NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072975

Metagenome / Metatranscriptome Family F072975

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072975
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 40 residues
Representative Sequence MTGIVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVP
Number of Associated Samples 104
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 90.83 %
% of genes near scaffold ends (potentially truncated) 96.67 %
% of genes from short scaffolds (< 2000 bps) 86.67 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (53.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.333 % of family members)
Environment Ontology (ENVO) Unclassified
(17.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.94%    β-sheet: 0.00%    Coil/Unstructured: 84.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF01965DJ-1_PfpI 9.17
PF08281Sigma70_r4_2 7.50
PF04542Sigma70_r2 5.83
PF00135COesterase 2.50
PF00962A_deaminase 1.67
PF04055Radical_SAM 1.67
PF12900Pyridox_ox_2 1.67
PF06441EHN 0.83
PF00196GerE 0.83
PF13278Obsolete Pfam Family 0.83
PF12323HTH_OrfB_IS605 0.83
PF01243Putative_PNPOx 0.83
PF02771Acyl-CoA_dh_N 0.83
PF13360PQQ_2 0.83
PF00005ABC_tran 0.83
PF07731Cu-oxidase_2 0.83
PF13738Pyr_redox_3 0.83
PF03008DUF234 0.83
PF07730HisKA_3 0.83
PF12697Abhydrolase_6 0.83
PF07690MFS_1 0.83
PF09250Prim-Pol 0.83
PF00132Hexapep 0.83
PF03720UDPG_MGDP_dh_C 0.83
PF01545Cation_efflux 0.83
PF12833HTH_18 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 5.83
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 5.83
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 5.83
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 5.83
COG2272Carboxylesterase type BLipid transport and metabolism [I] 2.50
COG1816Adenosine/6-amino-6-deoxyfutalosine deaminaseNucleotide transport and metabolism [F] 1.67
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.83
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.83
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.83
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.83
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.83
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.83
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.83
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.83
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.83
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.83
COG1672Predicted ATPase, archaeal AAA+ ATPase superfamilyGeneral function prediction only [R] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.33 %
UnclassifiedrootN/A46.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_5614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1453Open in IMG/M
3300001356|JGI12269J14319_10032149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3457Open in IMG/M
3300003505|JGIcombinedJ51221_10247334All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300005435|Ga0070714_102390994All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005436|Ga0070713_102030955All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005439|Ga0070711_100853805Not Available775Open in IMG/M
3300005541|Ga0070733_10254724All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300005591|Ga0070761_10605432Not Available682Open in IMG/M
3300005712|Ga0070764_10691214All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300006059|Ga0075017_101163065All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300006162|Ga0075030_100713235Not Available794Open in IMG/M
3300009522|Ga0116218_1221746Not Available851Open in IMG/M
3300009698|Ga0116216_10328704Not Available930Open in IMG/M
3300009698|Ga0116216_10811541Not Available561Open in IMG/M
3300009700|Ga0116217_10057152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2795Open in IMG/M
3300009824|Ga0116219_10165261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1275Open in IMG/M
3300010048|Ga0126373_12956798Not Available530Open in IMG/M
3300010335|Ga0134063_10238401All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300010343|Ga0074044_10817372Not Available609Open in IMG/M
3300010371|Ga0134125_11560617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria719Open in IMG/M
3300010371|Ga0134125_12465466Not Available565Open in IMG/M
3300010376|Ga0126381_103030523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium667Open in IMG/M
3300010396|Ga0134126_11460681Not Available754Open in IMG/M
3300010876|Ga0126361_10977413Not Available641Open in IMG/M
3300013105|Ga0157369_10082573All Organisms → cellular organisms → Bacteria3438Open in IMG/M
3300014325|Ga0163163_10280894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinokineospora → Actinokineospora alba1716Open in IMG/M
3300014969|Ga0157376_11709807All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300015356|Ga0134073_10401449All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300016294|Ga0182041_10257450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1424Open in IMG/M
3300016387|Ga0182040_11689904Not Available540Open in IMG/M
3300017822|Ga0187802_10087697Not Available1164Open in IMG/M
3300017823|Ga0187818_10072375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1485Open in IMG/M
3300017823|Ga0187818_10397870Not Available611Open in IMG/M
3300017932|Ga0187814_10204257Not Available743Open in IMG/M
3300017937|Ga0187809_10190081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia725Open in IMG/M
3300017942|Ga0187808_10083248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1381Open in IMG/M
3300017942|Ga0187808_10201767Not Available884Open in IMG/M
3300017959|Ga0187779_10365989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia934Open in IMG/M
3300017974|Ga0187777_10965995Not Available615Open in IMG/M
3300017975|Ga0187782_11311308Not Available568Open in IMG/M
3300017994|Ga0187822_10222562Not Available638Open in IMG/M
3300018007|Ga0187805_10391740Not Available644Open in IMG/M
3300018009|Ga0187884_10242768Not Available735Open in IMG/M
3300018482|Ga0066669_11015684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia748Open in IMG/M
3300021170|Ga0210400_11445948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii547Open in IMG/M
3300021171|Ga0210405_10932569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia658Open in IMG/M
3300021171|Ga0210405_11195365Not Available563Open in IMG/M
3300021181|Ga0210388_10332937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1334Open in IMG/M
3300021363|Ga0193699_10213954Not Available801Open in IMG/M
3300021388|Ga0213875_10188393Not Available970Open in IMG/M
3300021403|Ga0210397_10107013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1898Open in IMG/M
3300021407|Ga0210383_10031616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4423Open in IMG/M
3300021474|Ga0210390_10060573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3119Open in IMG/M
3300021475|Ga0210392_10216852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Motilibacterales → Motilibacteraceae → Motilibacter1343Open in IMG/M
3300023056|Ga0233357_1022412Not Available755Open in IMG/M
3300023101|Ga0224557_1269521Not Available554Open in IMG/M
3300025899|Ga0207642_10576588All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300025909|Ga0207705_10507701All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300025910|Ga0207684_10354295All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300025915|Ga0207693_10694918Not Available788Open in IMG/M
3300025922|Ga0207646_10055825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae3531Open in IMG/M
3300025928|Ga0207700_10532591Not Available1041Open in IMG/M
3300025929|Ga0207664_10057063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3103Open in IMG/M
3300025929|Ga0207664_10801421Not Available847Open in IMG/M
3300025986|Ga0207658_11588493All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300026095|Ga0207676_11785201Not Available614Open in IMG/M
3300026551|Ga0209648_10071097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2927Open in IMG/M
3300026551|Ga0209648_10378614Not Available949Open in IMG/M
3300026899|Ga0209326_1004866All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300027029|Ga0208731_1011801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii904Open in IMG/M
3300027502|Ga0209622_1068966Not Available645Open in IMG/M
3300027787|Ga0209074_10100317All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300027812|Ga0209656_10040346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2703Open in IMG/M
3300027812|Ga0209656_10209837Not Available939Open in IMG/M
3300027824|Ga0209040_10085117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1819Open in IMG/M
3300027824|Ga0209040_10383888Not Available657Open in IMG/M
3300027825|Ga0209039_10265744Not Available682Open in IMG/M
3300027867|Ga0209167_10545875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis thailandensis635Open in IMG/M
3300028780|Ga0302225_10393562Not Available651Open in IMG/M
3300028877|Ga0302235_10459765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia542Open in IMG/M
3300029920|Ga0302142_1191831Not Available622Open in IMG/M
3300029943|Ga0311340_10107955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3041Open in IMG/M
3300029999|Ga0311339_10087107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3925Open in IMG/M
3300030054|Ga0302182_10396707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300030057|Ga0302176_10099473Not Available1137Open in IMG/M
3300030520|Ga0311372_12320442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300030580|Ga0311355_10024658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae7420Open in IMG/M
3300030730|Ga0307482_1259715All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031090|Ga0265760_10035328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41480Open in IMG/M
3300031234|Ga0302325_10096529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5557Open in IMG/M
3300031234|Ga0302325_10214034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3287Open in IMG/M
3300031525|Ga0302326_10104894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5043Open in IMG/M
3300031525|Ga0302326_12030741Not Available741Open in IMG/M
3300031525|Ga0302326_12208968Not Available702Open in IMG/M
3300031543|Ga0318516_10137312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1401Open in IMG/M
3300031682|Ga0318560_10355129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300031708|Ga0310686_109638760Not Available1253Open in IMG/M
3300031708|Ga0310686_117741799Not Available573Open in IMG/M
3300031723|Ga0318493_10634905Not Available596Open in IMG/M
3300031748|Ga0318492_10332538All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300031748|Ga0318492_10556723Not Available610Open in IMG/M
3300031753|Ga0307477_10743758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita654Open in IMG/M
3300031754|Ga0307475_10791130Not Available753Open in IMG/M
3300031771|Ga0318546_10520150Not Available835Open in IMG/M
3300031782|Ga0318552_10155331Not Available1151Open in IMG/M
3300031792|Ga0318529_10393523Not Available645Open in IMG/M
3300031799|Ga0318565_10327133All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300031805|Ga0318497_10249332Not Available985Open in IMG/M
3300031910|Ga0306923_10551335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1299Open in IMG/M
3300031910|Ga0306923_11251377All Organisms → cellular organisms → Bacteria → Terrabacteria group790Open in IMG/M
3300031942|Ga0310916_10900549Not Available742Open in IMG/M
3300032001|Ga0306922_11010498Not Available858Open in IMG/M
3300032001|Ga0306922_12090557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300032008|Ga0318562_10653019Not Available606Open in IMG/M
3300032060|Ga0318505_10541877Not Available548Open in IMG/M
3300032805|Ga0335078_10055283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5850Open in IMG/M
3300032828|Ga0335080_11580608Not Available646Open in IMG/M
3300032893|Ga0335069_10553285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1327Open in IMG/M
3300032898|Ga0335072_10578443Not Available1136Open in IMG/M
3300033807|Ga0314866_075301Not Available583Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.33%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa10.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment7.50%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.50%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.50%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.50%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.67%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.67%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.83%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.83%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.83%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.83%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.83%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.83%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.83%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026899Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027029Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029920Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_014598202124908016MTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLM
JGI12269J14319_1003214953300001356Peatlands SoilMTSIVPSGQGHLLTARGNVMAFKAVADQTGGDFSLMERTVPPGA
JGIcombinedJ51221_1024733413300003505Forest SoilMGDXVPSGQGRLXRARGNVMAFKAVAAQTGGDFSLMERTVPPGART
Ga0070714_10239099423300005435Agricultural SoilMTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTV
Ga0070713_10203095513300005436Corn, Switchgrass And Miscanthus RhizosphereMTGIVSPGQGHLLTARGNVMAFKAVADQTGGDFSLMERTVPP
Ga0070711_10085380513300005439Corn, Switchgrass And Miscanthus RhizosphereVSEPSIVSAGQGKVVTARGSVMAFKAVAAQTGGDFSLMERTVPPRGR
Ga0070733_1025472423300005541Surface SoilVSESSIVSAGKGKIVTARGSVMAFKAVGAQTGGDFSLMERTVPPR
Ga0070761_1060543223300005591SoilMDGIVSPGQGHLLTARGNVLAFKAVAAQTGGDFSLME
Ga0070764_1069121423300005712SoilMADIVRPGQGHLLTARGNVLAFKAVADQTGGDFSLMERTVP
Ga0075017_10116306523300006059WatershedsMTSIVPSGQGHLLTARGNVMAFKAVADQTGGDFSLMERTVPPG
Ga0075030_10071323513300006162WatershedsMISIVPSGQGHLLTARGNVMAFKAVADQTGGDFSLMERTV
Ga0116218_122174613300009522Peatlands SoilMTQIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLMERTVPPGA
Ga0116216_1032870413300009698Peatlands SoilMTSIVPSGQGHLLTARGNVMAFKAVADQTGGDFSLMERTVPP
Ga0116216_1081154113300009698Peatlands SoilMTPIVPSGQGHLLTARGNVLAFKAVAAQTGGDFSLMERTVPPG
Ga0116217_1005715213300009700Peatlands SoilMTPIVPSGQGHRLTARGNVLAFKAVAAQTGGDFSLME
Ga0116219_1016526113300009824Peatlands SoilMTEIVPSGQGRMLTARGNVMAFKAVADQTGGDFSLMERTVPPGAR
Ga0126373_1295679813300010048Tropical Forest SoilVTESSIVPAGKGKIVSARGSVMAFKAIAAQTGGDF
Ga0134063_1023840113300010335Grasslands SoilMTGIVPPGQGHLLTARGNVMAFKAVADQTGGDFSLMERTVP
Ga0074044_1081737223300010343Bog Forest SoilMGRIGGMTSIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLMERTVPP
Ga0134125_1156061713300010371Terrestrial SoilVSESSIVSAGKGKVVSARGSVMAFKAIAAQTDGDFSLME
Ga0134125_1246546623300010371Terrestrial SoilMTGIVSPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVP
Ga0126381_10303052323300010376Tropical Forest SoilVITIAIVPPGAGHVLTARGSVMAFKAVAAQTGGDFSLMERTLPSGG
Ga0134126_1146068113300010396Terrestrial SoilMTGIVSPGQGHLLTARGNVMAFKAVADQTGGDFSL
Ga0126361_1097741323300010876Boreal Forest SoilMSDIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTVPPGARTP
Ga0157369_1008257353300013105Corn RhizosphereMSDSSVIPAGMGKIVTARGSVMAFKAVAAQTGGDFSLMER
Ga0163163_1028089443300014325Switchgrass RhizosphereMTRIVSPGQGHLLTARGNVMAFKAVAEQTGGDFSLM
Ga0157376_1170980713300014969Miscanthus RhizosphereMTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPPG
Ga0134073_1040144923300015356Grasslands SoilMTGIVPPGQGQLLTARGNVMAFKAVAEQTGGDFSLMERTVPPGAR
Ga0182041_1025745033300016294SoilMTDIVPSGQGHRLTARGNVMAFKAVADQTGGDFSLM
Ga0182040_1168990423300016387SoilMTGVVSSGQGHMLTARGNVMAFKAVAAQTGGDFSLME
Ga0187802_1008769723300017822Freshwater SedimentMTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTV
Ga0187818_1007237533300017823Freshwater SedimentMTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTVPPG
Ga0187818_1039787023300017823Freshwater SedimentMTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTVP
Ga0187814_1020425713300017932Freshwater SedimentMTGIVPSGQGRLLSARGNVMAFKAVAAQTGGDFSLMERTVPP
Ga0187809_1019008113300017937Freshwater SedimentMTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSL
Ga0187808_1008324833300017942Freshwater SedimentMTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMER
Ga0187808_1020176723300017942Freshwater SedimentMTGEGVIPAGKGSKIYSARGSVMAFKAVADQTSGDFSL
Ga0187779_1036598923300017959Tropical PeatlandMTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTVPPGARGTG
Ga0187777_1096599513300017974Tropical PeatlandMNEIVPSGIVSAGQGHLLTARGNVMAFKAVADQTGGDFS
Ga0187782_1131130823300017975Tropical PeatlandMTGIVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVP
Ga0187822_1022256223300017994Freshwater SedimentMTDIVPAGRGQLLTARGNVMAFKAVAGQTGGGFSLMERTVPPG
Ga0187805_1039174023300018007Freshwater SedimentVTESGIIAAGKGTIVAARGSVMAFKAIAAQTGGDF
Ga0187884_1024276823300018009PeatlandMNDVVPSGQGHLLTARGNVMAFKAVAAQTRGDFSL
Ga0066669_1101568413300018482Grasslands SoilMDVLRPGEGHLLTAQGSTMAFKAVAAQTGGDFVLVPRGV
Ga0210400_1144594813300021170SoilMTDPSVMPAGQGRILSARGSVMAFKAGAEQTGGDFSLMERILPPRG
Ga0210405_1093256913300021171SoilMTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERSRYGMEPAGQNPLL
Ga0210405_1119536523300021171SoilMANIVPSGQGRLLRARGNVMAFKAVAAQTGGDFSLM
Ga0210388_1033293713300021181SoilVSEPGIIAAGEGTIVAARGSVMAFKAIAAQTGGDFSLME
Ga0193699_1021395423300021363SoilMTGIVPPGQGHLLTARGNEMAFKAVAEQTGGDFSLMERTVPPGAR
Ga0213875_1018839323300021388Plant RootsMSEIVPSGQGHLLTARGNVMAFKAVAEQTGGDFSLMERSVPAGAPM
Ga0210397_1010701313300021403SoilVSESSIVSTGKGKVVTARGSVMAFKAIAAQTDGDFS
Ga0210383_1003161643300021407SoilVSEPGIIAAGEGTIVAARGSVMAFKAIAAQTGGDFSLMERTVPPR
Ga0210390_1006057353300021474SoilMGDIVPSGQGRLLRARGNVMAFKAVAAQTGGDFSLMERTVPPG
Ga0210392_1021685213300021475SoilMTDHSVIPAGLGRILKARGSVMAFKAGREQTGGDFSLMER
Ga0233357_102241223300023056SoilVDGIVPPGAGHILTARGSVMAFKAVAAQTGGDFSLMERT
Ga0224557_126952123300023101SoilVAGNGVIPPGAGHTLTARGSIMAFKAVAEQTGGDFSL
Ga0207642_1057658823300025899Miscanthus RhizosphereMTDIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPPGAR
Ga0207705_1050770113300025909Corn RhizosphereMTDIVPPGQGHLLTARGNVMAFKAVAEQTGGAGDFLLV
Ga0207684_1035429523300025910Corn, Switchgrass And Miscanthus RhizosphereMTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLME
Ga0207693_1069491813300025915Corn, Switchgrass And Miscanthus RhizosphereMTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMER
Ga0207646_1005582533300025922Corn, Switchgrass And Miscanthus RhizosphereVSEPSIIAAGKGTIVTARGSVMAFKAIAAQTGGDFSLMERT
Ga0207700_1053259113300025928Corn, Switchgrass And Miscanthus RhizosphereVSEPSIIAAGKGTIVTARGSVMAFKAIAAQTGGDFSLMERTVPPRGRR
Ga0207664_1005706343300025929Agricultural SoilMTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLME
Ga0207664_1080142123300025929Agricultural SoilVTESGIIGAGQGSIVAARGSVMAFKAIAAQTGGDFSLMERTVPPRGRR
Ga0207658_1158849323300025986Switchgrass RhizosphereMTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERT
Ga0207676_1178520123300026095Switchgrass RhizosphereMTGIVSPGQGHLLTARGNVMAFKAVADQTGGDFSLM
Ga0209648_1007109733300026551Grasslands SoilMTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTVPLMSRYGMEPA
Ga0209648_1037861423300026551Grasslands SoilMTGIVPSGQGHMLTARGNVMAFKAVAGQTGRPNGS
Ga0209326_100486623300026899Forest SoilMTDIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSL
Ga0208731_101180123300027029Forest SoilMTGIVPSGQGHLLTARGNVMAFKAVADQTGGDFSLME
Ga0209622_106896623300027502Forest SoilVSEPSIVSAGKGKIVTARGSVMAFKAIAAQTDGDFSLME
Ga0209074_1010031713300027787Agricultural SoilMTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPP
Ga0209656_1004034643300027812Bog Forest SoilMTEIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLMERTV
Ga0209656_1020983713300027812Bog Forest SoilMGRIGGMTSIVPSGEGHLLTARGNVMAFKAVADQTGGD
Ga0209040_1008511743300027824Bog Forest SoilMTEIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLM
Ga0209040_1038388813300027824Bog Forest SoilMGRIGGMTSIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLM
Ga0209039_1026574423300027825Bog Forest SoilMGRIGGMTSIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLMERTVPPGA
Ga0209167_1054587523300027867Surface SoilVSESSIVSAGKGKIVTARGSVMAFKAVAAQTGGDFSLMERTVPPRG
Ga0302225_1039356223300028780PalsaMTDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPP
Ga0302235_1045976513300028877PalsaVTESSIIAAGKGNIVTARGSVMAFKAIAAQTDGDFSLMERT
Ga0302142_119183113300029920BogVAGPGVVPPGEGHLLTARGSVMAFKAVAAQTGGDFSL
Ga0311340_1010795543300029943PalsaMTDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMER
Ga0311339_1008710753300029999PalsaMSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPPGA
Ga0302182_1039670713300030054PalsaMSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPS
Ga0302176_1009947313300030057PalsaMTDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPPG
Ga0311372_1232044223300030520PalsaVTETSIISAGNGKIVTARGSVMAFKAIAAQTDGDFSLMERTVPPH
Ga0311355_1002465813300030580PalsaMSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPPG
Ga0307482_125971513300030730Hardwood Forest SoilMTDDGRRIVPAGEGHLLTARGNLLAFKAVAAETGGDFSLMERTV
Ga0265760_1003532813300031090SoilMTPIVPAGAGHVLTARGSVMAFKAVARQTGGDFSL
Ga0302325_1009652913300031234PalsaMSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPP
Ga0302325_1021403413300031234PalsaMSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVP
Ga0302326_1010489413300031525PalsaVSESSIVSAGKGKIVAARGSVMAFKAVAATTDGDFSLMERTVPAHGR
Ga0302326_1203074123300031525PalsaMSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLME
Ga0302326_1220896813300031525PalsaMTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLM
Ga0318516_1013731213300031543SoilMTDIVPPGQGHLLTARGNVMAFKAVAEQTSGDFSLMERTVP
Ga0318560_1035512913300031682SoilMTGIVPSGQGRRLTARGNVMAFKAVAAQTGGDFSLMERTVPP
Ga0310686_10963876033300031708SoilVGGVTESSIIPAGAGQLVTARGSVMAFKAVAASTGGDFSLMERTVPPHGRR
Ga0310686_11774179923300031708SoilVPAGRGQLFTARGNVMAFKAVAAQTGGDFSLMERTVP
Ga0318493_1063490523300031723SoilMTDIVPAGRGLLLTARGNVMAFKAVAAQTDGDFSVMER
Ga0318492_1033253813300031748SoilMTEIVPPGQGHLLTARGNVMAFKAVAEQTSGDFSLME
Ga0318492_1055672323300031748SoilMTGVVSLGQGHMLTARGNVMAFKAVAAQTGGDFSLMERTVPPGA
Ga0307477_1074375823300031753Hardwood Forest SoilMTGIVPSGQGRVLTARGNVMAFKAVAAQTGGDFSLMERTRAALPV
Ga0307475_1079113023300031754Hardwood Forest SoilVTESGIIGAGQGAIVAARGSVMAFKAIAAQTGGDFSLMERTVPPR
Ga0318546_1052015023300031771SoilMTDIVPAGRGRLLTARGNVMAFKAVAAQTGGDFSVM
Ga0318552_1015533123300031782SoilMTDIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERT
Ga0318529_1039352323300031792SoilMTGVVSSGQGHMLTARGNVMAFKAVAAQTGGDFSLMERTVQP
Ga0318565_1032713323300031799SoilMTGIVPPGQGRQLTARGNVMAFKAVADQTGGDFSLMER
Ga0318497_1024933213300031805SoilMTDIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMER
Ga0306923_1055133513300031910SoilMTDIVPSGQGRLLTARGNVMAFKAVAAQTDGDFSLMER
Ga0306923_1125137713300031910SoilMTDIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPP
Ga0310916_1090054923300031942SoilMTDIVPAGRGRLLTARGNVMAFKAVAAQTGGDFSVMERTVP
Ga0306922_1101049823300032001SoilMTEIVPPGQGHLLTARGNVMAFKAVAEQTSGDFSL
Ga0306922_1209055713300032001SoilMTTIVPSGEGHLLTARGSVMAFKAVAAQTGGDFSL
Ga0318562_1065301923300032008SoilMTGIVPPGEGHLLTARGNVMAFKAVADQTGGTMPVM
Ga0318505_1054187713300032060SoilMTEIVPPGQGHLLTARGNVMAFKAVAEQTSGDFSLMERTVP
Ga0335078_1005528373300032805SoilMTDIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPPGART
Ga0335080_1158060823300032828SoilMTDIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPPG
Ga0335069_1055328523300032893SoilMTGIIGPGEGHLFTARGSTMAFKALAAQTGGDFSLMERT
Ga0335072_1057844323300032898SoilMVSMTEHSIIPAGKGRIVGARGSVMAFKAVAEQTDGGFSLMER
Ga0314866_075301_475_5823300033807PeatlandMTGIVPSGQGHLLTARGNVMAFKAVTEQTSGDFSLM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.