Metagenome / Metatranscriptome Family F073218

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F073218
Family Type	Metagenome / Metatranscriptome
Number of Sequences	120
Average Sequence Length	37 residues
Representative Sequence	MKILLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM
Number of Associated Samples	85
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	63.33 %
% of genes near scaffold ends (potentially truncated)	31.67 %
% of genes from short scaffolds (< 2000 bps)	86.67 %
Associated GOLD sequencing projects	82
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (70.833 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.833 % of family members)
Environment Ontology (ENVO)	Unclassified (35.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (31.667 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 51.61% β-sheet: 0.00% Coil/Unstructured: 48.39%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.41
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF02909	TetR_C_1	14.17
PF00440	TetR_N	10.83
PF01145	Band_7	10.00
PF00487	FA_desaturase	8.33
PF13453	zf-TFIIB	4.17
PF00011	HSP20	2.50
PF01569	PAP2	1.67
PF06305	LapA_dom	0.83
PF01155	HypA	0.83
PF03861	ANTAR	0.83
PF00270	DEAD	0.83
PF03006	HlyIII	0.83
PF01613	Flavin_Reduct	0.83
PF01872	RibD_C	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG1309	DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA	Transcription [K]	14.17
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	8.33
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	8.33
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	2.50
COG3707	Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains	Transcription [K]	0.83
COG3771	Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family	Cell wall/membrane/envelope biogenesis [M]	0.83
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.83
COG0375	Hydrogenase maturation factor HypA/HybF, metallochaperone involved in Ni insertion	Posttranslational modification, protein turnover, chaperones [O]	0.83
COG1272	Predicted membrane channel-forming protein YqfA, hemolysin III family	Intracellular trafficking, secretion, and vesicular transport [U]	0.83
COG1853	FMN reductase RutF, DIM6/NTAB family	Energy production and conversion [C]	0.83
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	71.67 %
Unclassified	root	N/A	28.33 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.83 %
Unclassified	root	N/A	28.33 %
Viruses	superkingdom	All Organisms → Viruses	0.83 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.83 %
Unclassified	root	N/A	28.33 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	49.17 %
Unclassified	root	N/A	28.33 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	48.33 %
Unclassified	root	N/A	28.33 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	30.83 %
Unclassified	root	N/A	28.33 %
unclassified Actinobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria	4.17 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.33 %
Actinobacteria bacterium 13_2_20CM_2_71_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6	4.17 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	2.50 %
Cryptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales	0.83 %
Pseudonocardiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.33 %
Actinobacteria bacterium 13_2_20CM_2_71_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6	4.17 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	2.50 %
Cryptosporangiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae	0.83 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.33 %
Actinobacteria bacterium 13_2_20CM_2_71_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6	4.17 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	1.67 %
Cryptosporangium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium	0.83 %
Amycolatopsis	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.33 %
Actinobacteria bacterium 13_2_20CM_2_71_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6	4.17 %
unclassified Amycolatopsis	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis	0.83 %
Streptomyces gardneri	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces gardneri	0.83 %
Cryptosporangium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.33 %
Actinobacteria bacterium 13_2_20CM_2_71_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6	4.17 %
Amycolatopsis sp. DSM 110486	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. DSM 110486	0.83 %
Streptomyces gardneri	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces gardneri	0.83 %
Cryptosporangium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000443\|F12B_10355389	Not Available	724	Open in IMG/M
3300000858\|JGI10213J12805_10268131	Not Available	1251	Open in IMG/M
3300000956\|JGI10216J12902_122071944	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	783	Open in IMG/M
3300005562\|Ga0058697_10011504	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2938	Open in IMG/M
3300005562\|Ga0058697_10299420	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. DSM 110486	766	Open in IMG/M
3300005719\|Ga0068861_100050168	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3163	Open in IMG/M
3300006049\|Ga0075417_10096045	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1339	Open in IMG/M
3300006049\|Ga0075417_10252527	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	846	Open in IMG/M
3300006049\|Ga0075417_10302036	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	776	Open in IMG/M
3300006058\|Ga0075432_10011226	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3045	Open in IMG/M
3300006844\|Ga0075428_101003662	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	883	Open in IMG/M
3300006844\|Ga0075428_101989174	Not Available	602	Open in IMG/M
3300006845\|Ga0075421_101364654	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	782	Open in IMG/M
3300006845\|Ga0075421_101879635	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	642	Open in IMG/M
3300006847\|Ga0075431_100501829	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1204	Open in IMG/M
3300006852\|Ga0075433_10007926	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	8452	Open in IMG/M
3300006871\|Ga0075434_100149170	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2358	Open in IMG/M
3300007790\|Ga0105679_10397363	All Organisms → cellular organisms → Bacteria	1352	Open in IMG/M
3300009147\|Ga0114129_12065795	Not Available	688	Open in IMG/M
3300009789\|Ga0126307_10004035	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	10128	Open in IMG/M
3300009789\|Ga0126307_10012657	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	6189	Open in IMG/M
3300009789\|Ga0126307_10236575	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1468	Open in IMG/M
3300009789\|Ga0126307_10246384	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1436	Open in IMG/M
3300009789\|Ga0126307_10248421	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1430	Open in IMG/M
3300009789\|Ga0126307_10313999	All Organisms → cellular organisms → Bacteria	1261	Open in IMG/M
3300009840\|Ga0126313_10069449	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2529	Open in IMG/M
3300009840\|Ga0126313_10190250	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1571	Open in IMG/M
3300009840\|Ga0126313_10560602	Not Available	918	Open in IMG/M
3300009840\|Ga0126313_10888040	Not Available	727	Open in IMG/M
3300009840\|Ga0126313_11213861	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	622	Open in IMG/M
3300010037\|Ga0126304_11205099	Not Available	519	Open in IMG/M
3300010038\|Ga0126315_10898609	Not Available	588	Open in IMG/M
3300010038\|Ga0126315_11203782	Not Available	515	Open in IMG/M
3300010039\|Ga0126309_10044612	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2091	Open in IMG/M
3300010041\|Ga0126312_10152006	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1607	Open in IMG/M
3300010041\|Ga0126312_10286331	All Organisms → cellular organisms → Bacteria	1161	Open in IMG/M
3300010041\|Ga0126312_10307477	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1119	Open in IMG/M
3300010042\|Ga0126314_10102541	Not Available	1945	Open in IMG/M
3300010044\|Ga0126310_10016450	All Organisms → cellular organisms → Bacteria	3598	Open in IMG/M
3300010044\|Ga0126310_10160371	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium	1442	Open in IMG/M
3300010085\|Ga0127445_1040017	All Organisms → cellular organisms → Bacteria	646	Open in IMG/M
3300010166\|Ga0126306_10163155	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1663	Open in IMG/M
3300010167\|Ga0123353_11676466	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	798	Open in IMG/M
3300011003\|Ga0138514_100069596	Not Available	735	Open in IMG/M
3300012021\|Ga0120192_10009211	Not Available	1423	Open in IMG/M
3300012356\|Ga0137371_10298370	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1255	Open in IMG/M
3300012373\|Ga0134042_1209838	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300012380\|Ga0134047_1212643	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1515	Open in IMG/M
3300012501\|Ga0157351_1061470	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300012515\|Ga0157338_1074581	Not Available	537	Open in IMG/M
3300012937\|Ga0162653_100039728	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6	705	Open in IMG/M
3300012938\|Ga0162651_100066453	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	588	Open in IMG/M
3300014487\|Ga0182000_10000669	All Organisms → cellular organisms → Bacteria	6042	Open in IMG/M
3300014487\|Ga0182000_10031063	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1489	Open in IMG/M
3300014487\|Ga0182000_10104948	Not Available	955	Open in IMG/M
3300014488\|Ga0182001_10044880	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1166	Open in IMG/M
3300014497\|Ga0182008_10536433	Not Available	648	Open in IMG/M
3300014497\|Ga0182008_10908101	Not Available	519	Open in IMG/M
3300018073\|Ga0184624_10163520	All Organisms → cellular organisms → Bacteria	983	Open in IMG/M
3300018429\|Ga0190272_12071681	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300018432\|Ga0190275_11692646	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	711	Open in IMG/M
3300018465\|Ga0190269_11195822	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces gardneri	597	Open in IMG/M
3300018476\|Ga0190274_10075494	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2567	Open in IMG/M
3300018476\|Ga0190274_11282308	Not Available	819	Open in IMG/M
3300019254\|Ga0184641_1066194	All Organisms → cellular organisms → Bacteria	852	Open in IMG/M
3300019254\|Ga0184641_1184902	All Organisms → cellular organisms → Bacteria → Terrabacteria group	535	Open in IMG/M
3300019254\|Ga0184641_1222169	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6	694	Open in IMG/M
3300019269\|Ga0184644_1150224	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6	708	Open in IMG/M
3300021951\|Ga0222624_1175461	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	558	Open in IMG/M
3300022534\|Ga0224452_1164058	Not Available	684	Open in IMG/M
3300025972\|Ga0207668_12086451	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300027809\|Ga0209574_10132301	Not Available	744	Open in IMG/M
3300027907\|Ga0207428_10108322	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2140	Open in IMG/M
3300027909\|Ga0209382_11473269	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	680	Open in IMG/M
3300028587\|Ga0247828_10603170	Not Available	670	Open in IMG/M
3300028608\|Ga0247819_10615265	All Organisms → cellular organisms → Bacteria	655	Open in IMG/M
3300028708\|Ga0307295_10018829	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1679	Open in IMG/M
3300028719\|Ga0307301_10154380	All Organisms → cellular organisms → Bacteria	739	Open in IMG/M
3300028744\|Ga0307318_10065133	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1214	Open in IMG/M
3300028744\|Ga0307318_10068278	Not Available	1186	Open in IMG/M
3300028771\|Ga0307320_10217806	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	748	Open in IMG/M
3300028787\|Ga0307323_10256365	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300028814\|Ga0307302_10400895	Not Available	678	Open in IMG/M
3300030510\|Ga0268243_1000458	All Organisms → cellular organisms → Bacteria	6280	Open in IMG/M
3300030571\|Ga0247652_1046783	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6	752	Open in IMG/M
3300030592\|Ga0247612_1150444	All Organisms → cellular organisms → Bacteria	575	Open in IMG/M
3300030592\|Ga0247612_1180644	Not Available	536	Open in IMG/M
3300030634\|Ga0247636_10123579	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6	749	Open in IMG/M
3300030634\|Ga0247636_10250245	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300030831\|Ga0308152_101997	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	963	Open in IMG/M
3300030831\|Ga0308152_104700	Not Available	738	Open in IMG/M
3300030831\|Ga0308152_113706	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	531	Open in IMG/M
3300030902\|Ga0308202_1029682	All Organisms → cellular organisms → Bacteria	914	Open in IMG/M
3300030903\|Ga0308206_1096094	All Organisms → cellular organisms → Bacteria	658	Open in IMG/M
3300030987\|Ga0308155_1003510	All Organisms → cellular organisms → Bacteria	1045	Open in IMG/M
3300031092\|Ga0308204_10249243	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	575	Open in IMG/M
3300031095\|Ga0308184_1010530	Not Available	871	Open in IMG/M
3300031099\|Ga0308181_1095491	Not Available	635	Open in IMG/M
3300031114\|Ga0308187_10124245	All Organisms → cellular organisms → Bacteria	831	Open in IMG/M
3300031124\|Ga0308151_1011762	All Organisms → cellular organisms → Bacteria	818	Open in IMG/M
3300031421\|Ga0308194_10055025	All Organisms → cellular organisms → Bacteria	1030	Open in IMG/M
3300031421\|Ga0308194_10354038	Not Available	523	Open in IMG/M
3300031424\|Ga0308179_1006516	All Organisms → cellular organisms → Bacteria	1037	Open in IMG/M
3300031424\|Ga0308179_1039539	Not Available	584	Open in IMG/M
3300031505\|Ga0308150_1040446	Not Available	546	Open in IMG/M
3300031548\|Ga0307408_101827542	Not Available	581	Open in IMG/M
3300031731\|Ga0307405_10383219	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1095	Open in IMG/M
3300031824\|Ga0307413_10986151	All Organisms → cellular organisms → Bacteria	721	Open in IMG/M
3300031852\|Ga0307410_10122109	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1901	Open in IMG/M
3300031852\|Ga0307410_10382782	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1132	Open in IMG/M
3300031852\|Ga0307410_10844842	Not Available	781	Open in IMG/M
3300031901\|Ga0307406_11101087	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	686	Open in IMG/M
3300031911\|Ga0307412_10462661	All Organisms → Viruses → Predicted Viral	1048	Open in IMG/M
3300031995\|Ga0307409_100121870	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2210	Open in IMG/M
3300031995\|Ga0307409_101960476	Not Available	615	Open in IMG/M
3300032002\|Ga0307416_100042030	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3565	Open in IMG/M
3300032126\|Ga0307415_101570045	Not Available	631	Open in IMG/M
3300034448\|Ga0370540_00428	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1455	Open in IMG/M
3300034448\|Ga0370540_09778	Not Available	599	Open in IMG/M
3300034680\|Ga0370541_004913	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1195	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	70.83%
Host-Associated	Host-Associated	29.17%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	65.00%
Plants	Host-Associated → Plants	28.33%
Aquatic	Environmental → Aquatic	5.83%
Arthropoda	Host-Associated → Arthropoda	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	62.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere	24.17%
Freshwater	Environmental → Aquatic → Freshwater	4.17%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	2.50%
Phylloplane	Host-Associated → Plants → Phylloplane	2.50%
Sediment	Environmental → Aquatic → Sediment	1.67%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.67%
Digestive System	Host-Associated → Arthropoda → Digestive System	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	60.83%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	23.33%
Sediment	Environmental → Aquatic → Freshwater → Sediment	4.17%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	2.50%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	2.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.67%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.67%
Loam	Environmental → Terrestrial → Soil → Loam	0.83%
Sand	Environmental → Terrestrial → Soil → Sand	0.83%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	0.83%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	53.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	23.33%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	4.17%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.17%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	2.50%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	2.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.67%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.67%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.67%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.83%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.83%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	0.83%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	25.83%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	18.33%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	11.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	10.00%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.17%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.50%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	2.50%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	2.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.67%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.83%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.83%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.83%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.83%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.83%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000443	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly	Environmental	Open in IMG/M
3300000858	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300007790	Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010085	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010167	Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3	Host-Associated	Open in IMG/M
3300011003	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015	Environmental	Open in IMG/M
3300012021	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012373	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012380	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012501	Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610	Environmental	Open in IMG/M
3300012515	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610	Host-Associated	Open in IMG/M
3300012937	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015	Environmental	Open in IMG/M
3300012938	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015	Environmental	Open in IMG/M
3300014487	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG	Environmental	Open in IMG/M
3300014488	Bulk soil microbial communities from Mexico - San Felipe (SF) metaG	Environmental	Open in IMG/M
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019254	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019269	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021951	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027809	Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028608	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6	Environmental	Open in IMG/M
3300028708	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152	Environmental	Open in IMG/M
3300028719	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182	Environmental	Open in IMG/M
3300028744	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367	Environmental	Open in IMG/M
3300028771	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369	Environmental	Open in IMG/M
3300028787	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300030510	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)	Environmental	Open in IMG/M
3300030571	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030592	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030634	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030831	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030902	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030903	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030987	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031092	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031095	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031099	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031114	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031124	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031421	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031424	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031505	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300034448	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_115 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034680	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F12B_103553892	3300000443	Soil	MKILLLVAAAVGLGAIMAGNVVLDISRYVRIRRM*
JGI10213J12805_102681312	3300000858	Soil	MTRSLLVVAAAVGLGAVLARSVVPDVTRYLRIRRM*
JGI10216J12902_1220719442	3300000956	Soil	MKIVLLLAAAVGFGAIVAGSVMPDVARYLRIRRM*
Ga0058697_100115043	3300005562	Agave	MKILLLAAAVVGLGAILAGNVLLDVTRYLRMRRM*
Ga0058697_102994202	3300005562	Agave	MTRLLLLVAAAVGLGAVLARSVVPDVTRYLRIRRM*
Ga0068861_1000501682	3300005719	Switchgrass Rhizosphere	MKILLLVAAALGLGAVLAGNVLPDVTRYLRIRRM*
Ga0075417_100960453	3300006049	Populus Rhizosphere	MKILLLAAAAVGLGGILAGNLLPDVTRYLRIRRM*
Ga0075417_102525271	3300006049	Populus Rhizosphere	MKILLLAAAAVGLGAILAGNVLPDVTRYLRIRRM*
Ga0075417_103020361	3300006049	Populus Rhizosphere	MKILLLVAAAVGLGAIVAGKVVPDVTQYLRIRRM*
Ga0075432_100112263	3300006058	Populus Rhizosphere	MKILLLAAAAVGLGDILAGKLLPDVTRYLRIRRM*
Ga0075428_1010036621	3300006844	Populus Rhizosphere	MTRLVFVVAAAVGLGAVLARSVVPDVTRYLRIRRM*
Ga0075428_1019891742	3300006844	Populus Rhizosphere	MARLVFVVAAAVGLGALLARSVVPDVTRYLRIRRM*
Ga0075421_1013646542	3300006845	Populus Rhizosphere	MKILLLVAAAVGLGAIMAANVVPDVTRYLRIRRM*
Ga0075421_1018796352	3300006845	Populus Rhizosphere	MKILLLVAAAVGLGAIMAGNVLPDVTRYLRIRRM*
Ga0075431_1005018293	3300006847	Populus Rhizosphere	MKILLLAAAAVGLGAILAGNLLPDVTRYLRIRRM*
Ga0075433_100079269	3300006852	Populus Rhizosphere	MKILLLAAAAVGLGAIVAGKVVPDVTRYLRIRRM*
Ga0075434_1001491702	3300006871	Populus Rhizosphere	MKILLLAAAAVGLGGILAGKLLPDVTRYLRIRRM*
Ga0105679_103973635	3300007790	Soil	MTRSLLVLAAAVGLGAVLARGVGPDGTRYLRIRRM*
Ga0114129_120657951	3300009147	Populus Rhizosphere	MTRLLLVVAAAVGLGAVLARSVVPDVTRYLRIRRM*
Ga0126307_100040356	3300009789	Serpentine Soil	MKILLLVAAAVGLGAILAGNVMPDIARYMRIRRM*
Ga0126307_100126572	3300009789	Serpentine Soil	MKILLLAAAAVGLGAIMAGNVVPDVTRYLRIRRM*
Ga0126307_102365751	3300009789	Serpentine Soil	MKILLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM*
Ga0126307_102463842	3300009789	Serpentine Soil	MKILLLVAAAVGLGAVFAGNVLPDVTRYLRIRRM*
Ga0126307_102484213	3300009789	Serpentine Soil	MGQEETCQMKILLLVAAAVGLGALLAGGVLPDVTRYLRIRRM*
Ga0126307_103139993	3300009789	Serpentine Soil	MKILLLLAAAVGLGAIMAGRVVPDVTRYLRIRRM*
Ga0126313_100694491	3300009840	Serpentine Soil	MGQEETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYL
Ga0126313_101902501	3300009840	Serpentine Soil	MKIGVLVAAVVGLGAILAGNVLPDVIRYLRIRRM*
Ga0126313_105606021	3300009840	Serpentine Soil	MKILLLVAAAVGLGAIMAGNVVPDVTRYLRIRRM*
Ga0126313_108880402	3300009840	Serpentine Soil	MARLLIVVAAAVGLGALARSVVPDVTRYLRIRRM*
Ga0126313_112138612	3300009840	Serpentine Soil	MKFLLLAAAIVGLGAIVAGNVLPDITRYLRIRRM*
Ga0126304_112050992	3300010037	Serpentine Soil	MKILLLLAAAVGLGAIMAGRRVVPDVTRYLRIRRM*
Ga0126315_108986091	3300010038	Serpentine Soil	MTRLLVVVAAAVGLGVVLARSVVPDVTRYLRIRRM*
Ga0126315_112037821	3300010038	Serpentine Soil	MKILLLLAGVVGLGAIMASKVVPDVTRYLRIRRM*
Ga0126309_100446124	3300010039	Serpentine Soil	MTRLLIVVAAAVGLGAVLARSVVPDVTRYLRIRRM*
Ga0126312_101520063	3300010041	Serpentine Soil	MKILLLAAAAVGLGAILAGNVMPDVARYMRIRRM*
Ga0126312_102863311	3300010041	Serpentine Soil	VMGQEETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM*
Ga0126312_103074772	3300010041	Serpentine Soil	MKILLLVAAAVGLGAIVAGNVMPDVTRYLRIRRM*
Ga0126314_101025414	3300010042	Serpentine Soil	MKISLLVAAAVGLGAILAGNVMPDVARYLRIRRM*
Ga0126310_100164507	3300010044	Serpentine Soil	MKLLLLVAAAVGLGAILAGNVMPDVARYMRIRRM*
Ga0126310_101603711	3300010044	Serpentine Soil	RGQMKILLLVAAAVGLGAILAGNVMPDVARYMRIRRM*
Ga0127445_10400172	3300010085	Grasslands Soil	MKIVLLVAAAVGLGAIMAGKVVPDVTRYLRIRRM*
Ga0126306_101631551	3300010166	Serpentine Soil	MTRLVLVVAAVIGLGVVLARSVVPDVTRYLRIRRM*
Ga0123353_116764662	3300010167	Termite Gut	MRKTVVVGLVAAALAALVAQVLPDIMRYLRIRRM*
Ga0138514_1000695962	3300011003	Soil	MKFLLLVGAAVGLGAILVGNVLPDVTRYLRIRRM*
Ga0120192_100092112	3300012021	Terrestrial	MKILLLVAAAVGLGAIMAGNVILDVARYMRIRRM*
Ga0137371_102983702	3300012356	Vadose Zone Soil	MARTVSLLLLAVAVGLGALDVFAAGQVLPDVARHLRIRRM*
Ga0134042_12098382	3300012373	Grasslands Soil	MKIVLLVAAAVGLGAIMAGNVVPDITRYLRIRRM*
Ga0134047_12126433	3300012380	Grasslands Soil	ETWQMKILLLVAAAVGLGAIMAGNLVPDITRYLRIRRM*
Ga0157351_10614701	3300012501	Unplanted Soil	MKILLLVAAALGLGAVLAGKVLPDVTRYLRIRRM*
Ga0157338_10745812	3300012515	Arabidopsis Rhizosphere	MKILLLVAAALGLGALLAGNVLPDVTRYLRIRRM*
Ga0162653_1000397282	3300012937	Soil	VMGQEETWQMKILLLVAAAVGLGALLAGSVLPDVTRYLRIRRM*
Ga0162651_1000664532	3300012938	Soil	MKILLLVAAAVGLGAVLAGNVLPDVTRYMRMRRM*
Ga0182000_100006695	3300014487	Soil	MTRSLFVVAAVVGLGAVLARSVVPDVTRYLRIRRM*
Ga0182000_100310633	3300014487	Soil	MKILLLAAAVVGLGAILAGNVLPDVTRYLRIRRM*
Ga0182000_101049481	3300014487	Soil	LKILLLAAAVVGLGAILAGNVLLDVTRYLRMRRM*
Ga0182001_100448801	3300014488	Soil	MKILLLVGAAVGLGAVLAGNVLPDVTRYLRIRRM*
Ga0182008_105364332	3300014497	Rhizosphere	MKILLLVAAAVGLGAIMAGKVVPDVTRYLRIRRM*
Ga0182008_109081011	3300014497	Rhizosphere	MTRLLFVVAAAVGLGAVLARSVVPDVTRYLRIRRM*
Ga0184624_101635201	3300018073	Groundwater Sediment	GDKRETWQMKILLLVAAAVGLGAIMAGNVVPDVTRYLRIRRM
Ga0190272_120716812	3300018429	Soil	QEETCQMKILLLVAAAVGLGALLAGGVVPDVTRYLRIRRM
Ga0190275_116926461	3300018432	Soil	EDGAGGADMTRLVLVVAAVIGLGVVLARSVVPDVTRYLRIRRM
Ga0190269_111958222	3300018465	Soil	MTRLLFVVAAAVGLGAVLARSVVPDVTRYLRIRRM
Ga0190274_100754942	3300018476	Soil	MTRLLLAVAAAVGLGAVLARSVVPDVTRYLRIRRM
Ga0190274_112823082	3300018476	Soil	MTRLVLVVAAVIGLGVVLARSVVPDVTRYLRIRRM
Ga0184641_10661941	3300019254	Groundwater Sediment	ETCQMKILLLVAAALGLGALLAGNVLPDVTRYLRIRRM
Ga0184641_11849022	3300019254	Groundwater Sediment	CQMKILLLVAAAVGLGAVLAGNVLPDVTRYMRMRRM
Ga0184641_12221692	3300019254	Groundwater Sediment	MGQEETWQMKILLLVAAAVGLGALLAGSVLPDVTRYLRIRRM
Ga0184644_11502242	3300019269	Groundwater Sediment	ETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRMRRM
Ga0222624_11754611	3300021951	Groundwater Sediment	CQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRMRRM
Ga0224452_11640582	3300022534	Groundwater Sediment	MTRLLFVGAAAVGLAAVLARSVVPDVTRYLRIRRM
Ga0207668_120864512	3300025972	Switchgrass Rhizosphere	ETCQMKILLLVAAALGLGAVLAGNVLPDVTRYLRIRRM
Ga0209574_101323012	3300027809	Agave	MTRLLLVAAAAVGLGAVLARSVVPDVTRYLRIRRM
Ga0207428_101083223	3300027907	Populus Rhizosphere	MARLVFVVAAAVGLGALLARSVVPDVTRYLRIRRM
Ga0209382_114732692	3300027909	Populus Rhizosphere	MTRLVFVVAAAVGLGAVLARSVVPDVTRYLRIRRM
Ga0247828_106031702	3300028587	Soil	MARSVLLLLLAVAVGLGALGVLAAGNVLPDVARYLRIRRM
Ga0247819_106152652	3300028608	Soil	EEETCQMKILLLVAAALGLGALLAGNVLPDVTRYLRIRRM
Ga0307295_100188293	3300028708	Soil	ETWQMKILLLAAAAVGLGAILAGNVLPDVTRYLRIRRM
Ga0307301_101543802	3300028719	Soil	MGLEETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM
Ga0307318_100651332	3300028744	Soil	MARLLVMVAVAVGLGAVLARSVVPDVTRYLRIRRM
Ga0307318_100682782	3300028744	Soil	TCQMKIVLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM
Ga0307320_102178061	3300028771	Soil	MGQEETWQMKLLLLVAAAVGLGALLAGSVLPDVTRYLRIRRM
Ga0307323_102563651	3300028787	Soil	DKRESWQMRILVLVAAAVGLGAVLAGNVLPDVTRYLRIRRM
Ga0307302_104008952	3300028814	Soil	ESWHMRILVLVAAAVGLGAVLAGNVLPDVTRYLRIRRM
Ga0268243_10004588	3300030510	Soil	MTRSLFVVAAVVGLGAVLARSVVPDVTRYLRIRRM
Ga0247652_10467831	3300030571	Soil	GQMKILLLVAAAVGLGALLAGSVLPDVTRYLRIRRM
Ga0247612_11504441	3300030592	Soil	QMKILLLVAAAVGLGALLAGNVLPDVTRYLRIRRM
Ga0247612_11806441	3300030592	Soil	PVMGQEETCQMKILLLVAAAVGLGALLAGSVLPDVTRYLRIRRM
Ga0247636_101235791	3300030634	Soil	GETCQMKILLLVAAAVGLGALLAGSVLPDVTRYLRIRRM
Ga0247636_102502452	3300030634	Soil	QMKILLLVAAAVGLGAIMAGNVVPDVTRYLRIRRM
Ga0308152_1019972	3300030831	Soil	MTRLMLLAAAVVGLGALAVAGNVLPDVARYMRIRRM
Ga0308152_1047003	3300030831	Soil	MTRLLLVVATVVGLGAVLARSVVPDVTRYLRIRRM
Ga0308152_1137061	3300030831	Soil	HRSLTAREKEELEMKILVLVAATVGLGAVLAGNVLPDVTRYLRIRRM
Ga0308202_10296822	3300030902	Soil	EETCQMKILLLVAAALGLGALLAGNVLPDVTRYLRIRRM
Ga0308206_10960943	3300030903	Soil	WGQRETWQMKILLLAAAAVGLGAILAGNVLPDVTRYLRIRRM
Ga0308155_10035101	3300030987	Soil	RGQEELEMKILVLVAAAVGLGAVLAGNVLPDVTRYLRIRRM
Ga0308204_102492431	3300031092	Soil	QMKILLLVAAAVGLGAVLAGNVLPDVTRYLRMRRM
Ga0308184_10105301	3300031095	Soil	SLTAREKEELEMKILVLVAATVGLGAVLASNVLPDVTRYLRMRRM
Ga0308181_10954912	3300031099	Soil	DGYKRETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRMRRM
Ga0308187_101242452	3300031114	Soil	DGGEEETCQMKILLLVAAALGLGAVLAGNVLPDVTRYLRIRRM
Ga0308151_10117621	3300031124	Soil	QMKILLLVAAALGLGAVLAGNVLPDVTRYLRIRRM
Ga0308194_100550251	3300031421	Soil	SWQMRILVLVAAAVGLGAVLAGNVLPDVTRYLRIRRT
Ga0308194_103540381	3300031421	Soil	MGRSVLLLLLAVAVGLGALGAVAAGNVLPDVARHLRIRRM
Ga0308179_10065161	3300031424	Soil	GGEEETCQMKILLLVAAALGLGALLAGNVLPDVTRYLRIRRM
Ga0308179_10395392	3300031424	Soil	MARSVLLLLVVAVGLGTLGAVAAGNVLPDVAPRIRRM
Ga0308150_10404461	3300031505	Soil	PRLMLLVAAVVGLGALAVRGGVLPDMARYLRIRRM
Ga0307408_1018275422	3300031548	Rhizosphere	MTRLLLVVAAAVGLGVVLARSVVPDVTRYLRIRRM
Ga0307405_103832191	3300031731	Rhizosphere	MTRLLIVVAAAVGLGAVLARSVVPDVTRYLRIRRM
Ga0307413_109861512	3300031824	Rhizosphere	MGQEETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM
Ga0307410_101221091	3300031852	Rhizosphere	MTRLWLVLAAAVGLGAVLARSVVPDVTRYLRIRRM
Ga0307410_103827821	3300031852	Rhizosphere	ETWQMKILLLAAAAVGLGAILAGNLLPDVTRYLRIRRM
Ga0307410_108448422	3300031852	Rhizosphere	MTRLLLVVAAAVGLGAVLARSVVPDVTRYLRIRRRRM
Ga0307406_111010872	3300031901	Rhizosphere	MTRLLLVLAAAVGLGAVLARSVVPDVTRYLRIRRM
Ga0307412_104626611	3300031911	Rhizosphere	WQMKILLLAGAVGLGAIMASKVVPDVTRYLRIRRM
Ga0307409_1001218702	3300031995	Rhizosphere	MSRLVLVVAAAVGLGVVLARSVVPDVTRYLRIRRM
Ga0307409_1019604761	3300031995	Rhizosphere	MTRLLLVVAAAVGLGAVLARSVVPDVTRYLRIRRM
Ga0307416_1000420303	3300032002	Rhizosphere	MTRSLLVAAAAVVGLGAVLARSVMPDVPRYLRIRRM
Ga0307415_1015700451	3300032126	Rhizosphere	MGQEETCQMKILLLVAAAVGLGAVLAGQVLPDVTR
Ga0370540_00428_870_1001	3300034448	Soil	MKRGQEELEMKILVLVAAAVGLGAVLAGNVLPDVTRYLRIRRM
Ga0370540_09778_225_344	3300034448	Soil	MARSVLLLLAVAVGLGALGVLAAGNVLPDVARYLRIRRM
Ga0370541_004913_1010_1117	3300034680	Soil	MTRLLVVVAAAVGLGAVLARSVVPDVTRYLRIRRM

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F073218

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences