NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073219

Metagenome / Metatranscriptome Family F073219

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073219
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 45 residues
Representative Sequence MNESGYKGFRQDELEYQYNPRVSVPEYPELAKVRAAQARKVR
Number of Associated Samples 106
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.67 %
% of genes near scaffold ends (potentially truncated) 91.67 %
% of genes from short scaffolds (< 2000 bps) 93.33 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(10.000 % of family members)
Environment Ontology (ENVO) Unclassified
(27.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(34.167 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.71%    β-sheet: 0.00%    Coil/Unstructured: 64.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF02201SWIB 27.50
PF08546ApbA_C 10.00
PF13185GAF_2 5.00
PF02538Hydantoinase_B 4.17
PF12773DZR 3.33
PF04909Amidohydro_2 3.33
PF16123HAGH_C 3.33
PF00211Guanylate_cyc 1.67
PF13191AAA_16 0.83
PF09084NMT1 0.83
PF01977UbiD 0.83
PF09720Unstab_antitox 0.83
PF09844DUF2071 0.83
PF02954HTH_8 0.83
PF01527HTH_Tnp_1 0.83
PF01850PIN 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG5531DNA-binding SWIB/MDM2 domainChromatin structure and dynamics [B] 27.50
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 10.00
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 8.33
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.67
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.83
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.83
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.00 %
UnclassifiedrootN/A25.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig1335309All Organisms → cellular organisms → Bacteria515Open in IMG/M
2162886013|SwBSRL2_contig_10771936Not Available911Open in IMG/M
2162886013|SwBSRL2_contig_4260725Not Available911Open in IMG/M
2162886013|SwBSRL2_contig_8647264Not Available940Open in IMG/M
2228664021|ICCgaii200_c1095571All Organisms → cellular organisms → Bacteria626Open in IMG/M
2228664022|INPgaii200_c0672465All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1062800All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10028358All Organisms → cellular organisms → Bacteria1517Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10129333Not Available614Open in IMG/M
3300000787|JGI11643J11755_11469660All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium709Open in IMG/M
3300000789|JGI1027J11758_12543797All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300000858|JGI10213J12805_10392238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium878Open in IMG/M
3300000956|JGI10216J12902_100101261All Organisms → cellular organisms → Bacteria → Proteobacteria1892Open in IMG/M
3300002407|C687J29651_10202016All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300004114|Ga0062593_101413078All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300004808|Ga0062381_10241128All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005093|Ga0062594_102010828All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005167|Ga0066672_10200063All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300005183|Ga0068993_10086285All Organisms → cellular organisms → Bacteria → Proteobacteria983Open in IMG/M
3300005294|Ga0065705_10382737Not Available907Open in IMG/M
3300005294|Ga0065705_10771183All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005332|Ga0066388_105199903All Organisms → cellular organisms → Bacteria → Proteobacteria660Open in IMG/M
3300005340|Ga0070689_100840042All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300005440|Ga0070705_100734760All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300005450|Ga0066682_10507986All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005713|Ga0066905_100444468Not Available1064Open in IMG/M
3300005764|Ga0066903_107875435Not Available547Open in IMG/M
3300005842|Ga0068858_102565623All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300005844|Ga0068862_102201976All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300006844|Ga0075428_100928146All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium923Open in IMG/M
3300006844|Ga0075428_101262177All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300006847|Ga0075431_100748686All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300006853|Ga0075420_101005953Not Available717Open in IMG/M
3300006871|Ga0075434_100389536All Organisms → cellular organisms → Bacteria → Proteobacteria1414Open in IMG/M
3300006876|Ga0079217_10005112All Organisms → cellular organisms → Bacteria3870Open in IMG/M
3300006918|Ga0079216_10045045All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300006969|Ga0075419_11025015Not Available601Open in IMG/M
3300009137|Ga0066709_102681872Not Available665Open in IMG/M
3300009147|Ga0114129_10213539All Organisms → cellular organisms → Bacteria2607Open in IMG/M
3300009147|Ga0114129_12303904Not Available646Open in IMG/M
3300009609|Ga0105347_1356614All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300009792|Ga0126374_10660878All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300010037|Ga0126304_11168312Not Available527Open in IMG/M
3300010046|Ga0126384_10834904Not Available827Open in IMG/M
3300010047|Ga0126382_11565888All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300010047|Ga0126382_11701633Not Available589Open in IMG/M
3300010358|Ga0126370_12517083All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300010359|Ga0126376_11169816All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria782Open in IMG/M
3300010361|Ga0126378_10359244All Organisms → cellular organisms → Bacteria1567Open in IMG/M
3300010362|Ga0126377_10968709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium916Open in IMG/M
3300010366|Ga0126379_12294054Not Available640Open in IMG/M
3300010371|Ga0134125_10199208All Organisms → cellular organisms → Bacteria2229Open in IMG/M
3300010376|Ga0126381_100785362All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300010397|Ga0134124_11638781Not Available674Open in IMG/M
3300010398|Ga0126383_11002055Not Available924Open in IMG/M
3300010398|Ga0126383_11166327Not Available860Open in IMG/M
3300010401|Ga0134121_10981796All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300011443|Ga0137457_1279901Not Available570Open in IMG/M
3300012200|Ga0137382_10055436All Organisms → cellular organisms → Bacteria2490Open in IMG/M
3300012204|Ga0137374_10116622All Organisms → cellular organisms → Bacteria2468Open in IMG/M
3300012207|Ga0137381_11804232All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300012349|Ga0137387_10401330All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300012353|Ga0137367_10600247All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium771Open in IMG/M
3300012354|Ga0137366_10939691Not Available606Open in IMG/M
3300012486|Ga0157331_1003426All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300012503|Ga0157313_1020986Not Available667Open in IMG/M
3300012913|Ga0157298_10061607All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300012930|Ga0137407_11703272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium601Open in IMG/M
3300012957|Ga0164303_10929134All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300014305|Ga0075349_1042163Not Available915Open in IMG/M
3300014871|Ga0180095_1075080All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300015264|Ga0137403_10953331All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300015373|Ga0132257_103249039All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300015373|Ga0132257_103898740All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300015374|Ga0132255_101444245All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300015374|Ga0132255_104405001All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300018031|Ga0184634_10495170Not Available546Open in IMG/M
3300018052|Ga0184638_1039421All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1714Open in IMG/M
3300018074|Ga0184640_10219134All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300018078|Ga0184612_10309789All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300018081|Ga0184625_10071027All Organisms → cellular organisms → Bacteria1769Open in IMG/M
3300018082|Ga0184639_10051123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2137Open in IMG/M
3300018481|Ga0190271_10219520All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1910Open in IMG/M
3300021082|Ga0210380_10083295All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1404Open in IMG/M
3300021332|Ga0210339_1023204All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300025160|Ga0209109_10359272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300025165|Ga0209108_10129301All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1344Open in IMG/M
3300025312|Ga0209321_10308940All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium772Open in IMG/M
3300025324|Ga0209640_10910849All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300025915|Ga0207693_11465726All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300026051|Ga0208911_1012596Not Available788Open in IMG/M
3300026066|Ga0208290_1005010All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300027360|Ga0209969_1035038Not Available773Open in IMG/M
3300027471|Ga0209995_1046188All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300027527|Ga0209684_1012888All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300027577|Ga0209874_1108327Not Available656Open in IMG/M
3300027778|Ga0209464_10303793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium581Open in IMG/M
3300027787|Ga0209074_10499435All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300027815|Ga0209726_10034085All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3875Open in IMG/M
3300027831|Ga0209797_10098038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1280Open in IMG/M
3300027907|Ga0207428_11131233All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300027909|Ga0209382_10237315All Organisms → cellular organisms → Bacteria2075Open in IMG/M
3300027909|Ga0209382_10773839All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300030620|Ga0302046_10737681All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300031562|Ga0310886_10112505All Organisms → cellular organisms → Bacteria → Proteobacteria1376Open in IMG/M
3300031720|Ga0307469_10317211All Organisms → cellular organisms → Bacteria1292Open in IMG/M
3300031720|Ga0307469_11143903All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium733Open in IMG/M
3300031820|Ga0307473_10368171All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300031824|Ga0307413_10410795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1063Open in IMG/M
3300031854|Ga0310904_10171435All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300031854|Ga0310904_11135182All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300031903|Ga0307407_11046914Not Available632Open in IMG/M
3300031949|Ga0214473_11708248Not Available626Open in IMG/M
3300031965|Ga0326597_11456216Not Available660Open in IMG/M
3300032000|Ga0310903_10237201All Organisms → cellular organisms → Bacteria → Proteobacteria872Open in IMG/M
3300032180|Ga0307471_100608315All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300032205|Ga0307472_100518060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1033Open in IMG/M
3300032205|Ga0307472_101907063Not Available593Open in IMG/M
3300032828|Ga0335080_10486979All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300033434|Ga0316613_10842252All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium630Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.33%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.50%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.50%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.50%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.50%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.50%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.67%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.83%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.83%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.83%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.83%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002407Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012486Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510EnvironmentalOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300014305Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1EnvironmentalOpen in IMG/M
3300014871Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1DaEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021332Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026051Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026066Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027360Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027471Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_035391302124908045SoilMHMNEAAYRGFRQDELEYQFNPRVSVPEYPELAKVRAAQARKVRESAKS
SwBSRL2_0853.000077202162886013Switchgrass RhizosphereMRDLTYKSYQQDQLEFQYNPRESVPDYPELAKRRA
SwBSRL2_0712.000024802162886013Switchgrass RhizosphereMRDLTYKSYQQDQLEFQYNPRESVPEYPELAKRRA
SwBSRL2_0784.000049402162886013Switchgrass RhizosphereMRDLTYKSYQQDQLEFQYNPRESVPDYPELAKRRADASRKARSTL
ICCgaii200_109557122228664021SoilMNETVYKGFGPDEMEFQYNPRVSVPEYPELARVRAAQ
INPgaii200_067246522228664022SoilMNEPAYKGFRLDEMEYQYNPRVSVPEYPELAKMRAA
AF_2010_repII_A01DRAFT_106280023300000580Forest SoilMNETIYKGFRKDELEYQYNPRESVPEYPALSKRKAEQARKVRETAK
AF_2010_repII_A1DRAFT_1002835813300000597Forest SoilMNETIYKGFRKDELEYQYNPRESVPEYPALSKRKAEQARK
AF_2010_repII_A1DRAFT_1012933323300000597Forest SoilMNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAEA
JGI11643J11755_1146966013300000787SoilMTETGYRGFRLEEMEYQYNPRESVPEYPQLAKKRAEEA
JGI1027J11758_1254379723300000789SoilMTGIGYKSFRQDELEYQYNPRESVPEYPAISKRKAEQAR
JGI10213J12805_1039223833300000858SoilMIDTGYRGFRLEEMEYQYNPRESVPEYPQLAQKRAEE
JGI10216J12902_10010126113300000956SoilMSDQLYRGFRPDEMEYQYNPRESVPEYPELAKERAAQAKKVRDS
C687J29651_1020201613300002407SoilMNEVGYKGFRADELEYQFNPRVSVPEFPELSKVRAALSRKVRESAKSW
Ga0062593_10141307813300004114SoilMNESGYKGFRQDELEYQYNPRVSVPEYPELAKVRAAQARKVR
Ga0062381_1024112813300004808Wetland SedimentMSELYKGFRPDEMEYQYQPRESVPEFPELSKIRAAQAKKVRETAKSWLNIAYGSSGRESLDIYAADKPGG
Ga0062594_10201082813300005093SoilMNEAVYRGFRQDQLEYQYNPRSSVPEYPELAKIRATQARKVRESAKSWLNIAYGA
Ga0066672_1020006323300005167SoilMSDLGYKNFHRDEIEYQYNPRVSVPEFPQLAKKRSEESRK
Ga0068993_1008628523300005183Natural And Restored WetlandsLSDISYKGFRADEMEFQYNPRESVPEYPELAKIRAAQARKVRETAQSWLNV
Ga0065705_1038273723300005294Switchgrass RhizosphereMRDLTYKSYQQDQLEFQYNPRESVPEYPELAKRRAEASRKARSTLKSW
Ga0065705_1077118313300005294Switchgrass RhizosphereMNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLNIAYG
Ga0066388_10519990323300005332Tropical Forest SoilMNEIIYKGFRKDELEYQYNPRESVPEYLQLSKRKAEQARARDG*
Ga0070689_10084004233300005340Switchgrass RhizosphereMNEAVYRGFRQDQLEYQYNPRISVPEYPELAKIRATQARKVRESAKSWLNIAYGASPRERLD
Ga0070705_10073476023300005440Corn, Switchgrass And Miscanthus RhizosphereMNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLNIAYGASPRER
Ga0066682_1050798613300005450SoilMHEKAYKEFRQDEMEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLDI
Ga0066905_10044446823300005713Tropical Forest SoilMNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAE
Ga0066903_10787543523300005764Tropical Forest SoilMNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAEASRKARSNLK
Ga0068858_10256562323300005842Switchgrass RhizosphereMEAIAYKGFRHDEMEYQYNPRESVPEYPELAKKRAAESKKVRETAK
Ga0068862_10220197623300005844Switchgrass RhizosphereMNETEYKGFRPDEMEYQYNPRVSVPEYPELAKVRAAQA
Ga0075428_10092814613300006844Populus RhizosphereMPEIVYKGFRSDELEYQYNPRESVPEYPELAKLRAEASRK
Ga0075428_10126217713300006844Populus RhizosphereMNEPAYKGFRQVEMEYQYNPRVSVPEYPELAKMRAAQARKVRDSAKSWLN
Ga0075431_10074868633300006847Populus RhizosphereMNEPAYKGFGQDEMEYQYNPRVSVPEYPELAKMRAAQARK
Ga0075420_10100595313300006853Populus RhizosphereMSDQLYKGFRPDELEYQYNPRESVPEYPELAKVRAA
Ga0075434_10038953613300006871Populus RhizosphereMNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLNIAYGASPRERLD
Ga0079217_1000511253300006876Agricultural SoilMIETYKRFRPDEMEYQYNPRVSAPEYPELAKVRAA
Ga0079216_1004504513300006918Agricultural SoilMSVIPYKGFRPDEMEYQYNPRVSVPEYPELAKVRAAQAKKVRESAK
Ga0075419_1102501523300006969Populus RhizosphereMSDQLYKGFRPDELEYQYNPRESVPEYPELAKVRAAQAKKVRD
Ga0066709_10268187213300009137Grasslands SoilMNETAYKGFRQDEMEYQYNPRVSVPEYPELAKVRSAQARKVRESAKSW
Ga0114129_1021353943300009147Populus RhizosphereMKGERILIMSEPAYKGFRQDEMEFQYNPRVSVPEFPELAKVRSA
Ga0114129_1230390423300009147Populus RhizosphereMSDSGYKGFRPEEMEYQYNPRESVPEYPQLAKRRAEQARRVRESA
Ga0105347_135661413300009609SoilMSDRAYKSFQQDELEYQYNPRVSVPEFPELAKVRSARSRRVRESAKSWLDIAYGASPRET
Ga0126374_1066087813300009792Tropical Forest SoilMTEITYKGFRQDELEYQYNPRESVPEFPEISKRKAEQARK
Ga0126304_1116831223300010037Serpentine SoilMSDLYKGFRPDEMEYQYNPRESVPEYPELAKVRAA
Ga0126384_1083490413300010046Tropical Forest SoilMNEIGYEGFSKHELEYQYNPRESVPEYPELAKKRAEASRKARSN
Ga0126382_1156588823300010047Tropical Forest SoilMSEIVYKGFRKDELEYQYNPRESVAEYPQLSKRKADQ
Ga0126382_1170163323300010047Tropical Forest SoilMNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAEASRK
Ga0126370_1251708313300010358Tropical Forest SoilMDEIIYKGFRQDELEYQYNPRESVVEYPQLSKRKAEQARKVRETAKSWLN
Ga0126376_1116981623300010359Tropical Forest SoilMAMNDVVYKCFRKNELEYQYNPRESVPEYPQLSKRKAEQARARDG*
Ga0126378_1035924433300010361Tropical Forest SoilMNDAAYKGFRQDELEYQYNPRVSVPEYPELAKVRAAQARKVRERAKSWLNIAYGASPRE
Ga0126377_1096870913300010362Tropical Forest SoilMSEVTYKNYRADELEYQYNPRKSVPEYPQLSKRKAEQARARDG*
Ga0126379_1229405413300010366Tropical Forest SoilMNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAEASRKARSNLKS
Ga0134125_1019920813300010371Terrestrial SoilMNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAK
Ga0126381_10078536213300010376Tropical Forest SoilMTEITYKGFRQDELEYQYNPRESVPEFPEISKRKAEQARKVRETVK
Ga0134124_1163878123300010397Terrestrial SoilMNEAVYRGFRQDQLEYQYNPRSSVPEYPELAKIRATQARKVRESAKSWLNI
Ga0126383_1100205513300010398Tropical Forest SoilMNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAEASRKARSNLKSW
Ga0126383_1116632713300010398Tropical Forest SoilMNEAAYKDFRQDELEYQYNPRVSVPEYPELAKVRSAQARKVRESAKSWLNIAYGASPRER
Ga0134121_1098179623300010401Terrestrial SoilMEAIAYKGFRHDEMKYQYNPRESVPEYPELAKKRAAESKKVRETA
Ga0137457_127990113300011443SoilMSELYKGFRPDEMEYQYNPRESVPEYPELAKVRAAQAKKVRETAKFWLTISYGSSPREMLDI
Ga0137382_1005543633300012200Vadose Zone SoilMNETAYKGFRQDEMEYQYNPRVSVPEYPELAKVRSAQARKVRESAKSWLN
Ga0137374_1011662213300012204Vadose Zone SoilMSEPAYRGFRQDEMEFQYNPRVSVPEFPELARIRSAQARKV
Ga0137381_1180423213300012207Vadose Zone SoilMNETAYKGFRQDEMEYQYNPRVSVPEYPELAKVRS
Ga0137387_1040133013300012349Vadose Zone SoilMSELAYKNFRGDELEYQYNPRKSVREYPGLAKKRAE
Ga0137367_1060024723300012353Vadose Zone SoilMNEPAYKGFRQDEMEFQYNPRVSVPEFPELARIRSA
Ga0137366_1093969113300012354Vadose Zone SoilMSGTKYKGFSKDELEYQYNPRESVPEYPELAKRRAEQSRKARSTL
Ga0157331_100342633300012486SoilMNEAVYRGFRQDELECQYNPRISVPEYPELAKVRAAQARKVR
Ga0157313_102098613300012503Arabidopsis RhizosphereMNEAVYRGFRQDELEYQYNPRVSVPEYPELAKVRAAQARKVRESAKSWLNIA
Ga0157298_1006160713300012913SoilMNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLNI
Ga0137407_1170327213300012930Vadose Zone SoilMSEPAYKGFRQDEMEFQYNPRVSVPEFPELARIRSAQARKVRDSA
Ga0164303_1092913413300012957SoilMNETAYKGFRLGEMEYQYNPRVSVPEYPELAKMRAAQARKVRASAKS
Ga0075349_104216323300014305Natural And Restored WetlandsMSELYKGFRPDEMEYQYNPRESVPEYPELAKVRAAQANRRSPG*
Ga0180095_107508023300014871SoilMSESAYRNLRPDELEFQYNPRVSVPEFPELAEVRSAKSRKVRDSAKSWLNIA*
Ga0137403_1095333133300015264Vadose Zone SoilMNETAYKGFRLDEMEYQYNPRVSVPEYPELAKMRA
Ga0132257_10324903923300015373Arabidopsis RhizosphereMNEAVYRRFRQDELEYQYNPRISVPEYPELAKVRAAQARKVRESAKSWLNIAY
Ga0132257_10389874023300015373Arabidopsis RhizosphereMNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRA
Ga0132255_10144424513300015374Arabidopsis RhizosphereMNETAYKGFREDEMEYQYNPRVSVPEYPELAKVRAAQARK
Ga0132255_10440500123300015374Arabidopsis RhizosphereMNEAVYRRFRQDELEYQYNPRISVPEYPELAKVRAAQARKVRESAKSWLNIAYGASP
Ga0184634_1049517013300018031Groundwater SedimentMSEIAYKGFSKGEMEYQYNPRESVPEYPELAKLRA
Ga0184638_103942113300018052Groundwater SedimentMSELSYKAYPQDELEFQYNPRVSVPEYPQLAEVRSAKSRRVRDSAKSWLNI
Ga0184640_1021913413300018074Groundwater SedimentMSDNLYKGFRQDEMEYQYNPRVSVPEFPELAKVRSAQARKVRESAKSW
Ga0184612_1030978923300018078Groundwater SedimentMSDNLYKGFRQDQMEYQYNPRVSVPEFPELAKIRSAQARK
Ga0184625_1007102713300018081Groundwater SedimentMNEIRPNGFPKDELEYQYNPRESVPEYPELAKRRAE
Ga0184639_1005112313300018082Groundwater SedimentMSDQLYKGFRPDEMEFQYNPRVSVPEFPELAKVRAAQARKV
Ga0190271_1021952013300018481SoilMSDQLYKGFRPDEMEYQYNPRESVPEYSELAKVRAAQANKVRETAKSWLNISYGSSP
Ga0210380_1008329523300021082Groundwater SedimentMSDQLYKGFRPHEMEYQYNPRESVPEYPELAKVRAAQAKKVRD
Ga0210339_102320413300021332EstuarineMSDQLYKGFRQDEMEYQYNPRESVPEFPELAKIRAAQAKKVRETAKS
Ga0209109_1035927223300025160SoilMNDLGYKGFHQDELEYQYNPRVSVPEFPELSKLRSAQSRKVRESAKSW
Ga0209108_1012930123300025165SoilMSEVVYKGFHQDELEYQFNPRVSVPEFPELSKVRA
Ga0209321_1030894013300025312SoilMSDVGYKGFRQDELEYQYNPRVSVPEFPELAKVRAALS
Ga0209640_1091084913300025324SoilMSEIGYRGFRQDELEYQFNPRVSVPEFPELSKVRAA
Ga0207693_1146572623300025915Corn, Switchgrass And Miscanthus RhizosphereMSEIIYKGFRQDELEYQYNPRESVPEYPALAKKRGEASRKVRSTL
Ga0208911_101259613300026051Natural And Restored WetlandsMSEFAYRNFRQDELEFQYNPRVSVPEFPELAKARSAQARKVRES
Ga0208290_100501013300026066Natural And Restored WetlandsMNENGYKGFRQDELEYQYNPRVSVPDYPELAKVRAAQSRKVR
Ga0209969_103503833300027360Arabidopsis Thaliana RhizosphereMNENAYKGFRQDELEYQYNPRVSVPEYPELAKVRAAQSRKVRERAK
Ga0209995_104618833300027471Arabidopsis Thaliana RhizosphereMNESGYKGFRQDELEYQYNPRVSVPEYPELAKVRAAQSRKVRESARS
Ga0209684_101288813300027527Tropical Forest SoilMNEIIYKGFRKDELEYQYNPRESVPEYLQLSKRKAEQARARDG
Ga0209874_110832713300027577Groundwater SandMSGTAYKGFSKDELEYQYNPRVSVPEYPELAKRRAEASRKAR
Ga0209464_1030379313300027778Wetland SedimentMSELYKGFRPDEMEYQYQPRESVPEFPELSKIRAAQAKKVRETAKSWLN
Ga0209074_1049943513300027787Agricultural SoilMNEAIHRGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLNIAYGASP
Ga0209726_1003408513300027815GroundwaterMSDQLYKGFRPDEMEYQYNPRESVPEFPELAKVRSAQAKK
Ga0209797_1009803813300027831Wetland SedimentMSDQLYKGFRPDEMEYQFNPRASVPEFPELAKIRAAQAKKVRETA
Ga0207428_1113123323300027907Populus RhizosphereMNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKS
Ga0209382_1023731533300027909Populus RhizosphereMNEIRPNGFPKDELEYQYNPRESVPEYPELAERRAEESRKAR
Ga0209382_1077383933300027909Populus RhizosphereMNEAAYRGFRQDELEYQYNPRVSVPEYPELAKVRAAQARKVRESAKSWLNI
Ga0302046_1073768123300030620SoilMNESAYEGFRQDDLEYQYNPRVSVPEYPELAKLRAAQARKVRQ
Ga0310886_1011250533300031562SoilMTQLYKGFRPDEMEYQYNPRESVPEYPELAKVRAA
Ga0307469_1031721123300031720Hardwood Forest SoilMTEISYKDFRKDELEYQYNPRESVPEYPELAKKRAEPAGRR
Ga0307469_1114390313300031720Hardwood Forest SoilMSKPAYKGFRQDEMEFQYNPRVSVPEFPELARIRSAQARK
Ga0307473_1036817113300031820Hardwood Forest SoilMSEIIYKGFRQDELEYQYNPRESVPEYPALAKKRAEASRK
Ga0307413_1041079513300031824RhizosphereMIDAGYRGFRQDELEYQYNPRESVPEYPQLAKKRAEQARRVRRSAKSWLGVPYGSSPREKLD
Ga0310904_1017143533300031854SoilMNETAYKGFRLDEMEYQYNPRVSVPEYPELAKMRAAQARKVR
Ga0310904_1113518213300031854SoilMNEAVYRRFRQDELEYQYNPRISVPEYPELAKVRAAQARKVRESAKSW
Ga0307407_1104691413300031903RhizosphereMIDAGYRGFRQDELEYQYNPRESVPEYPQLAKKRAEQARR
Ga0214473_1170824813300031949SoilMSESAYRNFRQDELEFQYNPRVSVPEYPQLAEVRSAKSRTVRDSAKSWLNIAYGTSAREA
Ga0326597_1145621613300031965SoilMSDQLHKGFRPDEMEYQYNPRESAPEYPELAKVRAAQAKKVRDSARSWLNVA
Ga0310903_1023720113300032000SoilMNEPAYKGFGQDEMEYQYNPRVSVPEYPELAKMRAAQARKVRDSAKS
Ga0307471_10060831513300032180Hardwood Forest SoilMNEMIYKGFRQDELEYQYNPRESVPEYPELAKKRG
Ga0307472_10051806023300032205Hardwood Forest SoilMSEIIYKGFRQDELEYQYNPRESVPEYPALAKKRGEASRKVR
Ga0307472_10190706323300032205Hardwood Forest SoilMNEMIYKGFRQDELEYQYNPRESVPEYPELAKKRAEPAGRR
Ga0335080_1048697923300032828SoilMNEKIYKTFRQDELEYQYNPRASVADYPQLSKRKAEQARKVRE
Ga0316613_1084225223300033434SoilMTELYKGFRPDEMEYQYNPRESVPEYPELAKVRAAQAKKVR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.