_103658422 | 3300023275 | Plant Litter | MEKTAEQIYTDLLRQLASPSATQPGVLADMFRDVERMHSKGHITDWQLEN |
Ga0209511_10339694 | 3300025147 | Glacier Valley | MEKTAEQTYTDLLRQLASPSATLPQVLAETFRDIERMHSMGHITDWQLKNAREAYAATIEREPSQ |
Ga0207697_101237782 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKTAEQIYTDLLRQLASPSATQPGVLADMFRDVERMHSKGHITD |
Ga0208355_11014561 | 3300025581 | Arctic Peat Soil | MEKTAEQVYTDLLRQLASPSTIQPGVLADTFRDVERMHSMGRITDWQLENAREAYASTVSAA |
Ga0207643_107658182 | 3300025908 | Miscanthus Rhizosphere | MEKTAEQIYTDLLRQLASPSATQPGVLADMFRDVERMHSKGHITDWQLENAREA |
Ga0207695_110291601 | 3300025913 | Corn Rhizosphere | MEKTAEQVYTDLLRQLASPSAVQPAVLADAFRDVERMHAMGHITDW |
Ga0207671_109467653 | 3300025914 | Corn Rhizosphere | MEKTAEQVYTDLLRQLASPSAVQPAVLADAFRDVERMH |
Ga0207681_102329423 | 3300025923 | Switchgrass Rhizosphere | MEKTAEQLYTDLLRQLASPSAVQPGILADTFRDVERMHSMGPITD |
Ga0207650_100948953 | 3300025925 | Switchgrass Rhizosphere | MEKTAEQIYTDLLRQLASPSATQPGVLADMFRDVERMHSKGHITDWQLENARE |
Ga0207650_101520501 | 3300025925 | Switchgrass Rhizosphere | MEKTAEQVYTDLLCQLANPGVAQPVVVADLFREVELMHSRARSRTGPR |
Ga0207650_112096241 | 3300025925 | Switchgrass Rhizosphere | MEKTAEQIYTDLLRQLASPSATQPGVLADMFRDVERMHSKGHITDWQLENAREAY |
Ga0207659_105757001 | 3300025926 | Miscanthus Rhizosphere | MEKTAEQLYSDLLRLLASPSAVQPGVLADSFRDIERMHSMGHITDWQLHNAREAY |
Ga0207659_106141242 | 3300025926 | Miscanthus Rhizosphere | MEKTAEQLYTDLLRLLASPSAVQPGVLADSFRDIERMHSMGHITDWQLHNAREAY |
Ga0207687_106287033 | 3300025927 | Miscanthus Rhizosphere | MEKTAEQVYTDLLRQLANPSAAQPVAVADMFREVERMHSAGQITDWQLENAREAYARTVS |
Ga0207644_101316753 | 3300025931 | Switchgrass Rhizosphere | MEKTAEQIYTDLLRQLASPSATQPGVLADMFRDVE |
Ga0207644_103118023 | 3300025931 | Switchgrass Rhizosphere | MEETAEQVYTDLLRQLASPSAAQPGALAEMFRDIERLHPMGRITDWQLENAREAYARTVS |
Ga0207644_116053642 | 3300025931 | Switchgrass Rhizosphere | MEKTAEQLYTDLLRQLANPSAIQPAVLADTFRDVERMHSM |
Ga0207706_104793521 | 3300025933 | Corn Rhizosphere | MEKTAAQLYTDLLRLLASPSAIQPEILADTFRDVERMHSMGHITDWQLHN |
Ga0207711_101971631 | 3300025941 | Switchgrass Rhizosphere | MEKTAEQVYTDLLCQVASPSASQPGVLADLFRDVERMHSM |
Ga0207711_102007233 | 3300025941 | Switchgrass Rhizosphere | MEKTAEQVYTDLLRQLASPAGTDPEVLANTFRDVAI |
Ga0207711_102629253 | 3300025941 | Switchgrass Rhizosphere | MEKTAEQLYTDLLRLLASPSAVQPAVLADTLRDVERMHSMGHITDWQLEKA |
Ga0207711_103582951 | 3300025941 | Switchgrass Rhizosphere | MEKTPEQVYTDLLRQLVSPSATQPGVLEDMFRDVERMHS |
Ga0207679_109478973 | 3300025945 | Corn Rhizosphere | MEKTAEQVYTDLLRQLASPSAVQPAVLADAFRDVERMHAMGHITDWQLRQARDAY |
Ga0207679_113025861 | 3300025945 | Corn Rhizosphere | MEKTAEQLYTDLLRLLGSPSAVQPAVLADSFRDVERLHSMGHITDWQPHN |
Ga0207651_100621617 | 3300025960 | Switchgrass Rhizosphere | MEKTAEQIYTDLLRQLASPSATKPGVLADMFCDVERMH |
Ga0207651_110293262 | 3300025960 | Switchgrass Rhizosphere | MEKTAEQLYTDLLRLLASPSAVQPAVLADTLRDVERMHSMGHI |
Ga0207712_118075261 | 3300025961 | Switchgrass Rhizosphere | MELSPEQVYTDLLRQLASPAGTAPEVLANAFRNVERMHSMGQI |
Ga0207677_103808061 | 3300026023 | Miscanthus Rhizosphere | MEKTAEQLYTDLLRLLASPSAVQPGVLADSFRDVERMHSMGHI |
Ga0207677_116049622 | 3300026023 | Miscanthus Rhizosphere | MEHSPEQVYTDLLRQLASPAGTTPEVLANAFRNVERM |
Ga0207703_104885994 | 3300026035 | Switchgrass Rhizosphere | MEKTAEQVYTDLLRQLASPSAVQPAVLADAFRDVERMHAMGHITDWQLRQARDAYEKTIE |
Ga0207703_124216622 | 3300026035 | Switchgrass Rhizosphere | MEKTAEQVYTDLLRQLASPSASQPGVLADLFRDVERMHSMGRIP |
Ga0207678_101802393 | 3300026067 | Corn Rhizosphere | MMIAMEKTAEQLYTDLLRLLANPSAVQPAVLADTFRDVERMH |
Ga0207641_100683256 | 3300026088 | Switchgrass Rhizosphere | MEKTAEQVYTDLLRQLASPSAVQPAVLADAFRDVERLHAMGHITDWQLRQARDAYEKTI |
Ga0207641_105958973 | 3300026088 | Switchgrass Rhizosphere | MEKTAEQVYTDLLRQLASPAGTDPEVLANTFRDFAI |
Ga0207648_101690651 | 3300026089 | Miscanthus Rhizosphere | MEKTAEQVYTDLLRQLASPSASRPGMLADLFRDVERCTQ |
Ga0207648_111895602 | 3300026089 | Miscanthus Rhizosphere | MMIAMEKTAEQLYTDLLRLLANPSAVQPAVLADTFRDVERMHSMGRI |
Ga0207675_1009765972 | 3300026118 | Switchgrass Rhizosphere | MMIAKEIVMEKTAEQLYTDLLRLLASPSAVQPAVLADTLRDVERMHSMGHITDWQLEK |
Ga0207698_100441871 | 3300026142 | Corn Rhizosphere | MEKTAEQVYTDLLRQLASPSAVQPAVLADAFRDVERLHAMGHITDWQLRRARD |
Ga0207698_116865752 | 3300026142 | Corn Rhizosphere | MDESPEQVYTTLLRQLASPVGKEPEVLASLFRDVERMHSMGQITDWQLHNAR |
Ga0207428_104062002 | 3300027907 | Populus Rhizosphere | VELRPEQVYTDLLRQWGSPAATAPEVLANAFRDVERMHSMGHIT |
Ga0268266_113976781 | 3300028379 | Switchgrass Rhizosphere | MEKTAEQLYTDLLRQLANPSAIQPAVLADTFRDVERMHSMGHITDWQLHNAREAYAKTIE |
Ga0247821_108326872 | 3300028596 | Soil | MEKTAEQLYTDLLRQLANPSAIQPAVLADTFRDVERMHSMGHITDRQLH |
Ga0247819_107180612 | 3300028608 | Soil | MEKTAEQLYTDLLRQLASPSAVQPDVLADTFRDVERMHSMGHIT |
Ga0311349_112985432 | 3300030294 | Fen | VEKTSEQMYSDLLLQLGSPTIVEPEVLVGYLRDVERMHSMGHITAWQLEHA |
Ga0102758_107673233 | 3300030784 | Soil | MEKTAEQVYTDLLRQLADPSAIQPAVLAQLFRDVERMHSMGHITDW |
Ga0308175_1021904321 | 3300031938 | Soil | MERSPEQIYTDLLRQLSSPAGTEPEVLANMFRDVERMHSMGQITDWQLENAREAYARTPG |
Ga0247829_100819021 | 3300033550 | Soil | MEKTAEQLYTDLLRQLASPSAVQPDVLADTFRDVERMHSMG |
⦗Top⦘ |