| Basic Information | |
|---|---|
| Family ID | F072689 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 67.80 % |
| % of genes near scaffold ends (potentially truncated) | 34.71 % |
| % of genes from short scaffolds (< 2000 bps) | 91.74 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (76.860 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (11.570 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.314 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.066 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF01471 | PG_binding_1 | 16.53 |
| PF12850 | Metallophos_2 | 0.83 |
| PF01435 | Peptidase_M48 | 0.83 |
| PF01078 | Mg_chelatase | 0.83 |
| PF01583 | APS_kinase | 0.83 |
| PF02518 | HATPase_c | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 76.86 % |
| All Organisms | root | All Organisms | 23.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.65% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.65% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.83% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.83% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_05110080 | 2170459005 | Grass Soil | MAEIGNPEKRRVLVPDEQPAPSPVVVPERKVPVKVPERQPA |
| F62_06884470 | 2170459010 | Grass Soil | MAEIGNPEKRRVLVPDEQPAPSPVVVPERKAPVKVPEEQPV |
| JGI1027J12803_1007036731 | 3300000955 | Soil | MAEIGEPERRRVLVPNETPITTPIVVPEPKLPAKVPEREPA* |
| JGI1027J12803_1017366101 | 3300000955 | Soil | MAEIGEPERRRVLVPDETPAPTPIIEPVKVPEREPV |
| JGI12630J15595_100175552 | 3300001545 | Forest Soil | MAEIGKPEKRRVLVPEEMPQPARVVPAPKSPVKVPEREPA* |
| C688J35102_1196726831 | 3300002568 | Soil | MAEIGEPEKRRVLVPNEAPAPDRVAPAPKTPVKVPEREPV* |
| C688J35102_1201609842 | 3300002568 | Soil | MAEIGEPEKRRVLVPDETPAPHRVVPEPKTPVKVPERQPV* |
| C688J35102_1206532551 | 3300002568 | Soil | DSLTRFMMESPMAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV* |
| Ga0062589_1015282432 | 3300004156 | Soil | MAEIGNPEKRRVLVPDETPAPDRVVPEPKTPAKVPEREPA* |
| Ga0062595_1017842412 | 3300004479 | Soil | MAEIGEPERRRVLVPDETPAHPIIEPVKIPEREPVKIPEREPA* |
| Ga0062594_1032853961 | 3300005093 | Soil | RFLMELAMAEIGEPEKRRVLVPNEAPAPDRVAPAPKTPVKVPECEPV* |
| Ga0066809_100191892 | 3300005168 | Soil | MMESPMAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV* |
| Ga0066388_1005659874 | 3300005332 | Tropical Forest Soil | MAEIGEPERRRVVVPDEQPATSPIVVPERKEPIRVPEKQPA* |
| Ga0066388_1010164942 | 3300005332 | Tropical Forest Soil | MAEIGEPEKRRVLVPDEMPVPDRVVPKPRSPAKVPEREPA* |
| Ga0066388_1013728763 | 3300005332 | Tropical Forest Soil | MAEIGKPERRRVLVPDETPVPDRVVPEPKTPVKVPEREPA* |
| Ga0066388_1041427962 | 3300005332 | Tropical Forest Soil | MAEIGNPERRRVLVPEEQPAPSPVVVPERKTPVKVPEEQPV* |
| Ga0070691_109040462 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIGEPERRRVLIPDETPAPTPIVEPVKVPEREPVKAPQREPV* |
| Ga0070668_1008511152 | 3300005347 | Switchgrass Rhizosphere | LTRFLMELAMAEIGEPEKRRVLVPNEAPAPDRVAPAPKTPVKVPEREPV* |
| Ga0070669_1012964351 | 3300005353 | Switchgrass Rhizosphere | MELAMAEIGEPEKRRVLVPNEAPAPDRVAPAPKTPVKVPEREPV* |
| Ga0070659_1002277492 | 3300005366 | Corn Rhizosphere | MAEIGEPEKRRVLVPDETPAPDRVVPEPKAPVKVPEREPV* |
| Ga0070659_1017703382 | 3300005366 | Corn Rhizosphere | MAEIGNPERRRVLVPEEQPAPSPVVVPERKTPVKVPEEQPA* |
| Ga0070709_102745522 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIGEPERRRVLIPDETPAPTPIFEPVKVPEREPVKIPQREPV* |
| Ga0070709_115209962 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV* |
| Ga0070710_102900163 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIGEPERRRVLIPDETPATTPIVEPVKVPQREPAKVQ* |
| Ga0070711_1002266892 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEIGEPERRRVLIPDETPAPTPIVEPVKVPEREPVKIPQREPV* |
| Ga0070705_1010609741 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIGEPERRRVLIPDETPAPTPIVEPVKVPEREPVKVPQREPV* |
| Ga0070662_1013231142 | 3300005457 | Corn Rhizosphere | MAEIGNPERRRVLVPEEQPAPSPVVVPERKAPVKVPEEQPA* |
| Ga0070693_1009706081 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIGEPERRRVLIPDETPAPTPIFEPVKVPEREPVKAPQREPV* |
| Ga0068864_1019363042 | 3300005618 | Switchgrass Rhizosphere | SMAEIGEPERRRVLVPDETPAPPIIEPVKIPEREPVKIPEREPA* |
| Ga0066905_1016079972 | 3300005713 | Tropical Forest Soil | MAEIGEPERRRVLVPDETPAPTPAIPERKLPVKVPEREPA* |
| Ga0066903_1003371235 | 3300005764 | Tropical Forest Soil | MAEIGKPEKRRVLVPDETPAPDRVVPEPKTPAKVPEREPA* |
| Ga0066903_1003459443 | 3300005764 | Tropical Forest Soil | MAEIGNPERRRVLVPDEQPAPSPVVVPERKAPVKVPENEPA* |
| Ga0066903_1018599231 | 3300005764 | Tropical Forest Soil | MAGIGNPEKRRVLVPDEQPAPSPVVVPERKAPVKVPEEQPA* |
| Ga0066903_1032203232 | 3300005764 | Tropical Forest Soil | MAEIGNPERRRVLVPEEQPAPAPVVVPERKTPVKVPEEQPA* |
| Ga0066903_1038076233 | 3300005764 | Tropical Forest Soil | AEIGEPERRRVLVPEETPIPDRSVPERKTPVKVPEREPA* |
| Ga0066903_1041811232 | 3300005764 | Tropical Forest Soil | MAEIGEPERRRVLVPDETPAPPRVVPEPTTPVKVPEK |
| Ga0066903_1042136242 | 3300005764 | Tropical Forest Soil | MAEIGKPEKRRVLVPDETPAPQLVPEPKSPAKVPEREPA* |
| Ga0066903_1053819842 | 3300005764 | Tropical Forest Soil | MAEIGKPERRRVVVPDELPAPSRVVPDRKSPVKVPEKEPA* |
| Ga0066903_1082133842 | 3300005764 | Tropical Forest Soil | MAEIGEPERRRVLVPEETPVPDRSVPQPKIPVKVPEREPA* |
| Ga0075365_100374044 | 3300006038 | Populus Endosphere | MAEIGEPERRRVLVPVETPVPDRYVPEPEPKTPVKVPEREPA* |
| Ga0075365_105156261 | 3300006038 | Populus Endosphere | SLTRFMMESPMAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV* |
| Ga0075017_1011209892 | 3300006059 | Watersheds | MAEIGNPEKRRVLVPDEQPAPSPVVIPERKAPVKVPEEQPA* |
| Ga0070716_1001042623 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIGEPQRRRVLIPDETPAPTPIVEPVKVPEREPVKVPQREPV* |
| Ga0075014_1007211732 | 3300006174 | Watersheds | MAEIGNPEKRRVLVPDEQPAPSPVVVPERKAPVKVPERQPA* |
| Ga0070712_1007883412 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV* |
| Ga0075021_102845093 | 3300006354 | Watersheds | MAEIGEPERRRVLVPAETPTPAEDPETTPAEEPVKIPVTTP* |
| Ga0075433_112206552 | 3300006852 | Populus Rhizosphere | RFMMESPMAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV* |
| Ga0068865_1005794521 | 3300006881 | Miscanthus Rhizosphere | MESPMAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV* |
| Ga0073928_102259633 | 3300006893 | Iron-Sulfur Acid Spring | MAEIGEPERRRVLVPDETPAPAPIIEPFKVPDREPVKVPEREPV* |
| Ga0099827_114872101 | 3300009090 | Vadose Zone Soil | MAEIGNPEKRRVLVPDEQPAPSPVVIPERKVPVKVPEEQPA* |
| Ga0105247_115573021 | 3300009101 | Switchgrass Rhizosphere | MAEIGNPERRRVLVPEEQPAPSPVVVPERKTPVKVP |
| Ga0105243_117703831 | 3300009148 | Miscanthus Rhizosphere | MAEIGEPERRRVLIPDETPAPTPIFEPVKVPEREPV |
| Ga0075423_123155111 | 3300009162 | Populus Rhizosphere | MESPMAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPEREPV* |
| Ga0105241_120044801 | 3300009174 | Corn Rhizosphere | MAEIGEPERRRVLIPDETPAPTPIVEPVKVPEREPVK |
| Ga0105242_107808811 | 3300009176 | Miscanthus Rhizosphere | EIGEPERRRVLVPDETPAPTPIVEPVKVPEREPVKVPEREPA* |
| Ga0105248_112733253 | 3300009177 | Switchgrass Rhizosphere | ERRRVLVPDETPAPPIIEPVKIPEREPVKIPEREPA* |
| Ga0126374_101447093 | 3300009792 | Tropical Forest Soil | MAEIGKPERRRVLVPTEEPATPIAPPTPVKEPAREEPEKVE* |
| Ga0126384_111015972 | 3300010046 | Tropical Forest Soil | MAEIGKPERRRVVVPDEQPATSPIVVPERKEPIRVPEKQPA* |
| Ga0126373_117609782 | 3300010048 | Tropical Forest Soil | SMAEIGKPEKRRVLVPDETPAPDRVVPEPKTPAKVPEREPA* |
| Ga0127503_106811871 | 3300010154 | Soil | GSMAEIGKPERRRVVVPEETPAPERVVPAPQRPVKVPEHEPA* |
| Ga0126378_102555892 | 3300010361 | Tropical Forest Soil | MAEIGNPERRRVLVPDEQPAPSPVVVPERKTPVKVPEEQPA* |
| Ga0134125_102450701 | 3300010371 | Terrestrial Soil | MAEIGEPERRRVLIPDETPAPTPIVEPVKVPEREPVKIPQREPV* |
| Ga0134124_106916003 | 3300010397 | Terrestrial Soil | EPKKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV* |
| Ga0126383_116420392 | 3300010398 | Tropical Forest Soil | MAEIGKPEKRRVLVPDETPAPDRVVPEPKTPAKVPEREPG* |
| Ga0134123_119677481 | 3300010403 | Terrestrial Soil | LTRFMMESPMAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV* |
| Ga0126358_12018701 | 3300010856 | Boreal Forest Soil | MAEIGEPERRRVLVPDETPAPTPIIEPFKVPEREPVKVPEREPV* |
| Ga0150983_112972291 | 3300011120 | Forest Soil | RPMAEIGDPEKRRVLVPDEQPAPSPVVPERKAPVKVPEEQPA* |
| Ga0137393_112626112 | 3300011271 | Vadose Zone Soil | MAEIGNPEKRRVLVPDEQPAPSPVVVPERKTPVKVPEDQPV* |
| Ga0153974_11615151 | 3300012180 | Attine Ant Fungus Gardens | MAEIGNPERRRVLVPDEQPAPSPVVVPERKTPVKVPEE |
| Ga0150985_1042223722 | 3300012212 | Avena Fatua Rhizosphere | MMESPMAEIGEPEKRRVLVPDETPAPHRVVPEPKTPVKVPERQPV* |
| Ga0150985_1086738441 | 3300012212 | Avena Fatua Rhizosphere | TRFVVELLMAEIGEPEKRRVLVPDETPVPDRVVPEPKTPVKIPEREPV* |
| Ga0150985_1145194193 | 3300012212 | Avena Fatua Rhizosphere | RRRDNSMAEIGEPERRRVLVPDETPAFTPIIEPAKVPDREPVKVPEREPV* |
| Ga0150984_1033536393 | 3300012469 | Avena Fatua Rhizosphere | LTRFVVELLMAEIGEPEKRRVLVPDETPVPDRVVPEPKTPVKIPEREPV* |
| Ga0164302_113227382 | 3300012961 | Soil | MAEIGVPERRRVLVPDETPAPTPTVPERKLPVKVPEREPA* |
| Ga0164302_117575151 | 3300012961 | Soil | MAEIGNPERRRVLVPDEQPAPSPVVVPERKAPVKVPEEQPA* |
| Ga0164308_119317801 | 3300012985 | Soil | EPEKRRVLVPNEAPAPDRVAPAPKTPVKVPEREPV* |
| Ga0164306_107133883 | 3300012988 | Soil | INTEDNTMAEIGVPERRRVLVPDETPAPTPTVPERKLPVKVPEREPA* |
| Ga0164306_109786663 | 3300012988 | Soil | MAEIGNPERRRVLVPDEQPAPSPVVVPERKAPVKVPEEQPV* |
| Ga0157378_132849941 | 3300013297 | Miscanthus Rhizosphere | MAEIGEPERRRVLVPDETPAPTPIIEPVKVPEREPVKVPQREPV* |
| Ga0163162_130121571 | 3300013306 | Switchgrass Rhizosphere | MAEIGVPERRRVLVPDETPAPTPTVPERKLPAKVPEREPA* |
| Ga0120132_10453982 | 3300013832 | Permafrost | MAEIGEPERRRVLVPDETPAPIIEPVKVPDREPVKVPEREPV* |
| Ga0132258_106412515 | 3300015371 | Arabidopsis Rhizosphere | MAEIGEPERRRVLVPDETPAPPIIEPVKIPEREPVKIPEREPA* |
| Ga0182033_114178052 | 3300016319 | Soil | AEIGNPEKRRVLVPDEQPAPSPLVVPERKAPIKVPERQPA |
| Ga0182034_109357043 | 3300016371 | Soil | MAEIGEPQRRRVVVPNETPVDPIRVPEPKRDPVKVPE |
| Ga0163161_100199436 | 3300017792 | Switchgrass Rhizosphere | MAEIGEPERRRVLVPAPTPIVEPVKVPEREPAKVQ |
| Ga0163161_107867061 | 3300017792 | Switchgrass Rhizosphere | IGEPERRRVLVPDETPAPPIIEPVKIPEREPVKIPEREPA |
| Ga0187780_101586292 | 3300017973 | Tropical Peatland | MAEIGNPEKRRVLVPDEQPAPAPVVVPERKTPVKIPEDQPA |
| Ga0184611_11190132 | 3300018067 | Groundwater Sediment | MAEIGEPEKRRVLVPNEAPAPDRVAPAPKTPVKVPEREPV |
| Ga0190271_121220801 | 3300018481 | Soil | IGEPERRRVLVPNEAPAPDRVAPAPKTPVKVPEREPV |
| Ga0173479_103661881 | 3300019362 | Soil | MAEIGEPKKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV |
| Ga0210401_109997902 | 3300020583 | Soil | MAEIGNPERRRVLVPDEQPAPSPVVVPERKAPVKVPEEQPA |
| Ga0210405_112333412 | 3300021171 | Soil | MAEIGDPEKRRVLVPDEQPAPSPVVPERKAPVKVPEEQPA |
| Ga0210402_114396872 | 3300021478 | Soil | MAEIGEPERRRVLVPDETPAPTPTEPVKIPGRTPVKVPERQPV |
| Ga0126371_132868881 | 3300021560 | Tropical Forest Soil | NPERRRVLVPDEQPAPSPVVVPERKTPVKIPEEQPA |
| Ga0242656_10772791 | 3300022525 | Soil | PMAEIGNPERRRVLVPDEQPAPSPVVVPERKAPVKVPEEQPA |
| Ga0207656_101421321 | 3300025321 | Corn Rhizosphere | ESPMAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV |
| Ga0207692_102241122 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MMESPMAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV |
| Ga0207704_100064628 | 3300025938 | Miscanthus Rhizosphere | MESPMAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPERQPV |
| Ga0207665_101303283 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIGEPQRRRVLIPDETPAPTPIVEPVKVPEREPVEVPQREPV |
| Ga0207678_118184051 | 3300026067 | Corn Rhizosphere | EIGEPERRRVLIPDETPAPTPIVEPVKVPEREPVKVPQREPV |
| Ga0207648_101406283 | 3300026089 | Miscanthus Rhizosphere | MAEIGEPQRRRVLVPDETPAPTPIVEPVKVPEREPVEVPQREPV |
| Ga0207683_102578522 | 3300026121 | Miscanthus Rhizosphere | MAEIGEPERRRVLVPDETPAPTPIIEPVKVPEREPVKIPQREPV |
| Ga0209527_10185562 | 3300027583 | Forest Soil | MAEIGKPEKRRVLVPEEMPQPARVVPAPKSPVKVPEREPA |
| Ga0307322_100343763 | 3300028710 | Soil | MAEIGAPERRRVLVPNETPAPTPVVPEPKLPVKVPEREPA |
| Ga0307286_103491812 | 3300028876 | Soil | NTEDNSMAEIGAPERRRVLVPNETPAPTPVVPEPKLPVKVPEREPA |
| Ga0311334_101812812 | 3300029987 | Fen | MTKYDRETSMAEIGEPERRRVLVPNEEPAHTPMVVPVPEREPVKIPAREPT |
| Ga0308201_101494061 | 3300031091 | Soil | EIGAPERRRVLVPNETPAPTPVVPEPKLPVKVPEREPA |
| Ga0308201_102986212 | 3300031091 | Soil | MAEIGEPEKRRVLVPNEAPGPDRVAPAPKTPVKVPEREPV |
| Ga0306917_101578264 | 3300031719 | Soil | MAEIGEPQRRRVVVPNETPVDPVRVPEPKRDPVKVPEKEPAREPA |
| Ga0318547_107131451 | 3300031781 | Soil | MAEIGKPEKRRVLVPDETPAPAPQVVPEPKSPAKV |
| Ga0310892_106176241 | 3300031858 | Soil | MAEIGEPEKRRVLVPDETPAPDRVVPEPKTPVKVPEREPL |
| Ga0306925_115129572 | 3300031890 | Soil | STSNIQKEWPMAEIGNPEKRRILVPEERPAPSPVIVPERKPPVKVPEDQPV |
| Ga0310912_111717681 | 3300031941 | Soil | MAEIGKPEKRRVLVPDETPAPAPQRVPEPKSPAKVPE |
| Ga0310909_114754581 | 3300031947 | Soil | MAEIGKPEKRRVLVPDETPAPAPQVVPEPKSPVKV |
| Ga0306926_108214642 | 3300031954 | Soil | MAEIGNPEKRRILVPEERPAPSPVIVPERKPPVKVPEDQPV |
| Ga0306924_110988432 | 3300032076 | Soil | MAEIGNPEKRRVLVPDEQPAPSPVVVPERKAPVKVPEEQPA |
| Ga0311301_113671722 | 3300032160 | Peatlands Soil | MAEIGNPEKRRVLVPDEQPAPSPVVVPERKAPVKVPERQPA |
| Ga0307471_1006308532 | 3300032180 | Hardwood Forest Soil | MAEIGEPERRRVLVPDETPAPTPIVEPVEVPEREPVKIPQREPA |
| Ga0306920_1013567512 | 3300032261 | Soil | MAEIGEPQRRRVVVPNETPVDPIRVPEPKRDPVKVPEKEPAREPA |
| Ga0306920_1013869142 | 3300032261 | Soil | MAEIGNPEKRRVLVPDEQPAPSPVVVPERKAPVKVPEKQPA |
| Ga0370541_053751_408_533 | 3300034680 | Soil | SMAEIGAPERRRVLVPNETPAPTPVVPEPKLPVKVPEREPA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |