


| Basic Information | |
|---|---|
| Family ID | F073296 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MMVFMENTIVLTDAERMELNQRAASRSGRADDARRARLIL |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 38.14 % |
| % of genes near scaffold ends (potentially truncated) | 94.17 % |
| % of genes from short scaffolds (< 2000 bps) | 79.17 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.833 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00535 | Glycos_transf_2 | 3.33 |
| PF13358 | DDE_3 | 3.33 |
| PF13551 | HTH_29 | 2.50 |
| PF09424 | YqeY | 2.50 |
| PF13565 | HTH_32 | 1.67 |
| PF03596 | Cad | 1.67 |
| PF00884 | Sulfatase | 1.67 |
| PF00072 | Response_reg | 0.83 |
| PF00719 | Pyrophosphatase | 0.83 |
| PF13635 | DUF4143 | 0.83 |
| PF00534 | Glycos_transf_1 | 0.83 |
| PF13489 | Methyltransf_23 | 0.83 |
| PF00400 | WD40 | 0.83 |
| PF07228 | SpoIIE | 0.83 |
| PF13439 | Glyco_transf_4 | 0.83 |
| PF03099 | BPL_LplA_LipB | 0.83 |
| PF00903 | Glyoxalase | 0.83 |
| PF13545 | HTH_Crp_2 | 0.83 |
| PF03572 | Peptidase_S41 | 0.83 |
| PF07992 | Pyr_redox_2 | 0.83 |
| PF13620 | CarboxypepD_reg | 0.83 |
| PF13701 | DDE_Tnp_1_4 | 0.83 |
| PF07045 | DUF1330 | 0.83 |
| PF00665 | rve | 0.83 |
| PF07238 | PilZ | 0.83 |
| PF10531 | SLBB | 0.83 |
| PF14903 | WG_beta_rep | 0.83 |
| PF14384 | BrnA_antitoxin | 0.83 |
| PF03448 | MgtE_N | 0.83 |
| PF00589 | Phage_integrase | 0.83 |
| PF03069 | FmdA_AmdA | 0.83 |
| PF11455 | MazE-like | 0.83 |
| PF00672 | HAMP | 0.83 |
| PF01638 | HxlR | 0.83 |
| PF00239 | Resolvase | 0.83 |
| PF13391 | HNH_2 | 0.83 |
| PF01594 | AI-2E_transport | 0.83 |
| PF13463 | HTH_27 | 0.83 |
| PF13384 | HTH_23 | 0.83 |
| PF07521 | RMMBL | 0.83 |
| PF01757 | Acyl_transf_3 | 0.83 |
| PF07589 | PEP-CTERM | 0.83 |
| PF00916 | Sulfate_transp | 0.83 |
| PF13751 | DDE_Tnp_1_6 | 0.83 |
| PF13738 | Pyr_redox_3 | 0.83 |
| PF14534 | DUF4440 | 0.83 |
| PF11535 | Calci_bind_CcbP | 0.83 |
| PF13683 | rve_3 | 0.83 |
| PF01862 | PvlArgDC | 0.83 |
| PF02667 | SCFA_trans | 0.83 |
| PF12697 | Abhydrolase_6 | 0.83 |
| PF02308 | MgtC | 0.83 |
| PF13442 | Cytochrome_CBB3 | 0.83 |
| PF02899 | Phage_int_SAM_1 | 0.83 |
| PF13618 | Gluconate_2-dh3 | 0.83 |
| PF02589 | LUD_dom | 0.83 |
| PF00198 | 2-oxoacid_dh | 0.83 |
| PF07366 | SnoaL | 0.83 |
| PF05853 | BKACE | 0.83 |
| PF07519 | Tannase | 0.83 |
| PF00561 | Abhydrolase_1 | 0.83 |
| PF00226 | DnaJ | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG4300 | Cadmium resistance protein CadD, predicted permease | Inorganic ion transport and metabolism [P] | 1.67 |
| COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.83 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.83 |
| COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.83 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.83 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.83 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.83 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.83 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 0.83 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.83 |
| COG1945 | Pyruvoyl-dependent arginine decarboxylase | Amino acid transport and metabolism [E] | 0.83 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.83 |
| COG2031 | Short chain fatty acids transporter | Lipid transport and metabolism [I] | 0.83 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.83 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.83 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.83 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.83 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.83 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.83 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.83 |
| COG2978 | p-Aminobenzoyl-glutamate transporter AbgT | Coenzyme transport and metabolism [H] | 0.83 |
| COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 0.83 |
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.83 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.83 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.83 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.83 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.83 % |
| Unclassified | root | N/A | 34.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig28723 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300004479|Ga0062595_101398393 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005187|Ga0066675_10751450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 735 | Open in IMG/M |
| 3300005332|Ga0066388_100723968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. | 1599 | Open in IMG/M |
| 3300005332|Ga0066388_103438035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| 3300005537|Ga0070730_10002813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15799 | Open in IMG/M |
| 3300005553|Ga0066695_10887881 | Not Available | 509 | Open in IMG/M |
| 3300005554|Ga0066661_10281994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1025 | Open in IMG/M |
| 3300005660|Ga0073904_10048164 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
| 3300005764|Ga0066903_100355258 | Not Available | 2373 | Open in IMG/M |
| 3300006031|Ga0066651_10002434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6660 | Open in IMG/M |
| 3300006800|Ga0066660_10261343 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300006904|Ga0075424_102028928 | Not Available | 607 | Open in IMG/M |
| 3300007265|Ga0099794_10110088 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300007265|Ga0099794_10229141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300009826|Ga0123355_11248994 | Not Available | 752 | Open in IMG/M |
| 3300009868|Ga0130016_10049066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4469 | Open in IMG/M |
| 3300010048|Ga0126373_10670477 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300010360|Ga0126372_10285385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1440 | Open in IMG/M |
| 3300010360|Ga0126372_13168854 | Not Available | 511 | Open in IMG/M |
| 3300010361|Ga0126378_12266907 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300010361|Ga0126378_12371416 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300010366|Ga0126379_10888175 | Not Available | 993 | Open in IMG/M |
| 3300010366|Ga0126379_12185178 | Not Available | 655 | Open in IMG/M |
| 3300010376|Ga0126381_101291518 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300010376|Ga0126381_101721381 | Not Available | 905 | Open in IMG/M |
| 3300010376|Ga0126381_102466254 | Not Available | 745 | Open in IMG/M |
| 3300010376|Ga0126381_104193852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 559 | Open in IMG/M |
| 3300010379|Ga0136449_103608576 | Not Available | 587 | Open in IMG/M |
| 3300011271|Ga0137393_11451664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300012198|Ga0137364_10444155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 973 | Open in IMG/M |
| 3300012199|Ga0137383_10783104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. OV329 | 696 | Open in IMG/M |
| 3300012200|Ga0137382_10473337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 888 | Open in IMG/M |
| 3300012202|Ga0137363_10031861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3649 | Open in IMG/M |
| 3300012202|Ga0137363_10039633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3312 | Open in IMG/M |
| 3300012202|Ga0137363_10242611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1462 | Open in IMG/M |
| 3300012204|Ga0137374_10499663 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300012205|Ga0137362_11192512 | Not Available | 646 | Open in IMG/M |
| 3300012228|Ga0137459_1198469 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012285|Ga0137370_10239269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
| 3300012349|Ga0137387_10551706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300012361|Ga0137360_10335971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300012917|Ga0137395_10090905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2010 | Open in IMG/M |
| 3300012917|Ga0137395_10352500 | Not Available | 1049 | Open in IMG/M |
| 3300012917|Ga0137395_10907312 | Not Available | 636 | Open in IMG/M |
| 3300012917|Ga0137395_10939963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300012922|Ga0137394_10564573 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300012922|Ga0137394_10839870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
| 3300012924|Ga0137413_11436355 | Not Available | 558 | Open in IMG/M |
| 3300014156|Ga0181518_10155252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis | 1223 | Open in IMG/M |
| 3300014164|Ga0181532_10004884 | All Organisms → cellular organisms → Bacteria | 11556 | Open in IMG/M |
| 3300014165|Ga0181523_10022203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4188 | Open in IMG/M |
| 3300014165|Ga0181523_10128663 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300014165|Ga0181523_10195574 | Not Available | 1173 | Open in IMG/M |
| 3300014165|Ga0181523_10270270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300014200|Ga0181526_10587521 | Not Available | 704 | Open in IMG/M |
| 3300014495|Ga0182015_10247099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300014501|Ga0182024_10032865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8823 | Open in IMG/M |
| 3300015054|Ga0137420_1448049 | All Organisms → cellular organisms → Bacteria | 4477 | Open in IMG/M |
| 3300016341|Ga0182035_10597946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
| 3300016341|Ga0182035_11848716 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300016371|Ga0182034_10176159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1633 | Open in IMG/M |
| 3300016387|Ga0182040_10053911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2518 | Open in IMG/M |
| 3300016422|Ga0182039_10106936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2079 | Open in IMG/M |
| 3300017955|Ga0187817_10665023 | Not Available | 664 | Open in IMG/M |
| 3300017974|Ga0187777_10320868 | Not Available | 1061 | Open in IMG/M |
| 3300017974|Ga0187777_11199360 | Not Available | 555 | Open in IMG/M |
| 3300017999|Ga0187767_10297852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300018034|Ga0187863_10328310 | Not Available | 851 | Open in IMG/M |
| 3300018053|Ga0184626_10414246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 536 | Open in IMG/M |
| 3300018062|Ga0187784_11503047 | Not Available | 533 | Open in IMG/M |
| 3300020581|Ga0210399_10159166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1869 | Open in IMG/M |
| 3300021178|Ga0210408_10773371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 753 | Open in IMG/M |
| 3300021388|Ga0213875_10296074 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300021402|Ga0210385_11575011 | Not Available | 501 | Open in IMG/M |
| 3300021404|Ga0210389_11177619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 590 | Open in IMG/M |
| 3300021433|Ga0210391_10219027 | Not Available | 1496 | Open in IMG/M |
| 3300021476|Ga0187846_10029429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2501 | Open in IMG/M |
| 3300021560|Ga0126371_10148109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2405 | Open in IMG/M |
| 3300021560|Ga0126371_10655537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1198 | Open in IMG/M |
| 3300021560|Ga0126371_12343034 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 645 | Open in IMG/M |
| 3300021560|Ga0126371_12518209 | Not Available | 623 | Open in IMG/M |
| 3300026318|Ga0209471_1083548 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1406 | Open in IMG/M |
| 3300026323|Ga0209472_1015857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3678 | Open in IMG/M |
| 3300026497|Ga0257164_1021477 | Not Available | 920 | Open in IMG/M |
| 3300026547|Ga0209156_10313799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300026890|Ga0207781_1013315 | Not Available | 861 | Open in IMG/M |
| 3300027604|Ga0208324_1122516 | Not Available | 718 | Open in IMG/M |
| 3300027671|Ga0209588_1000975 | All Organisms → cellular organisms → Bacteria | 7349 | Open in IMG/M |
| 3300027671|Ga0209588_1001949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5530 | Open in IMG/M |
| 3300027671|Ga0209588_1046462 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300027857|Ga0209166_10001776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17354 | Open in IMG/M |
| 3300027895|Ga0209624_10919476 | Not Available | 570 | Open in IMG/M |
| 3300027902|Ga0209048_10245860 | Not Available | 1278 | Open in IMG/M |
| 3300028574|Ga0302153_10170948 | Not Available | 744 | Open in IMG/M |
| 3300031231|Ga0170824_113053756 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031546|Ga0318538_10367534 | Not Available | 777 | Open in IMG/M |
| 3300031564|Ga0318573_10447606 | Not Available | 695 | Open in IMG/M |
| 3300031719|Ga0306917_10641400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300031777|Ga0318543_10324953 | Not Available | 688 | Open in IMG/M |
| 3300031846|Ga0318512_10144667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum pedocola | 1144 | Open in IMG/M |
| 3300031879|Ga0306919_10210936 | Not Available | 1447 | Open in IMG/M |
| 3300031890|Ga0306925_10026067 | All Organisms → cellular organisms → Bacteria | 5910 | Open in IMG/M |
| 3300031910|Ga0306923_11445759 | Not Available | 722 | Open in IMG/M |
| 3300031910|Ga0306923_12405614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300031912|Ga0306921_11142461 | Not Available | 870 | Open in IMG/M |
| 3300031942|Ga0310916_10719617 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300031947|Ga0310909_10156107 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
| 3300031947|Ga0310909_10975401 | Not Available | 693 | Open in IMG/M |
| 3300032001|Ga0306922_10136712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2614 | Open in IMG/M |
| 3300032025|Ga0318507_10549403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300032039|Ga0318559_10393953 | Not Available | 645 | Open in IMG/M |
| 3300032059|Ga0318533_10725816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300032060|Ga0318505_10350462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300032895|Ga0335074_10000811 | All Organisms → cellular organisms → Bacteria | 42826 | Open in IMG/M |
| 3300032896|Ga0335075_10724634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. CSK15P-2 | 950 | Open in IMG/M |
| 3300032898|Ga0335072_11471532 | Not Available | 583 | Open in IMG/M |
| 3300033485|Ga0316626_10266490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1380 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.83% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.83% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.83% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.83% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.83% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.83% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0723.00002320 | 2166559005 | Simulated | MMVFMENAIVLTDSERLELNQRAASRSGRADDARGRG |
| Ga0062595_1013983931 | 3300004479 | Soil | VFMSTITLSDAERMELNRRASSRAGRADDARRARLILLLDSGD |
| Ga0066675_107514501 | 3300005187 | Soil | MIVLMENTLVLTDPERMELNQRMASRSGRADDARRARLMLLLEA |
| Ga0066388_1007239681 | 3300005332 | Tropical Forest Soil | VFMKSTIELTGSERIELSQRAASRSGRADDGRRARLILLLAAGH |
| Ga0066388_1034380352 | 3300005332 | Tropical Forest Soil | MIVFMKSTIGLTEGKRRELRQRAASRSGRADDGRRARLILLLAAG |
| Ga0070730_1000281318 | 3300005537 | Surface Soil | MIGFMENSIVLTDAERGELNQRAASRSGRADDARRARLLLLLDAGHT* |
| Ga0066695_108878812 | 3300005553 | Soil | MMVFMENTIVLTDAERMELNQRAASRSGRADDARRARL |
| Ga0066661_102819941 | 3300005554 | Soil | MMVFMENTIVLTDAERMELNQRVASRSGRADDARRA |
| Ga0073904_100481642 | 3300005660 | Activated Sludge | MCTITLSKAERMELDHRVASRAGRADDARRARLLLLLEAGHSWA |
| Ga0066903_1003552585 | 3300005764 | Tropical Forest Soil | MIVFMMSTLSEGERRELGQRAASRSGRADDGRRARLIL |
| Ga0066651_100024348 | 3300006031 | Soil | MVFMENTIVLTDAERMELNQRVASRSGRADDARRA |
| Ga0066660_102613433 | 3300006800 | Soil | MMVFMENTIVLTDAERMELNQRVASRSGRADDARRAR |
| Ga0075424_1020289281 | 3300006904 | Populus Rhizosphere | MIVLMKSTIELTASERTELSQRTTSRSGRADDGRRGRLI |
| Ga0099794_101100883 | 3300007265 | Vadose Zone Soil | MIVFMENTIVLTDAERMELNQRAASRSGRADDARRARL |
| Ga0099794_102291411 | 3300007265 | Vadose Zone Soil | MIVFMENTIVLTDAERMELNQRAASRSGRADDARRA |
| Ga0123355_112489941 | 3300009826 | Termite Gut | MIVPMSTITLSDVERTELSRRASSRSGRADDARRARLILL |
| Ga0130016_100490661 | 3300009868 | Wastewater | MIVAMSTITLSDAERMELNRRASSRAGRADDARRARLI |
| Ga0126373_106704772 | 3300010048 | Tropical Forest Soil | MVFMENTIVLTDSERLELNQRAASRSGRADDARRARLMLLLEANHTWAAIRDK |
| Ga0126372_102853851 | 3300010360 | Tropical Forest Soil | MENTIVLTDSERLELNQRAASRSGRADDARRARLMLLLGANH |
| Ga0126372_131688541 | 3300010360 | Tropical Forest Soil | MIVFMKSTIGLTEGERRELRQRAASRSGRADDGRRARLILL |
| Ga0126378_122669071 | 3300010361 | Tropical Forest Soil | MIVFMMSTIILSEGERRELSQRAASRSGRADDGRRARLILLLAARHT |
| Ga0126378_123714162 | 3300010361 | Tropical Forest Soil | MIVFMMNTIILSEGERRELSQRAASRSGRADDGRRARLILLLAARHT |
| Ga0126379_108881752 | 3300010366 | Tropical Forest Soil | MVFMENTIVLTDSERLELNQRAASRSGRADDARRARLM |
| Ga0126379_121851781 | 3300010366 | Tropical Forest Soil | MIVLMKSTIILTESERMELSQRATSRSGRADDGRRARLILL |
| Ga0126381_1012915182 | 3300010376 | Tropical Forest Soil | MVFMENTIVLTDSERLELNQRAASRSGRADDARRARLMLLLETNHTWAA |
| Ga0126381_1017213811 | 3300010376 | Tropical Forest Soil | MIALMKSTIELTEAERMELSQRATSRSGRADDGRRARLILLLEA |
| Ga0126381_1024662541 | 3300010376 | Tropical Forest Soil | MIVFMKSAIGLTEGERRELRQRAASRSGRADDGRRARLIL |
| Ga0126381_1041938523 | 3300010376 | Tropical Forest Soil | MIVFMKSTIGLTEGERRELGQRAARRSGRAEDGRRARLILLL |
| Ga0136449_1036085763 | 3300010379 | Peatlands Soil | MIVSMEATIVLTEAERMELDQRAARRSGRADDARRAR |
| Ga0137393_114516641 | 3300011271 | Vadose Zone Soil | MVFMENTIVLTDAERVELHQRATSRSGRADDARRAR |
| Ga0137364_104441551 | 3300012198 | Vadose Zone Soil | MIVFMENTIVLTEPERMELNQRAGSRSGRADDARR |
| Ga0137383_107831041 | 3300012199 | Vadose Zone Soil | MMVFMENTIVLTDAERMELNQRAASRSGRADDARRARLMLLLEADHTWAAIRDKLDC |
| Ga0137382_104733372 | 3300012200 | Vadose Zone Soil | MMVFMENTIVLTDAERMELNQRAASRSGRADDARRARLMLLLEA |
| Ga0137363_100318617 | 3300012202 | Vadose Zone Soil | MMVFMENTIVLTDAERMELNQRAASRSGRADDARRARLML |
| Ga0137363_100396331 | 3300012202 | Vadose Zone Soil | MMVFMENTIVLTDAERMELNQRAASRSGRADDARRA |
| Ga0137363_102426113 | 3300012202 | Vadose Zone Soil | MMVFMENTIILTDAERMELNQRAASRSGRADDARRARL |
| Ga0137374_104996631 | 3300012204 | Vadose Zone Soil | MMVFMENTIVLTDAERMELNQRAASRSGRADDARR |
| Ga0137362_111925121 | 3300012205 | Vadose Zone Soil | MMVFMENTIVLTDAERMELNQRAASRSGRADDARRAR |
| Ga0137459_11984692 | 3300012228 | Soil | MGNTIVLTEAERVELNQRAASRSGRADEARRARLVLLLEAG |
| Ga0137370_102392693 | 3300012285 | Vadose Zone Soil | MMVFMENTIVLTDAERMELNQRAASRSGRADDARRARLMLLLEAD |
| Ga0137387_105517062 | 3300012349 | Vadose Zone Soil | MMMFMENTIVLTDAERMELNQRAASRSGRADDARRARLM |
| Ga0137360_103359711 | 3300012361 | Vadose Zone Soil | MVFMENTIVLTDAERMELNQRAASRSGRADDARRARLMLLLET |
| Ga0137395_100909054 | 3300012917 | Vadose Zone Soil | MMVFRENTIVLTDAERLELNQRAASRSGRADDARRARLMLLLEAG |
| Ga0137395_103525003 | 3300012917 | Vadose Zone Soil | MMVFMENTIVLTDAERLELNQRAASRSGRADDARRARLMLLLEAG |
| Ga0137395_109073121 | 3300012917 | Vadose Zone Soil | MGNPIRLTEAERMELNQRVSSRSGRADDARGARLILLLE |
| Ga0137395_109399631 | 3300012917 | Vadose Zone Soil | MMVFMENTIILTDAERMELNQRAASRSGRADDARRAR |
| Ga0137394_105645732 | 3300012922 | Vadose Zone Soil | MIVFMGTITLSDVERSELSRRAGSRAGRADDARRARL |
| Ga0137394_108398701 | 3300012922 | Vadose Zone Soil | MMVFMENTIVLTDAERIELNQRAASRSGRADDARRARLM |
| Ga0137413_114363551 | 3300012924 | Vadose Zone Soil | MIVSMNTITLSKAERMELDHRVASRAGRADDARRARLVLLLE |
| Ga0181518_101552522 | 3300014156 | Bog | MMVSMENTIVLTDSERLELNQRAASRSGRADDARRARLMLLLEA |
| Ga0181532_100048841 | 3300014164 | Bog | MMAFMENTIVLTDSERLELNQRAASRSGRADDARRARLMLLLEANHTWA |
| Ga0181523_100222031 | 3300014165 | Bog | MMAFMENTIVLTDSERLELNQRAASRSGRADDARRARLMLLLEANHTWAAIRDKLD |
| Ga0181523_101286631 | 3300014165 | Bog | MIGFMENPFVLTDAERTELSQRAASRSGRADDARRARLLL |
| Ga0181523_101955742 | 3300014165 | Bog | MMVFMENTIVLTDSERLELNQRAASRSGRADDARR |
| Ga0181523_102702701 | 3300014165 | Bog | MENPFVLTDAERTELSQRAASRSGRADDARRARLLL |
| Ga0181526_105875211 | 3300014200 | Bog | MIGFMENPFVLTDAERTELSQRAASRSGRADDARR |
| Ga0182015_102470991 | 3300014495 | Palsa | MMVFMKNTIVLTDAERVELSQRAASRSGRADDARRGR |
| Ga0182024_100328651 | 3300014501 | Permafrost | MAFMENTIVLTDSERVELNQRAASRSGRADDARRAR |
| Ga0137420_14480492 | 3300015054 | Vadose Zone Soil | MVFMENTIVLTDAERMELNQRAASRSGRADSARRRG* |
| Ga0137409_115971561 | 3300015245 | Vadose Zone Soil | MSDAIILSKAERMELTQRATSQAGRADDARRARLILRLEAG |
| Ga0182035_105979461 | 3300016341 | Soil | MMVFMENTIVLTDSERLELNQRAASRSGRADDARRARLVLLLEANHTWAA |
| Ga0182035_118487161 | 3300016341 | Soil | MMVSMDNTIVLTDSERLELNQRAASRSGRADDARRARLVLLLEANHTWAA |
| Ga0182034_101761591 | 3300016371 | Soil | MIVFMRSTIGLTQSERMELSQRVTSRSGRADDGRR |
| Ga0182040_100539111 | 3300016387 | Soil | MMVLLENTIVLTDAEHLELNQRAASRSGRADDARRARLILL |
| Ga0182039_101069361 | 3300016422 | Soil | MVLLENTIVLTDAERLELNQRAASRSGRADDARRAR |
| Ga0187817_106650231 | 3300017955 | Freshwater Sediment | MIGFMENPFVLTDAERNEFSQRAASRSGRADDARRARLLLLLEAGHTGHGIIRREL |
| Ga0187777_103208683 | 3300017974 | Tropical Peatland | MFVFMSTITLTAVERAELNRRAMSRAGRADDARRARLILLLDAGETW |
| Ga0187777_111993601 | 3300017974 | Tropical Peatland | MIVFMENTIVLTDSERLELNQRAASRSGRADDARRAR |
| Ga0187767_102978522 | 3300017999 | Tropical Peatland | MIVFMENTIVLTDSERLELNQRAASRSGRADDARRARLMLLL |
| Ga0187863_103283101 | 3300018034 | Peatland | MVFMENTIVLTEAERMELSQRATSRSGRADDARRGRLIL |
| Ga0184626_104142461 | 3300018053 | Groundwater Sediment | MGNTIVLTDAERVELNQRAASRSGRADDARRARLILL |
| Ga0187784_115030471 | 3300018062 | Tropical Peatland | MVFMENAIVLTDVERMELNQRAGSRGRADDARRARLLLLLE |
| Ga0210399_101591662 | 3300020581 | Soil | MMVFMENTILLTDSERLELNQRAASRSGRADDARRARLMLLLEA |
| Ga0210408_107733711 | 3300021178 | Soil | MIVFMENTIVLTEAERIELNQRAASRSGRADDARR |
| Ga0213875_102960741 | 3300021388 | Plant Roots | MIVFMKSTIGLTEGERRELSRRAARRSGRADDGRRARL |
| Ga0210385_115750112 | 3300021402 | Soil | MVFMENAIVLTDAERMELNQRATSLSGRADDARRRG |
| Ga0210389_111776192 | 3300021404 | Soil | MEATIVLTEAERMELDQRAGRRSGRADDARRARLILLLE |
| Ga0210391_102190271 | 3300021433 | Soil | MIVCMENTIVLTEAEYMELNQRASSRSGRADDARR |
| Ga0187846_100294291 | 3300021476 | Biofilm | MENPIKLTEAERMELNQRVSSRSGRVDDGRRARLI |
| Ga0126371_101481098 | 3300021560 | Tropical Forest Soil | MVLMKSTIELTEAERMELSQRATSRSGRADDGRRARLILLLEA |
| Ga0126371_106555373 | 3300021560 | Tropical Forest Soil | MIVFMKSTIGLTEGERRELRQRAASRSGRADDGRRARLILLLA |
| Ga0126371_123430341 | 3300021560 | Tropical Forest Soil | MIVFMKSTIGLTEGERRELSQRAASRSGRADDGRRARLILLLEA |
| Ga0126371_125182091 | 3300021560 | Tropical Forest Soil | MIVFMKSTIGLTEGERRELRQRAASRSGRADDGRRAR |
| Ga0209471_10835481 | 3300026318 | Soil | MMVFMENTIVLTDAERMELNQRVASRSGRADDARRARL |
| Ga0209472_10158577 | 3300026323 | Soil | MVFMENTIVLTDAERMELNQRVASRSGRADDARRARL |
| Ga0257164_10214771 | 3300026497 | Soil | MIVFMENTIVLTDAERMELNQRAASRSGRADDARRARLMLLLDAGH |
| Ga0209156_103137992 | 3300026547 | Soil | MVFMENTIVLTDAERMELNQRAASRSGRADDARRARLMLLLEADHTWAAI |
| Ga0207781_10133151 | 3300026890 | Tropical Forest Soil | MMVFMENAIVLTDSERVELNQRVASRSGRADDARRARLMLLLDAGQTWAAIR |
| Ga0208324_11225162 | 3300027604 | Peatlands Soil | VLMSGTISLSMAERVELSQRASSQAGRADDARRARLILL |
| Ga0209588_10009751 | 3300027671 | Vadose Zone Soil | MMVFMENTIVLTDAERMELNQRAASRSGRADDARRARLIL |
| Ga0209588_10019491 | 3300027671 | Vadose Zone Soil | MIVFMENTIVLTDAERMELNQRAASRSGRADDARRAR |
| Ga0209588_10464623 | 3300027671 | Vadose Zone Soil | MIVFMENTIVLTDAERMELNQRAASRGGRADDARRARLMLLLEAGH |
| Ga0209392_12098702 | 3300027683 | Freshwater Sediment | MSTITLSDAERMELSRRAGSRAGRADDARRARLILLL |
| Ga0209166_1000177617 | 3300027857 | Surface Soil | MIGFMENSIVLTDAERGELNQRAASRSGRADDARRARLLLLLDAGHT |
| Ga0209624_109194762 | 3300027895 | Forest Soil | MIVLMSSTISLSKAERVELSQRATSQAGRADDARRARLILLL |
| Ga0209048_102458602 | 3300027902 | Freshwater Lake Sediment | MIVPMSAITLSSAERMELDQRAASRAGRADGARRARLA |
| Ga0302153_101709482 | 3300028574 | Bog | MIVFMSNTISLSKAERMELSQRASSQAGRADDARRARLILL |
| Ga0170824_1130537561 | 3300031231 | Forest Soil | MIGFMENPIVLTDAERVELNQRAASRSWRAGDFKGIRAG |
| Ga0318538_103675341 | 3300031546 | Soil | MIVPMSTITLSDVERVELNRRASSRAGRADDARRAR |
| Ga0318573_104476061 | 3300031564 | Soil | MIVFMMSPIGLTEGERRELSQRAASRSGRADDGRRARLLLLLAAGHT |
| Ga0306917_106414002 | 3300031719 | Soil | MMVLLENTIVLTDAERLELNQRAASRSGRADDARR |
| Ga0318543_103249531 | 3300031777 | Soil | VLMSTITLSDVERVELNRRASSRAGRADDARRARLILL |
| Ga0318512_101446671 | 3300031846 | Soil | MIVSMGTITLTDVERTELSRRAASRAGRADDARRARLILLL |
| Ga0306919_102109361 | 3300031879 | Soil | MMVLLENTIVLTDAERLELNQRAASRSGRADDARRARL |
| Ga0306925_100260671 | 3300031890 | Soil | MMVLLENTIVLTDAERLELNQRAASRSGRADDARRARLI |
| Ga0306923_114457591 | 3300031910 | Soil | MIVFMKSTIGLTEGERRELRQRAASRSGRADDGRRARLIL |
| Ga0306923_124056141 | 3300031910 | Soil | MMVLMENTIVLTDAERLELNQRAASRSGRADDARRARLILLL |
| Ga0306921_111424611 | 3300031912 | Soil | MMVLLENTIVLTDAERLELNQRAASRSGRADDARRAR |
| Ga0310916_107196171 | 3300031942 | Soil | MMVSMDNTIVLTDSERLELNQRAASRSGRADDARR |
| Ga0310909_101561071 | 3300031947 | Soil | MMVSMDNTIVLSDSERLELNQRAASRSGRADDARRARLMLLLAANHTWAAIRD |
| Ga0310909_109754013 | 3300031947 | Soil | MIVLMKSTIELTESERMELSQRATSRSGRADDGRRA |
| Ga0306922_101367125 | 3300032001 | Soil | MMVLLENTIVLTDAERLELNQRAASRSGRADDARRA |
| Ga0318507_105494031 | 3300032025 | Soil | MEFMENAIVLTDVERMELNQRAGSRSGRADDARRARLLLLLEAGHT |
| Ga0318559_103939531 | 3300032039 | Soil | MIVFMKSTIGLTEGERRELRQRAASRSGRADDGRRARLI |
| Ga0318533_107258161 | 3300032059 | Soil | MKNAVVLTDAERMELNQRAGSRSGRADDARRARLLLLLQA |
| Ga0318505_103504621 | 3300032060 | Soil | VLMSTITLSDVERVELNRRASSRAGRADDARRARLILLLDSGDT |
| Ga0335074_100008111 | 3300032895 | Soil | VLMSSTIKLSEVERVELKERAMSQAGRADDARRARLIL |
| Ga0335075_107246341 | 3300032896 | Soil | VLMSSTIKLSEVERVELKERAMSQAGRADDARRARL |
| Ga0335072_114715321 | 3300032898 | Soil | VLMSSAIKLSEVERVELKERAMSQAGRADDARRARLILLLEAGDTWS |
| Ga0316626_102664902 | 3300033485 | Soil | MGTIILSEAEHRELSQRAASRAGRADDARRARLVLLLAAGQTWAAVR |
| ⦗Top⦘ |