NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073362

Metagenome / Metatranscriptome Family F073362

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073362
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 44 residues
Representative Sequence MPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP
Number of Associated Samples 97
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.83 %
% of genes near scaffold ends (potentially truncated) 21.67 %
% of genes from short scaffolds (< 2000 bps) 85.83 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(23.333 % of family members)
Environment Ontology (ENVO) Unclassified
(26.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(53.333 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF07690MFS_1 29.17
PF03551PadR 5.83
PF07366SnoaL 4.17
PF10881DUF2726 1.67
PF00561Abhydrolase_1 1.67
PF12172DUF35_N 0.83
PF00027cNMP_binding 0.83
PF02371Transposase_20 0.83
PF07676PD40 0.83
PF12898Stc1 0.83
PF13683rve_3 0.83
PF05977MFS_3 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 5.83
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 5.83
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 5.83
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.83
COG3547TransposaseMobilome: prophages, transposons [X] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.67 %
UnclassifiedrootN/A18.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_109423195Not Available580Open in IMG/M
3300005172|Ga0066683_10162550Not Available1374Open in IMG/M
3300005180|Ga0066685_10297305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1117Open in IMG/M
3300005181|Ga0066678_10123706All Organisms → cellular organisms → Bacteria1592Open in IMG/M
3300005293|Ga0065715_10010473All Organisms → cellular organisms → Bacteria2305Open in IMG/M
3300005293|Ga0065715_10180837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1469Open in IMG/M
3300005336|Ga0070680_101421800All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300005438|Ga0070701_10489280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria797Open in IMG/M
3300005440|Ga0070705_101492007All Organisms → cellular organisms → Bacteria → Proteobacteria566Open in IMG/M
3300005445|Ga0070708_101057362All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005445|Ga0070708_101439231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium642Open in IMG/M
3300005446|Ga0066686_10082632All Organisms → cellular organisms → Bacteria2037Open in IMG/M
3300005467|Ga0070706_100483024All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300005468|Ga0070707_100375848All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300005468|Ga0070707_101841084All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005518|Ga0070699_100626399All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300005540|Ga0066697_10809754All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005549|Ga0070704_101339972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium655Open in IMG/M
3300005555|Ga0066692_10530463All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300005556|Ga0066707_10934293All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria531Open in IMG/M
3300005558|Ga0066698_10319688Not Available1074Open in IMG/M
3300005559|Ga0066700_10213696All Organisms → cellular organisms → Bacteria1337Open in IMG/M
3300005569|Ga0066705_10642500All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300005574|Ga0066694_10175997All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300005840|Ga0068870_10589933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria754Open in IMG/M
3300006049|Ga0075417_10029142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2274Open in IMG/M
3300006049|Ga0075417_10065980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1594Open in IMG/M
3300006791|Ga0066653_10645545All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300006844|Ga0075428_100292849All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300006845|Ga0075421_100107744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3503Open in IMG/M
3300006852|Ga0075433_10979926All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria737Open in IMG/M
3300006852|Ga0075433_11555819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium571Open in IMG/M
3300006871|Ga0075434_101341485All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300006880|Ga0075429_100028052All Organisms → cellular organisms → Bacteria4886Open in IMG/M
3300006880|Ga0075429_101613078Not Available564Open in IMG/M
3300006894|Ga0079215_10243935All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300006918|Ga0079216_10320075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium929Open in IMG/M
3300006918|Ga0079216_10557197Not Available775Open in IMG/M
3300006918|Ga0079216_10998017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium646Open in IMG/M
3300006969|Ga0075419_10857349All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300007004|Ga0079218_11782704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium688Open in IMG/M
3300007004|Ga0079218_13524185Not Available531Open in IMG/M
3300007255|Ga0099791_10019069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2938Open in IMG/M
3300009012|Ga0066710_100027917All Organisms → cellular organisms → Bacteria6484Open in IMG/M
3300009038|Ga0099829_10840593All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla762Open in IMG/M
3300009088|Ga0099830_10879267Not Available741Open in IMG/M
3300009090|Ga0099827_11211898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium656Open in IMG/M
3300009137|Ga0066709_100558834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1623Open in IMG/M
3300009147|Ga0114129_10314382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2084Open in IMG/M
3300009147|Ga0114129_10381365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1862Open in IMG/M
3300009162|Ga0075423_10431684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1383Open in IMG/M
3300009814|Ga0105082_1087378Not Available573Open in IMG/M
3300010333|Ga0134080_10099572All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300010333|Ga0134080_10515629Not Available570Open in IMG/M
3300010336|Ga0134071_10130128Not Available1215Open in IMG/M
3300010373|Ga0134128_10421569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1490Open in IMG/M
3300010399|Ga0134127_10316140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1511Open in IMG/M
3300010399|Ga0134127_10628658All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300011270|Ga0137391_10734834Not Available818Open in IMG/M
3300012096|Ga0137389_10556735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium985Open in IMG/M
3300012199|Ga0137383_11249619Not Available532Open in IMG/M
3300012204|Ga0137374_10345980All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300012204|Ga0137374_10485434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium963Open in IMG/M
3300012204|Ga0137374_10507125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium936Open in IMG/M
3300012204|Ga0137374_10657831Not Available792Open in IMG/M
3300012205|Ga0137362_10624613All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300012208|Ga0137376_10673069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium893Open in IMG/M
3300012211|Ga0137377_10047032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3974Open in IMG/M
3300012355|Ga0137369_10336539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1107Open in IMG/M
3300012355|Ga0137369_10366154All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300012356|Ga0137371_10209076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1527Open in IMG/M
3300012358|Ga0137368_10565088All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300012359|Ga0137385_10951458All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300012360|Ga0137375_10115725All Organisms → cellular organisms → Bacteria2693Open in IMG/M
3300012360|Ga0137375_10498449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1037Open in IMG/M
3300012361|Ga0137360_11172972All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300012532|Ga0137373_10291292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1301Open in IMG/M
3300012918|Ga0137396_10795445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium696Open in IMG/M
3300012918|Ga0137396_10822697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium683Open in IMG/M
3300012922|Ga0137394_11566047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria516Open in IMG/M
3300017656|Ga0134112_10343545Not Available607Open in IMG/M
3300017656|Ga0134112_10410255Not Available561Open in IMG/M
3300017659|Ga0134083_10177069All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300017997|Ga0184610_1010482All Organisms → cellular organisms → Bacteria2319Open in IMG/M
3300017997|Ga0184610_1114553All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300018000|Ga0184604_10121508Not Available833Open in IMG/M
3300018027|Ga0184605_10151883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1042Open in IMG/M
3300018031|Ga0184634_10015796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2781Open in IMG/M
3300018054|Ga0184621_10250863All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300018056|Ga0184623_10011500All Organisms → cellular organisms → Bacteria3832Open in IMG/M
3300018056|Ga0184623_10437867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi568Open in IMG/M
3300018071|Ga0184618_10258071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium738Open in IMG/M
3300018074|Ga0184640_10491434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi541Open in IMG/M
3300018076|Ga0184609_10485269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium564Open in IMG/M
3300018082|Ga0184639_10209864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1033Open in IMG/M
3300018431|Ga0066655_10447210Not Available853Open in IMG/M
3300018469|Ga0190270_12310426All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300019255|Ga0184643_1189098All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300022694|Ga0222623_10164420Not Available864Open in IMG/M
3300025167|Ga0209642_10587684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium607Open in IMG/M
3300025910|Ga0207684_11089482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_3_70_6665Open in IMG/M
3300025922|Ga0207646_10033832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4620Open in IMG/M
3300025922|Ga0207646_10487482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1111Open in IMG/M
3300025942|Ga0207689_10928932Not Available734Open in IMG/M
3300026041|Ga0207639_11557595All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300026089|Ga0207648_10269184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1522Open in IMG/M
3300026548|Ga0209161_10466680All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300027655|Ga0209388_1015562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2091Open in IMG/M
3300027691|Ga0209485_1175046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium655Open in IMG/M
3300027695|Ga0209966_1035726All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300027738|Ga0208989_10145247Not Available798Open in IMG/M
3300027862|Ga0209701_10342856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium848Open in IMG/M
3300027873|Ga0209814_10026010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2395Open in IMG/M
3300027880|Ga0209481_10188902Not Available1027Open in IMG/M
3300028717|Ga0307298_10153007All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300028796|Ga0307287_10163604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium845Open in IMG/M
3300028819|Ga0307296_10516626Not Available653Open in IMG/M
3300031965|Ga0326597_10133557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2982Open in IMG/M
3300031965|Ga0326597_11753576All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300034773|Ga0364936_126973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium516Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil23.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment10.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.67%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.83%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.83%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300034773Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10942319523300000956SoilMPGKNKFGDDDRPPRDDCPKCGVKLTQGEKDSERCRNGHALP*
Ga0066683_1016255033300005172SoilMPGKKKFGDDAEQPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0066685_1029730523300005180SoilMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSESCRNGHPLT*
Ga0066678_1012370633300005181SoilRRYAMPGKKKFGDDAEEPDRDHCPKCGVKLTQGEMDSERCRDGHPLA*
Ga0065715_1001047313300005293Miscanthus RhizosphereMPGKKKFGDDEEEPXRDHCPKCGVKLTQGEKDSERCRNGHALA*
Ga0065715_1018083713300005293Miscanthus RhizosphereMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0070680_10142180013300005336Corn RhizosphereMPGKKKFGDDEEEPDRDHCPRCGVKLTQGEKDSERCRNGHALP*
Ga0070701_1048928023300005438Corn, Switchgrass And Miscanthus RhizosphereMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALS*
Ga0070705_10149200723300005440Corn, Switchgrass And Miscanthus RhizosphereMPGKKKFGGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHTLT*
Ga0070708_10105736223300005445Corn, Switchgrass And Miscanthus RhizosphereMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0070708_10143923123300005445Corn, Switchgrass And Miscanthus RhizosphereMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALA*
Ga0066686_1008263233300005446SoilVKCHSTNRRWSMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0070706_10048302433300005467Corn, Switchgrass And Miscanthus RhizosphereMPDKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0070707_10037584833300005468Corn, Switchgrass And Miscanthus RhizosphereMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSDRCRNGHTLT*
Ga0070707_10184108423300005468Corn, Switchgrass And Miscanthus RhizosphereMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHPLS*
Ga0070699_10062639923300005518Corn, Switchgrass And Miscanthus RhizosphereMPGKKKIGDDEDEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0066697_1080975423300005540SoilPRATEDAMPGKKKFGDDEAEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0070704_10133997213300005549Corn, Switchgrass And Miscanthus RhizosphereMPGKKKFGDDEEEPDRDNCPKCGVKLTQGEKDSERCRNGHALP*
Ga0066692_1053046313300005555SoilMPGKKKFGDDDAEPDRDHCPRCGVKLTQGEKDSERCRNGHPLA*
Ga0066707_1093429313300005556SoilMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGRPLT*
Ga0066698_1031968823300005558SoilMPGKKKFGDDDAEPDRDHCPKCGVKLTQGEKDSERCRNGHALT*
Ga0066700_1021369633300005559SoilPLEVRIDQRRYAMPGKKKFGDDESEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0066705_1064250033300005569SoilDDEAEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0066694_1017599723300005574SoilMPGKKKFGDDAEEPDRDHCPKCGVKLTQGEMDSERCRNGHPLT*
Ga0068870_1058993333300005840Miscanthus RhizosphereRRCPMPGKKKFGDDEEEPDRDHCPRCGVKLTQGEKDSERCRNGHALP*
Ga0075417_1002914273300006049Populus RhizosphereMPGKKKFGDEEEPDSEHCPKCGVKLTQGEKDSERCRN
Ga0075417_1006598023300006049Populus RhizosphereMRDATILPNRRWVMPGKKFGDEEGPDRDHCPKCGVKLTQGEKDSQRCRNGHALP*
Ga0066653_1064554513300006791SoilMPGKKKFGDDEAEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0075428_10029284913300006844Populus RhizosphereMPGKKKFGDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALST*
Ga0075421_10010774483300006845Populus RhizosphereMPGKKKFGDEEEPDSEHCPKCGVKLTQGEKDSERCRNGHALST*
Ga0075433_1097992613300006852Populus RhizosphereWRCPMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0075433_1155581923300006852Populus RhizosphereMPGNKKFGDDEEEPHRDHCPKCGVKLTQGEKDSERCRNGHALS*
Ga0075434_10134148533300006871Populus RhizosphereGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0075429_10002805283300006880Populus RhizosphereMPGKKKFGDEEETDHDHCPKCGVKLTQGEKDSERCRNGHALST*
Ga0075429_10161307823300006880Populus RhizosphereMPDKKKFGDDSSEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0079215_1024393523300006894Agricultural SoilMPGKKKFGEDEPDRDHCPKCGVKLTQGEKDSERCRNGHALST*
Ga0079216_1032007523300006918Agricultural SoilMPGKKKFGDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALTT*
Ga0079216_1055719733300006918Agricultural SoilMPDKKKFGEETEPNRDHCPKCGVKLTQGEKDSERCRNGHALST*
Ga0079216_1099801713300006918Agricultural SoilLRGLDVHSTNRGWPMPGKKKFGDEEEPDRDNCPKCGVKLTQGEKDSERCRNGHALTT*
Ga0075419_1085734933300006969Populus RhizosphereMPGKKQFGDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0079218_1178270433300007004Agricultural SoilMPGKKKFGDEEEPDRDHCPKCGVKLTQGEKDSERCRNGRALTT*
Ga0079218_1352418523300007004Agricultural SoilMPGKKKFGNEEEPDRDHCPKCGVELTQGEKDSERCRNGHALTT*
Ga0099791_1001906933300007255Vadose Zone SoilMPGKKKFGDDEAEPDRDHCPKCGVKLTQGEKDSERCRNGHALT*
Ga0066710_10002791733300009012Grasslands SoilMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSESCRNGHPLT
Ga0099829_1084059313300009038Vadose Zone SoilMPGKKKFGDDEAEPNRDQCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0099830_1087926713300009088Vadose Zone SoilMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERYRNGHALT*
Ga0099827_1121189833300009090Vadose Zone SoilMPGKKKFGDDEEQPDRDHCPKCGVKLTQGEKDSERCRNGHALT*
Ga0066709_10055883433300009137Grasslands SoilMPGKKKFGDDEAEPDRDHCPKCGVKLTQGKKDSVRCRNGHLLA*
Ga0114129_1031438253300009147Populus RhizosphereMPGKKKFGDDEVEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0114129_1038136533300009147Populus RhizosphereMPGKKKFGDDEEEPDRDHCPKCGVRLTQGEKDSERCRNGHALP*
Ga0075423_1043168433300009162Populus RhizosphereMPGKKKFGDDEEEPDRYHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0105082_108737833300009814Groundwater SandMPGKKKFGDDEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0134080_1009957233300010333Grasslands SoilWSMPGKKKFGDDDAEPDRDHCPTCGVKLTQGEKDSERCRNGHPLA*
Ga0134080_1051562913300010333Grasslands SoilMPGKKKFGDDDEEPDRDHCPKCGVKLTQGEKDSERCRNGHALT*
Ga0134071_1013012833300010336Grasslands SoilMPGKKKCGDDEAEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0134128_1042156933300010373Terrestrial SoilMPGRKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0134127_1031614053300010399Terrestrial SoilMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCR
Ga0134127_1062865813300010399Terrestrial SoilRRCPMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALS*
Ga0137391_1073483413300011270Vadose Zone SoilMPGKKKFGDDEEEPDRDDCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0137389_1055673533300012096Vadose Zone SoilMPGKKKFGDAEEEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0137383_1124961913300012199Vadose Zone SoilMPGKKKFGDDEEEPDRDQCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0137374_1034598033300012204Vadose Zone SoilMPGKKKFGEDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0137374_1048543423300012204Vadose Zone SoilMPGKKKFGEGEAEPDRDHCPKCGVKLTQGEKDSERCRNGHTLS*
Ga0137374_1050712533300012204Vadose Zone SoilMPGKKKFGDDEEEPDRDHCPKCDVKLTQGEKDSERCHNGHALS*
Ga0137374_1065783113300012204Vadose Zone SoilMPSKKKFGDDEEEPDRDHCPKCDVKLTQGEKDSERCHNGHALS
Ga0137362_1062461323300012205Vadose Zone SoilMPGKKKFADDAEEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0137376_1067306923300012208Vadose Zone SoilMPGKKKFGDDAAEPDRDHCPKCGVKLTQGEKDSERCRDGHPLA*
Ga0137377_1004703253300012211Vadose Zone SoilMPGKKKFGDDEAEPDRDHCPKCGVKLTQGEKDSERCRNGHPLS*
Ga0137369_1033653933300012355Vadose Zone SoilMPGKKKFGDDAEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0137369_1036615413300012355Vadose Zone SoilMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNVHALP*
Ga0137371_1020907623300012356Vadose Zone SoilMPGKKKFVDDEAEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0137368_1056508813300012358Vadose Zone SoilMPGKKKFGDEDSEPDRDHCPKCGVKLTQGEKDSERCRNGHALSS*
Ga0137385_1095145823300012359Vadose Zone SoilMPGKKKFGDDDAEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT*
Ga0137375_1011572543300012360Vadose Zone SoilMPGKKKFGDEEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0137375_1049844923300012360Vadose Zone SoilMPGKKKFGDDEEEPDRDHCPKCVVKLTQGEKDSERCRNGHPQT*
Ga0137360_1117297233300012361Vadose Zone SoilMPGKKKFGDDAAEPDRDHCPKCGVKLTQGEKDSERCRNGHALT*
Ga0137373_1029129243300012532Vadose Zone SoilMPGKKKFGDDEAEPDRDHCPKCGVKLTQGEKDSERCRN
Ga0137396_1079544533300012918Vadose Zone SoilMPGKKKFGDDEEQPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0137396_1082269733300012918Vadose Zone SoilMPGKKKFGDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALA*
Ga0137394_1156604713300012922Vadose Zone SoilMPGNKKFSDDAEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP*
Ga0134112_1034354513300017656Grasslands SoilMPGKKKFGDDDAEPDRDHCPKCGVKLTQGEKDSERCRNGHALT
Ga0134112_1041025523300017656Grasslands SoilMPGKKKFGDDAEQPDDDHCPKCGVTLTQGEKDSERCRNGHPLT
Ga0134083_1017706913300017659Grasslands SoilMPGKKKFGDDEAEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT
Ga0184610_101048233300017997Groundwater SedimentVPGKKKFGDEEEPDRDHCPKCGVKLTQGEKDSERCRDGHALP
Ga0184610_111455333300017997Groundwater SedimentMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALS
Ga0184604_1012150833300018000Groundwater SedimentMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP
Ga0184605_1015188333300018027Groundwater SedimentMPGKKKCGDDEEQPDRDHCPKYGGKLTQGEKDSQRCRNGHALP
Ga0184634_1001579623300018031Groundwater SedimentMPGKKKFGDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALS
Ga0184621_1025086313300018054Groundwater SedimentGGESVILAKRRCPMPGKKTFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALS
Ga0184623_1001150023300018056Groundwater SedimentVPGKKKFGDDEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP
Ga0184623_1043786723300018056Groundwater SedimentMQGKKKFGDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP
Ga0184618_1025807133300018071Groundwater SedimentMPGKKKFGNDEEEPDRDHCPKCGVKLTQGEKDSERC
Ga0184640_1049143413300018074Groundwater SedimentMPGKKKFGDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP
Ga0184609_1048526923300018076Groundwater SedimentMPGKKKFGDDEEEPDRDNCPKCGVKLTQGEKDSERCRNGHALP
Ga0184639_1020986413300018082Groundwater SedimentMPGKKKFGDDEEPDRDHCPKCGVKLTQGEKDSERCRNGHTLS
Ga0066655_1044721013300018431Grasslands SoilMPGKKKFGDDESEPDRDHCPKCGVKLTQGEKDSERCRNGHTLT
Ga0190270_1231042633300018469SoilMPGKKKFGDEEEPDRDHCPKCGAKLTQGEKDSERCRNGHALST
Ga0184643_118909833300019255Groundwater SedimentKKKFGDDEEQPDRDHCPKCGVKLTQGEKDSERCRNGHALS
Ga0222623_1016442033300022694Groundwater SedimentRGPESVILPKRRCPLPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALS
Ga0209642_1058768423300025167SoilMPGKKKFSDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALST
Ga0207684_1108948223300025910Corn, Switchgrass And Miscanthus RhizosphereMPDKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT
Ga0207646_1003383223300025922Corn, Switchgrass And Miscanthus RhizosphereMPGKKKIGDDEDEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT
Ga0207646_1048748223300025922Corn, Switchgrass And Miscanthus RhizosphereMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSDRCRNGHTLT
Ga0207689_1092893233300025942Miscanthus RhizosphereMPGKKKFGGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP
Ga0207639_1155759513300026041Corn RhizosphereLADRLHSSNWRCPLPGKKKFGDDEPEPDRDHCPKCGVKLTQGEKDSERCRNGHELP
Ga0207648_1026918423300026089Miscanthus RhizosphereMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALA
Ga0209161_1046668013300026548SoilMPGKKKFGDDESEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT
Ga0209388_101556243300027655Vadose Zone SoilMPGKKKFGDDEAEPDRDHCPKCGVKLTQGEKDSERCRNGHALT
Ga0209485_117504633300027691Agricultural SoilMPGKKKFGDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALT
Ga0209966_103572633300027695Arabidopsis Thaliana RhizosphereMPGKKKFGDDEEPDRDHCPKCGVKLTQGEKDSERCRNGHALST
Ga0208989_1014524723300027738Forest SoilKRRWLMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALT
Ga0209701_1034285623300027862Vadose Zone SoilMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHPLT
Ga0209814_1002601023300027873Populus RhizosphereMPGKKFGDEEGPDRDHCPKCGVKLTQGEKDSQRCRNGHALP
Ga0209481_1018890223300027880Populus RhizosphereMPGKKQFGDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALST
Ga0307298_1015300733300028717SoilMPGKKKFGDDEEQPDRDHCPKCGVKLTQGEKDSERCRNGHALP
Ga0307287_1016360433300028796SoilMPGKKKFGDEEEPDRDNCPKCGVKLTQGEKDSERCRNGHALST
Ga0307296_1051662613300028819SoilTEVAMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALS
Ga0326597_1013355713300031965SoilMPGSKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP
Ga0326597_1175357623300031965SoilYFEWRYPMPGKKKFGDDEEEPDRDHCPKCGVKLTQGEKDSERCRNGHALP
Ga0364936_126973_43_1743300034773SedimentMPGKKKFGDDEEQPDHDHCPKCGVKLTQGEKDSERCRNGHALP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.