


| Basic Information | |
|---|---|
| Family ID | F073530 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MHKLVNGIQVPLTPEEIAQRQAEETAWNNGAFDRAMA |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 96.67 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (34.167 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (37.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (56.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.85% β-sheet: 12.31% Coil/Unstructured: 53.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02945 | Endonuclease_7 | 2.50 |
| PF03237 | Terminase_6N | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.50 % |
| Unclassified | root | N/A | 12.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2222084001|2222188265 | Not Available | 510 | Open in IMG/M |
| 2222084001|2222189133 | Not Available | 509 | Open in IMG/M |
| 3300004240|Ga0007787_10391608 | All Organisms → Viruses | 692 | Open in IMG/M |
| 3300005805|Ga0079957_1311328 | All Organisms → Viruses | 704 | Open in IMG/M |
| 3300006561|Ga0101389_1008714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 512 | Open in IMG/M |
| 3300006789|Ga0098054_1180424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 773 | Open in IMG/M |
| 3300006802|Ga0070749_10459078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 697 | Open in IMG/M |
| 3300006802|Ga0070749_10497842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P | 664 | Open in IMG/M |
| 3300006810|Ga0070754_10310233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 706 | Open in IMG/M |
| 3300006868|Ga0075481_10257863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P | 614 | Open in IMG/M |
| 3300006869|Ga0075477_10170930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 901 | Open in IMG/M |
| 3300006919|Ga0070746_10330125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 695 | Open in IMG/M |
| 3300006947|Ga0075444_10050503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1970 | Open in IMG/M |
| 3300007234|Ga0075460_10073206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1257 | Open in IMG/M |
| 3300007344|Ga0070745_1311775 | All Organisms → Viruses | 558 | Open in IMG/M |
| 3300007538|Ga0099851_1246103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 640 | Open in IMG/M |
| 3300007539|Ga0099849_1212040 | All Organisms → Viruses | 725 | Open in IMG/M |
| 3300007539|Ga0099849_1221490 | All Organisms → Viruses | 705 | Open in IMG/M |
| 3300007539|Ga0099849_1242155 | Not Available | 665 | Open in IMG/M |
| 3300007539|Ga0099849_1261122 | Not Available | 634 | Open in IMG/M |
| 3300007541|Ga0099848_1057467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1554 | Open in IMG/M |
| 3300007541|Ga0099848_1300836 | All Organisms → Viruses | 550 | Open in IMG/M |
| 3300007542|Ga0099846_1209527 | All Organisms → Viruses | 685 | Open in IMG/M |
| 3300007640|Ga0070751_1372665 | All Organisms → Viruses → environmental samples → uncultured virus | 519 | Open in IMG/M |
| 3300007960|Ga0099850_1081594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1349 | Open in IMG/M |
| 3300008012|Ga0075480_10110573 | All Organisms → Viruses → Predicted Viral | 1529 | Open in IMG/M |
| 3300008012|Ga0075480_10532555 | All Organisms → Viruses | 562 | Open in IMG/M |
| 3300008117|Ga0114351_1454814 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 516 | Open in IMG/M |
| 3300008266|Ga0114363_1203460 | All Organisms → Viruses | 605 | Open in IMG/M |
| 3300010151|Ga0098061_1111377 | All Organisms → Viruses | 1014 | Open in IMG/M |
| 3300010300|Ga0129351_1078548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1335 | Open in IMG/M |
| 3300010300|Ga0129351_1223753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 725 | Open in IMG/M |
| 3300010318|Ga0136656_1061597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1341 | Open in IMG/M |
| 3300010368|Ga0129324_10183367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 857 | Open in IMG/M |
| 3300010368|Ga0129324_10212934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 781 | Open in IMG/M |
| 3300010368|Ga0129324_10320354 | Not Available | 607 | Open in IMG/M |
| 3300011013|Ga0114934_10530609 | Not Available | 520 | Open in IMG/M |
| 3300013005|Ga0164292_10255462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1218 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10411358 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 840 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10745190 | All Organisms → Viruses | 575 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10577057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 730 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10177774 | All Organisms → Viruses → Predicted Viral | 1380 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10445305 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 735 | Open in IMG/M |
| 3300017722|Ga0181347_1121814 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 729 | Open in IMG/M |
| 3300017761|Ga0181356_1138159 | All Organisms → Viruses | 764 | Open in IMG/M |
| 3300017761|Ga0181356_1144935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 739 | Open in IMG/M |
| 3300017769|Ga0187221_1142049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 714 | Open in IMG/M |
| 3300017773|Ga0181386_1202969 | Not Available | 595 | Open in IMG/M |
| 3300017774|Ga0181358_1024223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 2404 | Open in IMG/M |
| 3300017777|Ga0181357_1293023 | All Organisms → Viruses | 555 | Open in IMG/M |
| 3300017785|Ga0181355_1076400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1403 | Open in IMG/M |
| 3300017785|Ga0181355_1152716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P → Pelagibacter phage HTVC019P | 931 | Open in IMG/M |
| 3300017952|Ga0181583_10396130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 860 | Open in IMG/M |
| 3300017962|Ga0181581_10377694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 895 | Open in IMG/M |
| 3300017969|Ga0181585_10613400 | Not Available | 719 | Open in IMG/M |
| 3300018424|Ga0181591_11055771 | Not Available | 549 | Open in IMG/M |
| 3300019784|Ga0181359_1058235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1482 | Open in IMG/M |
| 3300019784|Ga0181359_1188325 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 675 | Open in IMG/M |
| 3300020172|Ga0211729_10256292 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 509 | Open in IMG/M |
| 3300020183|Ga0194115_10056072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 2446 | Open in IMG/M |
| 3300020190|Ga0194118_10468502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P → Pelagibacter phage HTVC019P | 615 | Open in IMG/M |
| 3300020196|Ga0194124_10344407 | All Organisms → Viruses | 702 | Open in IMG/M |
| 3300020220|Ga0194119_10460047 | All Organisms → Viruses | 810 | Open in IMG/M |
| 3300020527|Ga0208232_1003579 | All Organisms → Viruses → Predicted Viral | 2657 | Open in IMG/M |
| 3300020530|Ga0208235_1043133 | All Organisms → Viruses | 527 | Open in IMG/M |
| 3300020536|Ga0207939_1035826 | All Organisms → Viruses | 636 | Open in IMG/M |
| 3300020557|Ga0208231_1034349 | All Organisms → Viruses | 831 | Open in IMG/M |
| 3300021424|Ga0194117_10061595 | All Organisms → Viruses | 2119 | Open in IMG/M |
| 3300021959|Ga0222716_10716591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 529 | Open in IMG/M |
| 3300021960|Ga0222715_10393206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 760 | Open in IMG/M |
| 3300021961|Ga0222714_10163223 | All Organisms → Viruses | 1322 | Open in IMG/M |
| 3300021961|Ga0222714_10468616 | All Organisms → Viruses | 652 | Open in IMG/M |
| 3300021961|Ga0222714_10661403 | All Organisms → Viruses | 514 | Open in IMG/M |
| 3300021964|Ga0222719_10003871 | Not Available | 13217 | Open in IMG/M |
| 3300022065|Ga0212024_1011691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1326 | Open in IMG/M |
| 3300022065|Ga0212024_1018511 | All Organisms → Viruses | 1119 | Open in IMG/M |
| 3300022069|Ga0212026_1042628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 680 | Open in IMG/M |
| 3300022071|Ga0212028_1036915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 901 | Open in IMG/M |
| 3300022071|Ga0212028_1051602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 767 | Open in IMG/M |
| 3300022167|Ga0212020_1043119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 765 | Open in IMG/M |
| 3300022167|Ga0212020_1071825 | All Organisms → Viruses | 583 | Open in IMG/M |
| 3300022179|Ga0181353_1117777 | All Organisms → Viruses | 638 | Open in IMG/M |
| 3300022187|Ga0196899_1096979 | All Organisms → Viruses | 879 | Open in IMG/M |
| 3300022200|Ga0196901_1153997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 763 | Open in IMG/M |
| 3300022407|Ga0181351_1182654 | All Organisms → Viruses | 720 | Open in IMG/M |
| 3300025045|Ga0207901_1058660 | Not Available | 503 | Open in IMG/M |
| 3300025103|Ga0208013_1024161 | All Organisms → Viruses | 1779 | Open in IMG/M |
| 3300025108|Ga0208793_1058559 | All Organisms → Viruses | 1164 | Open in IMG/M |
| 3300025543|Ga0208303_1083577 | Not Available | 703 | Open in IMG/M |
| 3300025646|Ga0208161_1019846 | All Organisms → Viruses | 2549 | Open in IMG/M |
| 3300025674|Ga0208162_1093810 | All Organisms → Viruses | 905 | Open in IMG/M |
| 3300025687|Ga0208019_1058614 | All Organisms → Viruses → Predicted Viral | 1301 | Open in IMG/M |
| 3300025687|Ga0208019_1114655 | All Organisms → Viruses | 806 | Open in IMG/M |
| 3300025687|Ga0208019_1130767 | All Organisms → Viruses | 731 | Open in IMG/M |
| 3300025759|Ga0208899_1061840 | All Organisms → Viruses | 1545 | Open in IMG/M |
| 3300025818|Ga0208542_1125874 | All Organisms → Viruses | 715 | Open in IMG/M |
| 3300025853|Ga0208645_1092233 | All Organisms → Viruses | 1278 | Open in IMG/M |
| 3300025853|Ga0208645_1204487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 696 | Open in IMG/M |
| 3300025889|Ga0208644_1338509 | Not Available | 580 | Open in IMG/M |
| 3300026138|Ga0209951_1035335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1091 | Open in IMG/M |
| 3300027736|Ga0209190_1165958 | All Organisms → Viruses | 941 | Open in IMG/M |
| 3300027744|Ga0209355_1279308 | Not Available | 643 | Open in IMG/M |
| 3300027808|Ga0209354_10073838 | All Organisms → Viruses → Predicted Viral | 1384 | Open in IMG/M |
| 3300027917|Ga0209536_101292670 | All Organisms → cellular organisms → Archaea | 893 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1142649 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 934 | Open in IMG/M |
| 3300029448|Ga0183755_1085078 | Not Available | 663 | Open in IMG/M |
| 3300031951|Ga0315904_10793209 | All Organisms → Viruses | 781 | Open in IMG/M |
| 3300032053|Ga0315284_11231555 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 819 | Open in IMG/M |
| 3300032401|Ga0315275_11578410 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 703 | Open in IMG/M |
| 3300033233|Ga0334722_10245118 | All Organisms → Viruses | 1317 | Open in IMG/M |
| 3300033981|Ga0334982_0529611 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 517 | Open in IMG/M |
| 3300034062|Ga0334995_0511868 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 719 | Open in IMG/M |
| 3300034102|Ga0335029_0065974 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2618 | Open in IMG/M |
| 3300034110|Ga0335055_0150431 | All Organisms → Viruses | 1050 | Open in IMG/M |
| 3300034122|Ga0335060_0066538 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2234 | Open in IMG/M |
| 3300034374|Ga0348335_070321 | All Organisms → Viruses | 1228 | Open in IMG/M |
| 3300034375|Ga0348336_072002 | All Organisms → Viruses | 1292 | Open in IMG/M |
| 3300034418|Ga0348337_134038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 732 | Open in IMG/M |
| 3300034418|Ga0348337_139907 | All Organisms → Viruses | 704 | Open in IMG/M |
| 3300034418|Ga0348337_147435 | All Organisms → Viruses | 671 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 37.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.17% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.17% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.33% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.67% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.67% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Oil-Contaminated → Marine | 1.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.67% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.83% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.83% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.83% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.83% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.83% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2222084001 | Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Dispersant | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006561 | Marine microbial communities from the Black Sea in Odessa region - Od_1 | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2222224352 | 2222084001 | Marine | MPHKIVNGQQIELTAEEIAQRQTEESAWLGGAYQRAMNDLKTKRK |
| 2222225600 | 2222084001 | Marine | MPHKIVNGQQIELTAEEIAQRQTEESAWLGGAYQRAMNDLRQKEIACYLLQI |
| Ga0007787_103916082 | 3300004240 | Freshwater Lake | MEHKLVDGVKVILSDAEIAQRQAEESSWNAGAFDRAINNLRQRRNA |
| Ga0079957_13113281 | 3300005805 | Lake | MAQYKLVDGVEIELSPQEIAQRKAEEDAWKAGAFDRAIAG |
| Ga0101389_10087141 | 3300006561 | Marine | MEHKLINGIKVPLTAEEIAQRQAEETAWNNGAFDR |
| Ga0098054_11804243 | 3300006789 | Marine | MHKIVNGQRVELTAEEISQRETEEAAWQAGAFDRSMVE |
| Ga0070749_104590781 | 3300006802 | Aqueous | MEHKIVNGIQVPLTAEEIAQRQAEESAWLGGAYQR |
| Ga0070749_104978422 | 3300006802 | Aqueous | MHKLVNGIKVDLTAEEIAQRQQDEIAWNNGAFDRAMA |
| Ga0070754_103102332 | 3300006810 | Aqueous | MTTPHKLVNGQIVPLTAEEIAQRQQDEIAWNNGAF |
| Ga0075481_102578632 | 3300006868 | Aqueous | MHKLVNGIKVDLTAEEIAQRQQDEIAWNNGAFDRAMADLR |
| Ga0075477_101709303 | 3300006869 | Aqueous | MEHKIINGIQVPLTAEEIAQRQAEESAWLGGAYQR |
| Ga0070746_103301251 | 3300006919 | Aqueous | MEHKIVNGIQVPLTAKEIAQRQAEEANWNAGAFDRAMNDL |
| Ga0075444_100505031 | 3300006947 | Marine | MKKLVNGILVDLTAEEITARQAEETAWSNGALDRALDNL |
| Ga0075460_100732061 | 3300007234 | Aqueous | MPHKLVNGQIVELTPEEIAQRQEADAAWNAGAFDRAMADLRSK |
| Ga0070745_13117751 | 3300007344 | Aqueous | MEHKIVNGIQVPLTAEEIAQRQAEESAWLGGAYQRAMNDLRQK |
| Ga0099851_12461031 | 3300007538 | Aqueous | MHKLVNGIQIPLTPEEIAQRQQDEIAWNNGAFDRAIAD |
| Ga0099849_12120402 | 3300007539 | Aqueous | MPHKLVNGIQVELTEAEIAARAAEEAAWNAGAFDRA |
| Ga0099849_12214902 | 3300007539 | Aqueous | MPHKLVNGIQVELTAEEIAARAAEEAAWNAGAFDRAMS |
| Ga0099849_12421551 | 3300007539 | Aqueous | MTHKLVNGVQVELTPEEIAARAAEEAAWNAGTFDRAMAD |
| Ga0099849_12611222 | 3300007539 | Aqueous | MPHKLVNGQIVELTPEEIAQRQAEETAWNNGAFDRAMA |
| Ga0099848_10574673 | 3300007541 | Aqueous | MVEHKLIDGVQVPLTAEEIAQRQADELAWSAGAFDR |
| Ga0099848_13008362 | 3300007541 | Aqueous | MPHKLVNGVKVELTPQEIAQRQAEETAWANGAFDRAMSSL |
| Ga0099846_12095271 | 3300007542 | Aqueous | MEHKIVNGIQVPLTAEEIAQRQAEESAWLGGAYQRAMNDLRQKRNA |
| Ga0070751_13726651 | 3300007640 | Aqueous | MHKLVNGIKVDLTAEEIAQRQQDEIAWNNGAFDRAM |
| Ga0099850_10815943 | 3300007960 | Aqueous | MPHKIVNGQQVELTAEEIAAIAAQETAWNAGAFDRSMAELRSK |
| Ga0075480_101105734 | 3300008012 | Aqueous | MKKMVNGVLVDMTPEEITEKEQDIATWNEGAFDRSMENLRFK |
| Ga0075480_105325552 | 3300008012 | Aqueous | MHKLVNGIQVELTEAEIAARAAEEAAWNAGAFDRAMADLRQ |
| Ga0114351_14548141 | 3300008117 | Freshwater, Plankton | MEHKLVDGKVIPLTAQEIKQRQAEATAWEAGSFDRALAS |
| Ga0114363_12034602 | 3300008266 | Freshwater, Plankton | MEHKLVDGVKVVLSDAEIAQRQAEEIAWNNGAFDRAI |
| Ga0098061_11113771 | 3300010151 | Marine | MHKIVNGQRVELTAEEIAQKEADEAAWQAGAFDRSMTELRSRRNQLL |
| Ga0129351_10785483 | 3300010300 | Freshwater To Marine Saline Gradient | MPHKLVNGIQVELTEAEIAARAAEEAAWNAGAFDRAMA |
| Ga0129351_12237531 | 3300010300 | Freshwater To Marine Saline Gradient | MHKLVNGIQVPLTPEEIAQRQAEETAWNNGAFDRAMA |
| Ga0136656_10615971 | 3300010318 | Freshwater To Marine Saline Gradient | MAHKLVNGVQVELTAEEIAVRAAEEAAWNAGAFDRAMAD |
| Ga0129324_101833673 | 3300010368 | Freshwater To Marine Saline Gradient | MHKLVNGIKVDLTPEEIAQRQAEETAWNNGAFDRAMADLRSK |
| Ga0129324_102129342 | 3300010368 | Freshwater To Marine Saline Gradient | MTTPHKLVDGVQIPLSQEEIAQRQAEETAWNAGAFDRAMADLRQR |
| Ga0129324_103203542 | 3300010368 | Freshwater To Marine Saline Gradient | MTTPHKLVDGVQIPLTQEEIAQRQAEETAWNNGAFDRAMADLR |
| Ga0114934_105306092 | 3300011013 | Deep Subsurface | MAHKIVNGQQVELTADEIAAIAAQETAWNDGAFDRKMQDIRQQ |
| Ga0164292_102554623 | 3300013005 | Freshwater | MVEHKLVDGVQIELTAQEIAQRQAEATAWANGAFDRAIAGLRS |
| (restricted) Ga0172373_104113581 | 3300013131 | Freshwater | MEHKLVDGIQIPLSAEEIAQRQADELAWQNGAFDRSISS |
| (restricted) Ga0172373_107451902 | 3300013131 | Freshwater | MEHKLVDGIQIPLSAEEIAQRQADELAWQNGAFDR |
| (restricted) Ga0172372_105770571 | 3300013132 | Freshwater | MEHKLVDGIQIPLSAEEIAQRQTEEAAWNAGAFDRALASL |
| (restricted) Ga0172376_101777741 | 3300014720 | Freshwater | MAEHKLVDGIQIPLSAEEIAQRQADEIAWQNGAFDRAMSALRLKRNS |
| (restricted) Ga0172376_104453052 | 3300014720 | Freshwater | MAEHKLVDGIQIPLSAEEIAQRQADELAWQNGAFDRAMSA |
| Ga0181347_11218141 | 3300017722 | Freshwater Lake | MAEHKLVDGIQIPLSAEEIAQRQAEEIAWNNGAFDRSLA |
| Ga0181356_11381592 | 3300017761 | Freshwater Lake | MAEHKLVDGVAIELSAQEISQRQAEATAWANGAFDRAIAGLRSKR |
| Ga0181356_11449351 | 3300017761 | Freshwater Lake | MAEHKLVDGIQIPLSAEEIAQRQADEIAWNNGAFDRSLASLRAKRNSL |
| Ga0187221_11420492 | 3300017769 | Seawater | MAHKIVDGVQVELTADEIAAIAANEQAWNDGAYDRKMSDIRQERNRL |
| Ga0181386_12029691 | 3300017773 | Seawater | MAHKIVNGQQVELTADEIAAIAAQEQVWNDGAFDRKMQDF |
| Ga0181358_10242231 | 3300017774 | Freshwater Lake | MAEHKLVDGIQIPLSAEEIAQRQADETAWNAGAFNRSLASLRAKRN |
| Ga0181357_12930231 | 3300017777 | Freshwater Lake | MAEHKLVDGVEIELTAQEIAQRKADEDAWKAGTFDRAIAGLRQKRN |
| Ga0181355_10764003 | 3300017785 | Freshwater Lake | MAEHKLVDGIQIPLSAEEIAQRQAEEIAWNNGAFDRSLAS |
| Ga0181355_11527163 | 3300017785 | Freshwater Lake | MAEHKLVDGVKVILSDAEIAQRQAEEIAWNNGAFDRSLASLRAKRNSLL |
| Ga0181583_103961301 | 3300017952 | Salt Marsh | MPHKIVNGQQIELTAEEIAQRQAEESAWLGGAYQR |
| Ga0181581_103776943 | 3300017962 | Salt Marsh | MPHKIVNGQQVELTAEEIAARTAEETAWNAGAFDRAMAEL |
| Ga0181585_106134002 | 3300017969 | Salt Marsh | MKKLVNGVLVDLTAEEIAQKQADETGWNNGAFDRSMANLRA |
| Ga0181591_110557712 | 3300018424 | Salt Marsh | MSHKIVNGQQVELTADEIAAIAAQETAWNAGAFDRAMSELRSKRDR |
| Ga0181359_10582351 | 3300019784 | Freshwater Lake | MAEHKLVDGVQIELTAQEIAQRQAEATAWANGAFDRAIAGLRSKRNS |
| Ga0181359_11883252 | 3300019784 | Freshwater Lake | MAEHKLVDGIQIPLSAEEIAQRQAEEIAWNNGASSSFP |
| Ga0211729_102562921 | 3300020172 | Freshwater | MAEHKLVDGVQIELTSQEIAQRQAEATAWANGAFDRAI |
| Ga0194115_100560725 | 3300020183 | Freshwater Lake | MEHKLVDGIKIPLTAQEIAQRQAEATAWANGAFDRAMASLRVRRN |
| Ga0194118_104685021 | 3300020190 | Freshwater Lake | MEHKLVDGIKIPLTAQEIAQRQAEATAWANGAFDRAMASLRLRRNA |
| Ga0194124_103444072 | 3300020196 | Freshwater Lake | MEHKLVDGIKIPLTAQEIAQRQAEATAWANGAFDRAM |
| Ga0194119_104600471 | 3300020220 | Freshwater Lake | MEHKLVDGIKIPLTAQEIAQRQAEATAWANGAFDRAMASLR |
| Ga0208232_10035791 | 3300020527 | Freshwater | MAEHKLVDGVKIELTSQEITQRQAEATAWANGAFDRA |
| Ga0208235_10431331 | 3300020530 | Freshwater | MAEHKLVDGVKIELTAQEIAQRQAEATAWANGAFDRAIAGLRQK |
| Ga0207939_10358261 | 3300020536 | Freshwater | MAEHKLVDGVQIELTAQEIAQRQAEATAWANGAFDRAIAGLR |
| Ga0208231_10343491 | 3300020557 | Freshwater | MAEHKLVDGVKIELTSQEITQRQAEATAWANGAFDRAIA |
| Ga0194117_100615954 | 3300021424 | Freshwater Lake | MEHKLVDGIKIPLTAQEIAQRQAEATAWANGAFDRAP |
| Ga0222716_107165911 | 3300021959 | Estuarine Water | MTTPHKLVDGVQIPLTQEEIAQRQQDEIAWNNGAFDRAM |
| Ga0222715_103932061 | 3300021960 | Estuarine Water | MHKLVNGIKVELTAEEIAQRQAEELAWLDGAFDRAMAD |
| Ga0222714_101632233 | 3300021961 | Estuarine Water | MEHKIVNGIQVPLTAEEIAQRQAEESAWLGGAYQRAMN |
| Ga0222714_104686162 | 3300021961 | Estuarine Water | MEHKLVDGVKVILSDAEIAQRQADEIAWNNGAFDRAMVA |
| Ga0222714_106614031 | 3300021961 | Estuarine Water | MPHKLVNGIQVELTEAEIAARAAEEAAWNNGAFDRAMADL |
| Ga0222719_100038711 | 3300021964 | Estuarine Water | MSTKLINGIRVNLTAEEITARQAEETAWNNGAYDRAMK |
| Ga0212024_10116913 | 3300022065 | Aqueous | MTTPHKLVDGVQIPLTQEEIAQRQAEETAWNNGAFDRAI |
| Ga0212024_10185111 | 3300022065 | Aqueous | MHKLVNGIQVPLTPEEIAQRQAEEQAWNAGAFDRA |
| Ga0212026_10426281 | 3300022069 | Aqueous | MTAPHKLVNGQIVPLTAEEIAQRQQDEIAWNNGAFDI |
| Ga0212028_10369153 | 3300022071 | Aqueous | MTTPHKLVDGVQIPLTQEEIAQRQAEETAWNNGAFDRAMADF |
| Ga0212028_10516022 | 3300022071 | Aqueous | MHKLVNGIQVPLTPEEIAQRQQDEIAWNNGAFDRAMADF |
| Ga0212020_10431191 | 3300022167 | Aqueous | MEHKLVNGQIVPLTPEEIAQRQEADAAWNAGAFDRAMADL |
| Ga0212020_10718251 | 3300022167 | Aqueous | MAHKLVNGVQVELTPEEIAARAAEEAAWNAGAFDRAMA |
| Ga0181353_11177772 | 3300022179 | Freshwater Lake | MVDHKLVDGVKVVLSDAEIAQRQAEEAAWNAGAFDRAINNLRQRR |
| Ga0196899_10969793 | 3300022187 | Aqueous | MTTPHKLVDGVQIPLTQEEIAARAAEEAAWNAGAFDRAMADLRS |
| Ga0196901_11539971 | 3300022200 | Aqueous | MHKLVNGIQVPLTPEEIAQRQAEETAWNNGAFDRSM |
| Ga0181351_11826542 | 3300022407 | Freshwater Lake | MAEHKLVDGIQIPLSAEEIAQRQAEEIAWNNGAFDRSLSSLR |
| Ga0207901_10586601 | 3300025045 | Marine | MARHKLVNGIRVEFTQAEETARDAEEQIWRDGAFNR |
| Ga0208013_10241611 | 3300025103 | Marine | MHKIVNGQRVELTDAEVEQREAEEAAWNAGAFYRSIA |
| Ga0208793_10585593 | 3300025108 | Marine | MHKIVNGQRVELTDAEVEQREAEEAAWNAGAFDRSIANLR |
| Ga0208303_10835771 | 3300025543 | Aqueous | MPHKLVNGQIVELTPEEIAQRQQDEIAWNNGAFDRAMADLR |
| Ga0208161_10198461 | 3300025646 | Aqueous | MPHKLVNGIKVELTAEEIAARAAEEAAWNAGAFDRA |
| Ga0208162_10938101 | 3300025674 | Aqueous | MAHKLVNGVQVQLTPEEIAARAAEEAVWNAGAFDRAMADLRG |
| Ga0208019_10586141 | 3300025687 | Aqueous | MHKLVNGIQVPLTPEEIAQRQAEEAAWNAGAFDRAMADLR |
| Ga0208019_11146551 | 3300025687 | Aqueous | MPHKLVDGVKIELTPQEIAQRQAEEAAWNAGAFDRAM |
| Ga0208019_11307671 | 3300025687 | Aqueous | MPHKLVNGIQVELTEAEIAARAAEEAAWNAGAFDRAMADLR |
| Ga0208899_10618404 | 3300025759 | Aqueous | MPHKIVNGQQVELTAEEIAQRQADETVWNNGAKDRAVA |
| Ga0208542_11258741 | 3300025818 | Aqueous | MPHKLVDGVKIELTPQEIAQRQAEEAAWNAGAFDRAMSSLRQ |
| Ga0208645_10922331 | 3300025853 | Aqueous | MHKLVNGIKVDLTAEEIAQRQQDKIAWNNGAFDRAM |
| Ga0208645_12044872 | 3300025853 | Aqueous | MHKLVNGIKVDLTAEEIAQRQQDEIAWNNGAFDRAMAD |
| Ga0208644_13385091 | 3300025889 | Aqueous | MAHKLVNGVQVELTAEEIAARAAEEAAWNAGAFDRA |
| Ga0209951_10353353 | 3300026138 | Pond Water | MTTPHKLVNGQIIPLTAEEIAQRQAEEIAWNNGAFDRAMA |
| Ga0209190_11659582 | 3300027736 | Freshwater Lake | MAEHKLVDGIQIPLSAEEIAQRQAEEIAWNAGAFDRSLASLRQKRNALLSSTDYQALV |
| Ga0209355_12793082 | 3300027744 | Freshwater Lake | MKKIVNGIEIELTSEEIAIKQAEELAWNNGAFDRAIK |
| Ga0209354_100738383 | 3300027808 | Freshwater Lake | MAEHKLVDGIQIPLSAEEIAQRQAEEIAWNNGAFDRSLASLRAKRNS |
| Ga0209536_1012926702 | 3300027917 | Marine Sediment | MEHKIVNGIQVPLTAEEIAQRQAEESAWLASAFDR |
| (restricted) Ga0247832_11426492 | 3300028557 | Freshwater | MEHKLVDGIQIPLSAEEIAQRQADDLAWQNGAFDRALASLRAKRN |
| Ga0183755_10850781 | 3300029448 | Marine | MPHKIVNGQQVELTAEEISARQTEEAAWNAGAFDRSMAELRSK |
| Ga0315904_107932092 | 3300031951 | Freshwater | MEHKLIDGVKVPLTAQEIAQRQAEESSWNAGAFDRAINNL |
| Ga0315284_112315551 | 3300032053 | Sediment | MAEHKLVDGVEILLSPQEIAQRQAEATAWANGAFDRA |
| Ga0315275_115784101 | 3300032401 | Sediment | MEHKLVDGIQIPLSAEEIAQRQADEIAWNNGAFDRSLASLRAKR |
| Ga0334722_102451183 | 3300033233 | Sediment | MAEHKLVDGIQIPLSAEEIAQRQAEEIAWNNGAFDRS |
| Ga0334982_0529611_407_517 | 3300033981 | Freshwater | MAEHKLVDGIQIPLSAEEIAQRQAEEIAWNNGAFDRA |
| Ga0334995_0511868_601_717 | 3300034062 | Freshwater | MAEHKLVDGVKVVLSDAEIAQRQADEIAWNNGAFDRSLA |
| Ga0335029_0065974_2489_2617 | 3300034102 | Freshwater | MAEHKLVDGIQIPLSAEEIAQRQAEEIAWNNGAFDRSLASLRQ |
| Ga0335055_0150431_938_1048 | 3300034110 | Freshwater | MEHKLVDGIQIPLSAEEIAQRQADEIAWNNGAFDRSL |
| Ga0335060_0066538_2104_2232 | 3300034122 | Freshwater | MAEHKLVDGVKVILSDAEIAQRQAEEIAWNNGAFDRAIAGLRS |
| Ga0348335_070321_1_111 | 3300034374 | Aqueous | MHKLVNGIQVPLTPEEIAQRQAEEQAWNAGAFDRAMA |
| Ga0348336_072002_1160_1291 | 3300034375 | Aqueous | MPHKLVNGVKVELTPQEIAQRQAEETAWNAGAFDRAMSSLRQRR |
| Ga0348337_134038_610_732 | 3300034418 | Aqueous | MHKLVNGIQVPLTPEEIAQRQQDEIAWNNGAFDRAMADLRQ |
| Ga0348337_139907_1_114 | 3300034418 | Aqueous | MHKLVNGIQVPLTPEEIAQRQQDEIAWNNGAFDRAMAD |
| Ga0348337_147435_2_112 | 3300034418 | Aqueous | MEHKIVNGIQVPLTAEEIAQRQAEESAWLGGAYQRAM |
| ⦗Top⦘ |