NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F072876

Metagenome Family F072876

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072876
Family Type Metagenome
Number of Sequences 121
Average Sequence Length 44 residues
Representative Sequence MEMSKQSYNETLSMPVKRFYNYLKWKSDLEEEKQKMILEEVGK
Number of Associated Samples 79
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 11.11 %
% of genes near scaffold ends (potentially truncated) 15.70 %
% of genes from short scaffolds (< 2000 bps) 47.93 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.298 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface
(14.876 % of family members)
Environment Ontology (ENVO) Unclassified
(20.661 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(23.140 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.07%    β-sheet: 0.00%    Coil/Unstructured: 54.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF04965GPW_gp25 45.45
PF10983DUF2793 8.26
PF04984Phage_sheath_1 3.31
PF04055Radical_SAM 3.31
PF10127RlaP 2.48
PF07460NUMOD3 1.65
PF02649GCHY-1 0.83
PF13240zinc_ribbon_2 0.83
PF01653DNA_ligase_aden 0.83
PF07963N_methyl 0.83
PF03237Terminase_6N 0.83
PF13353Fer4_12 0.83
PF01743PolyA_pol 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG3497Phage tail sheath protein FIMobilome: prophages, transposons [X] 3.31
COG0272NAD-dependent DNA ligaseReplication, recombination and repair [L] 0.83
COG0617tRNA nucleotidyltransferase/poly(A) polymeraseTranslation, ribosomal structure and biogenesis [J] 0.83
COG1469GTP cyclohydrolase FolE2Coenzyme transport and metabolism [H] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.74 %
UnclassifiedrootN/A8.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001390|SMAR1_102086All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B182026Open in IMG/M
3300001533|MLSed_10005100All Organisms → cellular organisms → Bacteria21655Open in IMG/M
3300001751|JGI2172J19969_10004796All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin1605940Open in IMG/M
3300002180|JGI24724J26744_10016713All Organisms → cellular organisms → Bacteria3823Open in IMG/M
3300003991|Ga0055461_10137065All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18637Open in IMG/M
3300004027|Ga0055459_10228848All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300004050|Ga0055491_10000294All Organisms → cellular organisms → Bacteria5209Open in IMG/M
3300004050|Ga0055491_10003100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B182487Open in IMG/M
3300004073|Ga0055516_10068941All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300004146|Ga0055495_10128113All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005265|Ga0073580_100354Not Available24642Open in IMG/M
3300005590|Ga0070727_10046636All Organisms → Viruses → Predicted Viral2626Open in IMG/M
3300005600|Ga0070726_10068754All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin1601918Open in IMG/M
3300005600|Ga0070726_10609946All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300005645|Ga0077109_1028677All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin1602143Open in IMG/M
3300005821|Ga0078746_1061369All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160827Open in IMG/M
3300005917|Ga0075115_10094505All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin1601090Open in IMG/M
3300005918|Ga0075116_10020265All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin1602862Open in IMG/M
3300007764|Ga0102950_1000091All Organisms → cellular organisms → Bacteria21222Open in IMG/M
3300007776|Ga0105674_1291824All Organisms → Viruses → Predicted Viral1617Open in IMG/M
3300007871|Ga0111032_1087877All Organisms → cellular organisms → Bacteria7296Open in IMG/M
3300008516|Ga0111033_1291555All Organisms → cellular organisms → Bacteria23546Open in IMG/M
3300008517|Ga0111034_1075212All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181409Open in IMG/M
3300008517|Ga0111034_1260177All Organisms → Viruses → Predicted Viral2130Open in IMG/M
3300009082|Ga0105099_10495291All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300009149|Ga0114918_10000716Not Available29009Open in IMG/M
3300009149|Ga0114918_10018300All Organisms → cellular organisms → Bacteria5329Open in IMG/M
3300009149|Ga0114918_10041875All Organisms → cellular organisms → Bacteria3154Open in IMG/M
3300009488|Ga0114925_10000061All Organisms → cellular organisms → Bacteria35279Open in IMG/M
3300009488|Ga0114925_11317389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18533Open in IMG/M
3300009488|Ga0114925_11449492Not Available509Open in IMG/M
3300009788|Ga0114923_10014236All Organisms → cellular organisms → Bacteria5342Open in IMG/M
3300010392|Ga0118731_107861219All Organisms → cellular organisms → Bacteria9247Open in IMG/M
3300010392|Ga0118731_113492928All Organisms → cellular organisms → Bacteria16308Open in IMG/M
3300010413|Ga0136851_11100427All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300011118|Ga0114922_10009582All Organisms → cellular organisms → Bacteria8817Open in IMG/M
3300011118|Ga0114922_10067951All Organisms → cellular organisms → Bacteria3083Open in IMG/M
3300011118|Ga0114922_10187693All Organisms → Viruses → Predicted Viral1747Open in IMG/M
3300011118|Ga0114922_10229735All Organisms → cellular organisms → Bacteria1559Open in IMG/M
3300013099|Ga0164315_10090100All Organisms → Viruses → Predicted Viral2473Open in IMG/M
3300013099|Ga0164315_10369650All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300013101|Ga0164313_10043242All Organisms → cellular organisms → Bacteria3797Open in IMG/M
3300013101|Ga0164313_10109805All Organisms → cellular organisms → Bacteria2328Open in IMG/M
3300013103|Ga0164318_10675825All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18874Open in IMG/M
3300014903|Ga0164321_10001542All Organisms → cellular organisms → Bacteria5311Open in IMG/M
3300014913|Ga0164310_10407657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18799Open in IMG/M
3300017963|Ga0180437_10000970Not Available50843Open in IMG/M
3300017963|Ga0180437_10243611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181391Open in IMG/M
3300017971|Ga0180438_11369605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18505Open in IMG/M
3300017987|Ga0180431_10000031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales179738Open in IMG/M
3300017987|Ga0180431_10009996All Organisms → cellular organisms → Bacteria10611Open in IMG/M
3300017987|Ga0180431_10021446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B186546Open in IMG/M
3300017989|Ga0180432_10057826All Organisms → cellular organisms → Bacteria3577Open in IMG/M
3300017989|Ga0180432_10143552All Organisms → cellular organisms → Bacteria1977Open in IMG/M
3300017991|Ga0180434_10166238All Organisms → Viruses → Predicted Viral1787Open in IMG/M
3300017991|Ga0180434_10206309All Organisms → Viruses → Predicted Viral1574Open in IMG/M
3300017991|Ga0180434_10469663All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300018080|Ga0180433_10666463All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300021511|Ga0190284_1000269All Organisms → cellular organisms → Bacteria34769Open in IMG/M
3300021511|Ga0190284_1005637All Organisms → cellular organisms → Bacteria4128Open in IMG/M
(restricted) 3300022938|Ga0233409_10221611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18643Open in IMG/M
(restricted) 3300023086|Ga0233407_10012208All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18918Open in IMG/M
(restricted) 3300023089|Ga0233408_10042700All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18794Open in IMG/M
3300024262|Ga0210003_1003696All Organisms → cellular organisms → Bacteria12341Open in IMG/M
3300024262|Ga0210003_1072834All Organisms → cellular organisms → Bacteria1647Open in IMG/M
3300024262|Ga0210003_1239049All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300024265|Ga0209976_10062565All Organisms → cellular organisms → Bacteria1947Open in IMG/M
(restricted) 3300024340|Ga0255042_10227299All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300024432|Ga0209977_10000594All Organisms → cellular organisms → Bacteria14508Open in IMG/M
3300024432|Ga0209977_10000596All Organisms → cellular organisms → Bacteria14498Open in IMG/M
(restricted) 3300024519|Ga0255046_10179840All Organisms → cellular organisms → Bacteria952Open in IMG/M
(restricted) 3300024519|Ga0255046_10204558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18897Open in IMG/M
(restricted) 3300024519|Ga0255046_10247250All Organisms → cellular organisms → Bacteria822Open in IMG/M
(restricted) 3300024528|Ga0255045_10090722All Organisms → cellular organisms → Bacteria1096Open in IMG/M
(restricted) 3300024528|Ga0255045_10294736All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300025661|Ga0208905_1005634All Organisms → cellular organisms → Bacteria5548Open in IMG/M
3300025790|Ga0210075_1000600Not Available7032Open in IMG/M
3300025950|Ga0210134_1000979All Organisms → cellular organisms → Bacteria4233Open in IMG/M
3300025950|Ga0210134_1004874All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181985Open in IMG/M
3300025969|Ga0210080_1044669All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300026064|Ga0208146_1035537All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18517Open in IMG/M
3300026122|Ga0209926_1025256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181044Open in IMG/M
3300027726|Ga0209285_10049776All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300027814|Ga0209742_10205950All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300027852|Ga0209345_10026997All Organisms → cellular organisms → Bacteria4197Open in IMG/M
3300027852|Ga0209345_10401951Not Available807Open in IMG/M
(restricted) 3300027856|Ga0255054_10000328All Organisms → cellular organisms → Bacteria28365Open in IMG/M
(restricted) 3300027861|Ga0233415_10347659All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160705Open in IMG/M
(restricted) 3300027861|Ga0233415_10381291All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160673Open in IMG/M
3300027888|Ga0209635_10000122All Organisms → cellular organisms → Bacteria45542Open in IMG/M
3300027917|Ga0209536_100046647All Organisms → cellular organisms → Bacteria5720Open in IMG/M
3300028169|Ga0268279_1055011All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin1601174Open in IMG/M
3300028595|Ga0272440_1088244All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181142Open in IMG/M
3300028920|Ga0272441_10151952All Organisms → cellular organisms → Bacteria2160Open in IMG/M
3300028920|Ga0272441_11095938All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300029827|Ga0134606_10001969All Organisms → cellular organisms → Bacteria8902Open in IMG/M
3300031256|Ga0315556_1002769All Organisms → cellular organisms → Bacteria9864Open in IMG/M
3300031280|Ga0307428_1058403All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300031379|Ga0307434_1211498All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18509Open in IMG/M
3300031539|Ga0307380_10000037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales227820Open in IMG/M
3300031539|Ga0307380_10008040All Organisms → cellular organisms → Bacteria13592Open in IMG/M
3300031539|Ga0307380_10008181All Organisms → cellular organisms → Bacteria13445Open in IMG/M
3300031539|Ga0307380_10010268All Organisms → cellular organisms → Bacteria11809Open in IMG/M
3300031539|Ga0307380_10013407All Organisms → cellular organisms → Bacteria10127Open in IMG/M
3300031539|Ga0307380_10324929All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300031578|Ga0307376_10000826All Organisms → cellular organisms → Bacteria36378Open in IMG/M
3300031578|Ga0307376_10039165All Organisms → cellular organisms → Bacteria3521Open in IMG/M
3300031578|Ga0307376_10233502All Organisms → cellular organisms → Bacteria1245Open in IMG/M
3300031601|Ga0307992_1002982All Organisms → cellular organisms → Bacteria9484Open in IMG/M
3300031601|Ga0307992_1236987All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300031654|Ga0315549_1000525All Organisms → cellular organisms → Bacteria44570Open in IMG/M
3300031707|Ga0315291_10109223All Organisms → cellular organisms → Bacteria2966Open in IMG/M
3300031746|Ga0315293_10120195All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B182213Open in IMG/M
3300032053|Ga0315284_10046512All Organisms → cellular organisms → Bacteria5998Open in IMG/M
3300032177|Ga0315276_10389344All Organisms → cellular organisms → Bacteria1492Open in IMG/M
3300032260|Ga0316192_10720631All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18672Open in IMG/M
3300032276|Ga0316188_10252208All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18901Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface14.88%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment11.57%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands8.26%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil8.26%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment7.44%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment5.79%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.96%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater4.96%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.31%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment3.31%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment2.48%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine2.48%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.65%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.65%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow1.65%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.65%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment1.65%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.65%
Hydrothermal Vent Microbial MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat1.65%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.65%
BenthicEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic0.83%
SedimentEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Sediment0.83%
Diffuse Vent Fluid, Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents0.83%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents0.83%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.83%
Lake WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Lake Water0.83%
Brackish WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water0.83%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.83%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001390SMAR1EnvironmentalOpen in IMG/M
3300001533Benthic freshwater microbial communities from British Columbia, CanadaEnvironmentalOpen in IMG/M
3300001751Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32EnvironmentalOpen in IMG/M
3300002180Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7EnvironmentalOpen in IMG/M
3300003991Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004027Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2EnvironmentalOpen in IMG/M
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004073Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2EnvironmentalOpen in IMG/M
3300004146Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2EnvironmentalOpen in IMG/M
3300005265Hydrothermal sediment microbial communities from Guaymas Basin, California, USA 4484. Combined assembly of Gp0115313 and Gp0146561EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005645Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m)EnvironmentalOpen in IMG/M
3300005821Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1EnvironmentalOpen in IMG/M
3300005917Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKHEnvironmentalOpen in IMG/M
3300005918Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKCEnvironmentalOpen in IMG/M
3300007764Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MGEnvironmentalOpen in IMG/M
3300007776Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS915_Marker113_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007871Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf. Combined Assembly of MM2PM2EnvironmentalOpen in IMG/M
3300008516Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3EnvironmentalOpen in IMG/M
3300008517Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300009788Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300013099Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cmEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013103Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cmEnvironmentalOpen in IMG/M
3300014903Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cmEnvironmentalOpen in IMG/M
3300014913Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cmEnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300017971Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaGEnvironmentalOpen in IMG/M
3300017987Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaGEnvironmentalOpen in IMG/M
3300017989Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaGEnvironmentalOpen in IMG/M
3300017991Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaGEnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300021511Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-1-2_MGEnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300023086 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_7_MGEnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024265Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024340 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5EnvironmentalOpen in IMG/M
3300024432Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300025661Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS (SPAdes)EnvironmentalOpen in IMG/M
3300025790Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025950Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025969Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026064Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026122Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027726Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027814Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027852Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes)EnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027888Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028169Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_80mEnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300028920Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6NEnvironmentalOpen in IMG/M
3300029827Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047EnvironmentalOpen in IMG/M
3300031256Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10EnvironmentalOpen in IMG/M
3300031280Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240EnvironmentalOpen in IMG/M
3300031379Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-220EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031601Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133EnvironmentalOpen in IMG/M
3300031654Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-200EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SMAR1_10208643300001390Hydrothermal VentsMELSKQSYLQILEMPIQRFYNYLKWKTELEEEKRKLMEEKTSNG*
MLSed_10005100243300001533BenthicMEMSKQSYSDVTKMPVKKFYDYLKWKSDLEEEKRKMILEEVGK*
JGI2172J19969_1000479633300001751Marine SedimentMSGMSYSEIAAMPLKRFFDYLKWKTDLEDEKRKLVREESKKLR*
JGI24724J26744_1001671323300002180MarineMEMCKSAYTSVIEMPIKRFYNYLKWKINLEEDKKKMINEEMTKKG*
Ga0055461_1013706523300003991Natural And Restored WetlandsMELSNQSYPEVMSMPVKRLQNYLKWKGDLEEEKRKMISEEALKVRR*
Ga0055459_1022884813300004027Natural And Restored WetlandsMEMSKQSYDHVIKMPVKRFYNYLKWKSDLEEEKKTMLAEQVLSGLGKG
Ga0055491_1000029443300004050Natural And Restored WetlandsMEMSKQSYQEVTAMPIKKFYDYLKWKTDLEEEKQKMILEGIGKK*
Ga0055491_1000310023300004050Natural And Restored WetlandsMEMSKQSYDDVIQMPVQRFYNYLKWKSNLEEEKKKMLAENIISGLGGAM*
Ga0055516_1006894123300004073Natural And Restored WetlandsMEMSKQSYSDVMAMPVKRFQDYMKWKTDLEEEKQKMLLEGVGKKK*
Ga0055495_1012811313300004146Natural And Restored WetlandsMEMSKQSYQEVTAMPIKKFYDYLKWKTDLEEEKQKMILEGIG
Ga0073580_100354223300005265SedimentMELSKQGYQDVVDMPIKRFYNYLKWKTDLEEDKKKMIEEQIKGG*
Ga0070727_1004663633300005590Marine SedimentMEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEVKRLK*
Ga0070726_1006875443300005600Marine SedimentMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEVKRLK*
Ga0070726_1060994623300005600Marine SedimentMEMSKQSYPDTVSMPVKRLYDYLKWKTELEDEKQKL
Ga0077109_102867753300005645Brackish WaterMEMSKQSYIEVIMIPVKRFYNYLKWKSDLENEKQKQINEETSRR*
Ga0078746_106136913300005821Marine SedimentMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKIMKEEVKKLK*
Ga0075115_1009450523300005917Saline LakeMELSKQSYSETVMMPVKKFQDYLKWKSELEDSKQKQMQEQTERK*
Ga0075116_1002026563300005918Saline LakeFSCMELSKQSYFEIMFMPIKRFYDYLKWKSKLDEERAKQMEDL*
Ga0102950_100009143300007764SoilMEMSKQGYSEVTLMPVKKFYDYLKWKTKLEEEKQKMILEHTGK*
Ga0105674_129182423300007776Diffuse Vent Fluid, Hydrothermal VentsMEMSKQPYQNVVDMPINRFYNYLKWKTDLEEDKKKAIEEQIAQG*
Ga0111032_108787733300007871Marine SedimentMEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKIMKEEVKKLK*
Ga0111033_1291555153300008516Marine SedimentMEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKMMKEEVKKLK*
Ga0111034_107521223300008517Marine SedimentMEMSKQSYGDVMSMPVKRFQDYMKWKSDLEDEKQKMLVEGISKT*
Ga0111034_126017723300008517Marine SedimentMEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEVKKLK*
Ga0105099_1049529123300009082Freshwater SedimentMEMSKQSYSEIMSMPVKRFYNYLKWKTDLEEEKRKMILEETTKK*
Ga0114918_10000716223300009149Deep SubsurfaceMEMSKQSYVEVASMPVKRFFNYLKWKTDLEEERRKMMLEEVTR*
Ga0114918_1001830083300009149Deep SubsurfaceMELSKQPYGEVMLMPVKRFQNYMKWKNDLEDEKQKMILEEVNSK*
Ga0114918_1004187543300009149Deep SubsurfaceMEMSKQSYNQVMMMPIKKLKDYLKWKSNLEEEKQKLMEEQVSK*
Ga0114918_1036469223300009149Deep SubsurfaceMEMSKQSYVEVVNMPVKKFYDYLSWKIKLEEEKRKIMEEETGK*
Ga0114925_10000061443300009488Deep SubsurfaceMEMSKQSYIETIMMPVKRFQDYLKWKSDLEDERKKMIQEETL*
Ga0114925_1131738923300009488Deep SubsurfaceMELSKQSYTETVLMPVKRFYDYLKWKSDLEEERRKIMEEKINQT*
Ga0114925_1144949223300009488Deep SubsurfaceMEMSKQSYLETTSMPVKKLQDYLKWKTDLESERKKVLEES*
Ga0114923_1001423643300009788Deep SubsurfaceMEMSKQSYPETMRMPVKRLYNYLQWKSDLEDEKQKLIEELGKN*
Ga0118731_10786121973300010392MarineMEMSKSTYQGVVEMPIKRFYNYLKWKTDLEEDKKKMIEEEIGR*
Ga0118731_113492928173300010392MarineMEMSKQSYPDTVSMPVKRLYDYLKWKTELEDEKQKLIEEVTKQ*
Ga0136851_1110042723300010413Mangrove SedimentMEMSKQSYIDTMMMPVKKFQNYLKWKNDLEEEKQKMILEEVGKRR*
Ga0114922_10009582103300011118Deep SubsurfaceMEMSKQSYADVTKMPVKKFYDYLKWKSTLEEEKRKMMLEEIGKK*
Ga0114922_1006795133300011118Deep SubsurfaceMEMSKQSYRDVVDMPIKRFYNYLKWKTDLEDDKKKMIEEQIKGG*
Ga0114922_1018769323300011118Deep SubsurfaceMEMSKQGYQDVVDMPIKRFYNYLKWKTDLEEDKKKMIEEQIKGG*
Ga0114922_1022973533300011118Deep SubsurfaceMEMSKQGYQDVVDMPIKRFYNYLKWKTDLEEDKKKMIEEQIQGRK*
Ga0164315_1009010043300013099Marine SedimentMEMSNQSYIEVASMPVKRFFNYLKWKTDLEEERRKMMAEGIK*
Ga0164315_1036965023300013099Marine SedimentMEMSKQSYNEIMLMPVKRFSNYMRWKTNLEDEKQKMILEEVNIK*
Ga0164313_1004324243300013101Marine SedimentMEMSKQSYGEIVMMPVQRFYSYLKWKSDLEEEKKKMVTEEILSGLKG*
Ga0164313_1010980543300013101Marine SedimentMEMSKQGYQDVVDMPIKRFYNYLKWKSDLEEDKKKMIEEQIKGG*
Ga0164318_1067582523300013103Marine SedimentMEMSKQSYSEVMLMPVKRFQNYMRWKSDLEDEKQKMILEEVT*
Ga0164321_1000154233300014903Marine SedimentMEMSKQSYNETLSMPVKRFYNYLKWKSDLEEEKQKMILEEVGK*
Ga0164310_1040765723300014913Marine SedimentMEMSKQPYQNVVDMPVKRFYNYLKWKTDLEEDKKKAIEEQIAQG*
Ga0180437_10000970473300017963Hypersaline Lake SedimentMEMSKQSYGETMLMPVKRFQDYLKWKTDLEDEKQKMLLEGAS
Ga0180437_1024361113300017963Hypersaline Lake SedimentSYPDVNMMPIKRFYNYLKWKTDLEEDKKKMVTEEISKRGK
Ga0180438_1136960513300017971Hypersaline Lake SedimentMSKQSYQAVVAMPVKRFYNYLKWKNDLEEEKKKMIEEEVGR
Ga0180431_10000031263300017987Hypersaline Lake SedimentMEMSRQSYPEVMIMPIGKFHAYLKWKSDLEEEKQKMMEEEANK
Ga0180431_1000999683300017987Hypersaline Lake SedimentMEMSKQSYSDVMKMPVKKFYDYLKWKSDLEEEKRKMILEEVGKR
Ga0180431_1002144643300017987Hypersaline Lake SedimentMEMSKQSYQQVMMMPIYKFYAYIKWKSNLEEEKQKMMEEEANK
Ga0180432_1005782643300017989Hypersaline Lake SedimentMEMSKQSYNDTMLMPVKRFQDYLKWKTDLEDEKQKMLLEGSK
Ga0180432_1014355233300017989Hypersaline Lake SedimentMSRQSYSDVMKMPIKKLKDYIAWKTNLEEEKKKMMEEQGSK
Ga0180434_1000411173300017991Hypersaline Lake SedimentMEMSKTPYQSVTDMPIKRFYNYLKWKTDLEEDKKKMVAEEISKRG
Ga0180434_1016623823300017991Hypersaline Lake SedimentMSKQSYNETVLMPVNRFYNYLKWKTELEEEKRKMITEEISKKK
Ga0180434_1020630933300017991Hypersaline Lake SedimentMEFSKQGYIETVMMPVKKFYDYLKWKTTLEEERQKIMEEQTSQMKY
Ga0180434_1046966323300017991Hypersaline Lake SedimentMLESNIFACMEMSKQSYPDVNMMPIKRFYNYLKWKTDLEEDKKKM
Ga0180433_1066646313300018080Hypersaline Lake SedimentMELSRQSYNQVLSMPIQRFYDYLKWKNDLEEEKQKL
Ga0180433_1091594113300018080Hypersaline Lake SedimentMEMSKQGYQDVVDMPIKRFYNYLKWKTDLEEDKKKTIDEEIAKR
Ga0190284_100026973300021511Hydrothermal Vent Microbial MatMEMSKQSYSDTMLMPVKRFQDYLKWKTDLEDEKQKMLLEGTS
Ga0190284_100563773300021511Hydrothermal Vent Microbial MatLEKNVFACMEMSKQSYRETMLMPVKRFYNYLKWKNDLEEEKQKMMLEEVSKK
(restricted) Ga0233409_1022161123300022938SeawaterMEMSKQPYGDVMLMPVKRFQDYLKWKTDLEDEKQKMLLEGAS
(restricted) Ga0233407_1001220833300023086SeawaterMELSSQSYPETMSMPVQRFYDYLKWKSDLEDEKQKLIKEKTTGDV
(restricted) Ga0233408_1004270033300023089SeawaterSKQGYQDVVAMPIKRFYNYLKWKTDLEEDKKKMIEESIRGG
Ga0210003_1003696133300024262Deep SubsurfaceMEMSKQSYVEVASMPVKRFFNYLKWKTDLEEERRKMMLEEVTR
Ga0210003_107283423300024262Deep SubsurfaceMELSKQPYGEVMLMPVKRFQNYMKWKNDLEDEKQKMILEEVNSK
Ga0210003_123904923300024262Deep SubsurfaceMEMSKQSYNQVMMMPIKKLKDYLKWKSNLEEEKQKLMEEQVSK
Ga0209976_1006256543300024265Deep SubsurfaceMEMSKQSYPETMRMPVKRLYNYLQWKSDLEDEKQKLIEELGKN
(restricted) Ga0255042_1022729913300024340SeawaterMEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEV
Ga0209977_10000594153300024432Deep SubsurfaceKRVLTENIFGCMEMSKQSYPETMLMPVKKLQDYLKWKTDLESERKKVLEES
Ga0209977_10000596183300024432Deep SubsurfaceMCMEMSKQSYIETIMMPVKRFQDYLKWKSDLEDERKKMIQEETL
(restricted) Ga0255046_1017984023300024519SeawaterMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEV
(restricted) Ga0255046_1020455823300024519SeawaterMEMSKQGYQDVVAMPIKRFYNYLKWKTDLEEDKKKMIEESIRGG
(restricted) Ga0255046_1024725023300024519SeawaterMEMSKQPYGDVMLMPVKRFQDYLKWKTDLEDEKQKMLLEGTS
(restricted) Ga0255045_1009072213300024528SeawaterMEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEVKRLK
(restricted) Ga0255045_1029473613300024528SeawaterMEMSKQSYQAVVDMPIKRFYNYLKWKTDLEDDKKKMI
Ga0208905_100563483300025661Lake WaterMELSKQSYSETVMMPVKKFQDYLKWKSELEDSKQKQMQEQTERK
Ga0210075_100060023300025790Natural And Restored WetlandsMEMSKQSYDHVIKMPVKRFYNYLKWKSDLEEEKKTMLAEQVLSGLGKGYK
Ga0210134_100097923300025950Natural And Restored WetlandsMEMSKQSYQEVTAMPIKKFYDYLKWKTDLEEEKQKMILEGIGKK
Ga0210134_100487443300025950Natural And Restored WetlandsMEMSKQSYDDVIQMPVQRFYNYLKWKSNLEEEKKKMLAENIISGLGGAM
Ga0210080_104466913300025969Natural And Restored WetlandsMEMSKQSYSDVMAMPVKRFQDYMKWKTDLEEEKQKMLLEGVGKKK
Ga0208146_103553713300026064Natural And Restored WetlandsYTCMEMSKQSYDDVIQMPVQRFYNYLKWKSNLEEEKKKMLAENIISGLGGAM
Ga0209926_102525623300026122SoilMEMSKQGYSEVTLMPVKKFYDYLKWKTKLEEEKQKMILEHTGK
Ga0209285_1004977613300027726Freshwater SedimentMMDMSHQSYPETMNMPVKAFYDYIKWKNDLEEKKQKTIQEM
Ga0209742_1020595013300027814Marine SedimentMEIGKQSYTDVMQMPIKRLYNYLKWKSDLEDEKQKLIEEVTKK
Ga0209345_1002699743300027852MarineMEMCKSAYTSVIEMPIKRFYNYLKWKINLEEDKKKMINEEMTKKG
Ga0209345_1040195123300027852MarineMSKQSYDQVIAMPIKRFYNYLRWKSDLEDEKQKMILDEVGK
(restricted) Ga0255054_10000328143300027856SeawaterMEMSGMSYSEVAAMPVKKLFDYLKWKSDLEDEKRKLMKEEVKRLK
(restricted) Ga0233415_1034765923300027861SeawaterMEMSKQSWVDIVEMPVQRLYGYMKWKDKLEEEKQKLMEEEASKAG
(restricted) Ga0233415_1038129123300027861SeawaterMEMSKQSYVETVMMPIKKFSDYLKWKSDLENEKNKLMHEETT
Ga0209635_10000122373300027888Marine SedimentMSGMSYSEIAAMPLKRFFDYLKWKTDLEDEKRKLVREESKKLR
Ga0209536_10004664743300027917Marine SedimentMGKQNYLDVISMPVKRMHNYLKWKSELEEEKQKLIEEVAK
Ga0268279_105501133300028169Saline WaterLEEDIFSCMELSKQSYIEITLMPVNRFYNYLKWKSSLEIEKEKMIEEGIKK
Ga0272440_108824423300028595Marine SedimentMEMSKQSYPETMEMPVSRFYNYLKWKTDLEEEKRKMILEEVSGK
Ga0272441_1015195233300028920Marine SedimentMEMSKQSYKDIVSMPVQRFYSYLKWKSDLEEEKKKMMTEEILSGLK
Ga0272441_1109593823300028920Marine SedimentMEMSKQSYIDTMLMPVKRFQDYLKWKNDLEEEKQKLILEEVSKKR
Ga0134606_1000196983300029827Marine SedimentMEMSGQSYSEIAAMPIKKFYDYLKWKSDLEDEKRKLMREEVTKLKK
Ga0315556_100276933300031256Salt Marsh SedimentMEMSKQGYSEVTLMPVNKFYDYLKWKTKLEEEKQKMILEHTGK
Ga0307428_105840323300031280Salt MarshMEMSKQSYHETMLMPVKRFQDYMKWKSDLEDEKQRLILEEVGKRKNG
Ga0307434_121149813300031379Salt MarshMEMSKQSYHETMLMPVKRFQDYMKWKSDLEDEKQRLILEEVGKRNNG
Ga0307380_10000037383300031539SoilMEMSKQSYVDIVAMPVQRFYSYLKWKSDLEEEKKKIITEEIVSGLKS
Ga0307380_10008040103300031539SoilMEMSKQSYDQVIQMPVKRFYSYLKWKSDLEEEKKKLVVEEILGGMGG
Ga0307380_1000818153300031539SoilMEMSRQSYIEVTSMPVKRFFNYLKWKTDLEEERRKMMLEGISK
Ga0307380_1001026873300031539SoilMEMSKQAYTEVMAMPVKRFQDYMKWKTDLEEEKQKMLLEGVGKKR
Ga0307380_10013407123300031539SoilMEMSKQAYTDIMAMPVKRFQDYMKWKTDLEDDKQKMLLEGVNKKR
Ga0307380_1019626523300031539SoilMELSKQGYQDVVDMPIKRFYNYLKWKTDLEDDKKKMIDEQIMKRSGR
Ga0307380_1032492933300031539SoilMEMSKQSYPQIVAMPVKRFYNYLKWKTDLEDEKRKLILEEVGK
Ga0307376_10000826103300031578SoilMELSKQSYSDIMLMPVKRFQDYLKWKTDLEEEKQKMLLEGSK
Ga0307376_1003916523300031578SoilMELSKQGYQDVVDMPIKRFYNYLKWKTDLEDDKKKMIEEQIMKGTGRR
Ga0307376_1023350233300031578SoilMELSKQGYQDVVDMPIKRFYNYLKWKTDLEDDKKKMIEEQIMKGSGRR
Ga0307992_100298263300031601MarineMEMSKQSYSDVMLMPVKRFQNYMKWKNNLEDEKQKLILEEVKS
Ga0307992_123698723300031601MarineMEMSKQSYSDVMLMPVKRFENYMKWKNDIEDEKEKMILEGISS
Ga0315549_1000525183300031654Salt Marsh SedimentMCMEMSRQSYIETIMMPVKRFQDYLKWKSELEEERRKMIREESSK
Ga0315291_1010922333300031707SedimentMEMSKQSYFEVSLMPVQRFHEYMKWKTRLEEEKSKMLQEVTKK
Ga0315293_1012019523300031746SedimentMEMSKQSYHDICYMPVQRFHNYMKWKTKLEEEKAKMLQEVTKK
Ga0315284_1004651243300032053SedimentMEMSKQSYHDICCMPVQRFHNYMKWKTRLEEEKAKMLKEVTKK
Ga0315276_1038934433300032177SedimentMEMSKQSYFEVSLIPVQRFHEYMKWKTRLEEEKSKMLQEVTKK
Ga0316192_1072063113300032260Worm BurrowQLEKNIFSCMEMSKQSYIEIISMPVQRFYSYLKWKSDLEDEKKKMVTEEILSGLKGA
Ga0316188_1025220813300032276Worm BurrowMEMSKQGYQDVVDMPIKRFYNYLKWKTDLEEDKKKMIEEQIKGG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.