NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072661

Metagenome / Metatranscriptome Family F072661

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072661
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 39 residues
Representative Sequence MLRLLATLAFAASFDILLFDGKYISAVDKLAVAIIQHF
Number of Associated Samples 92
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 53.72 %
% of genes near scaffold ends (potentially truncated) 31.40 %
% of genes from short scaffolds (< 2000 bps) 83.47 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (52.066 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(9.917 % of family members)
Environment Ontology (ENVO) Unclassified
(27.273 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.934 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.48%    β-sheet: 0.00%    Coil/Unstructured: 51.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF13561adh_short_C2 17.36
PF03734YkuD 17.36
PF00839Cys_rich_FGFR 5.79
PF04311DUF459 4.13
PF00106adh_short 3.31
PF09594GT87 2.48
PF00188CAP 1.65
PF00497SBP_bac_3 1.65
PF02617ClpS 1.65
PF03775MinC_C 0.83
PF04773FecR 0.83
PF06186DUF992 0.83
PF00657Lipase_GDSL 0.83
PF04055Radical_SAM 0.83
PF13398Peptidase_M50B 0.83
PF03992ABM 0.83
PF01464SLT 0.83
PF00144Beta-lactamase 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 17.36
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 17.36
COG2845Peptidoglycan O-acetyltransferase, SGNH hydrolase familyCell wall/membrane/envelope biogenesis [M] 4.13
COG2127ATP-dependent Clp protease adapter protein ClpSPosttranslational modification, protein turnover, chaperones [O] 1.65
COG2340Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domainCell cycle control, cell division, chromosome partitioning [D] 1.65
COG0850Septum site-determining protein MinCCell cycle control, cell division, chromosome partitioning [D] 0.83
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.83
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.83
COG2367Beta-lactamase class ADefense mechanisms [V] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A52.07 %
All OrganismsrootAll Organisms47.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c0621633Not Available572Open in IMG/M
3300000041|ARcpr5oldR_c018638All Organisms → cellular organisms → Bacteria → Proteobacteria613Open in IMG/M
3300000156|NODE_c0635000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2014Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10003361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae4344Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10060043All Organisms → cellular organisms → Bacteria → Proteobacteria975Open in IMG/M
3300004268|Ga0066398_10221911All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae507Open in IMG/M
3300004633|Ga0066395_10899803Not Available536Open in IMG/M
3300005093|Ga0062594_100244388All Organisms → cellular organisms → Bacteria → Proteobacteria1305Open in IMG/M
3300005147|Ga0066821_1017667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas578Open in IMG/M
3300005161|Ga0066807_1012911Not Available791Open in IMG/M
3300005332|Ga0066388_104885579Not Available682Open in IMG/M
3300005337|Ga0070682_100167810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1523Open in IMG/M
3300005339|Ga0070660_100719424Not Available837Open in IMG/M
3300005339|Ga0070660_100975968Not Available716Open in IMG/M
3300005444|Ga0070694_101927910Not Available505Open in IMG/M
3300005548|Ga0070665_100812663Not Available948Open in IMG/M
3300005618|Ga0068864_100099416All Organisms → cellular organisms → Bacteria2577Open in IMG/M
3300005713|Ga0066905_100002135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae7230Open in IMG/M
3300005713|Ga0066905_100297120All Organisms → cellular organisms → Bacteria → Proteobacteria1266Open in IMG/M
3300005713|Ga0066905_100685014All Organisms → cellular organisms → Bacteria → Proteobacteria878Open in IMG/M
3300005713|Ga0066905_101878483Not Available554Open in IMG/M
3300005719|Ga0068861_102662963Not Available504Open in IMG/M
3300005764|Ga0066903_100358097Not Available2365Open in IMG/M
3300005764|Ga0066903_103856917Not Available805Open in IMG/M
3300005764|Ga0066903_104070106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Starkeya → unclassified Starkeya → Starkeya sp. ORNL1783Open in IMG/M
3300005764|Ga0066903_106459936All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300005841|Ga0068863_101437529Not Available698Open in IMG/M
3300006041|Ga0075023_100291247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria669Open in IMG/M
3300006041|Ga0075023_100583641Not Available517Open in IMG/M
3300006057|Ga0075026_100474459Not Available716Open in IMG/M
3300006057|Ga0075026_100541577Not Available676Open in IMG/M
3300006057|Ga0075026_100781632All Organisms → cellular organisms → Bacteria → Proteobacteria577Open in IMG/M
3300006173|Ga0070716_100955059Not Available675Open in IMG/M
3300006175|Ga0070712_100557948Not Available966Open in IMG/M
3300006175|Ga0070712_101898520Not Available521Open in IMG/M
3300006178|Ga0075367_10884772Not Available569Open in IMG/M
3300006237|Ga0097621_100856523Not Available844Open in IMG/M
3300006581|Ga0074048_12347100Not Available508Open in IMG/M
3300006806|Ga0079220_12095781Not Available506Open in IMG/M
3300006844|Ga0075428_100663530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1112Open in IMG/M
3300007076|Ga0075435_100712562Not Available872Open in IMG/M
3300009093|Ga0105240_10342745Not Available1697Open in IMG/M
3300009148|Ga0105243_10533613Not Available1118Open in IMG/M
3300010043|Ga0126380_10222659Not Available1282Open in IMG/M
3300010043|Ga0126380_10529518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales911Open in IMG/M
3300010043|Ga0126380_10951672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales718Open in IMG/M
3300010043|Ga0126380_11456856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas604Open in IMG/M
3300010046|Ga0126384_10064209All Organisms → cellular organisms → Bacteria2585Open in IMG/M
3300010046|Ga0126384_11672910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas601Open in IMG/M
3300010047|Ga0126382_10467375All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300010359|Ga0126376_10458518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1167Open in IMG/M
3300010359|Ga0126376_12832976Not Available535Open in IMG/M
3300010360|Ga0126372_10262612All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1490Open in IMG/M
3300010366|Ga0126379_11411763Not Available802Open in IMG/M
3300010375|Ga0105239_10582324Not Available1276Open in IMG/M
3300010396|Ga0134126_10175838Not Available2577Open in IMG/M
3300010397|Ga0134124_11440114Not Available716Open in IMG/M
3300010401|Ga0134121_10034916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14624087Open in IMG/M
3300010401|Ga0134121_10231833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1608Open in IMG/M
3300011120|Ga0150983_10718067Not Available763Open in IMG/M
3300011444|Ga0137463_1186769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales778Open in IMG/M
3300012480|Ga0157346_1008334All Organisms → cellular organisms → Bacteria → Proteobacteria712Open in IMG/M
3300012483|Ga0157337_1024671Not Available579Open in IMG/M
3300012488|Ga0157343_1002144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1050Open in IMG/M
3300012951|Ga0164300_10255027Not Available893Open in IMG/M
3300012957|Ga0164303_10085192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1520Open in IMG/M
3300012958|Ga0164299_10546346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas781Open in IMG/M
3300012984|Ga0164309_10217584Not Available1325Open in IMG/M
3300012985|Ga0164308_10382389Not Available1146Open in IMG/M
3300012987|Ga0164307_11291796Not Available609Open in IMG/M
3300012988|Ga0164306_11439814Not Available588Open in IMG/M
3300013105|Ga0157369_10314840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1627Open in IMG/M
3300014324|Ga0075352_1272226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales529Open in IMG/M
3300015371|Ga0132258_11459965All Organisms → cellular organisms → Bacteria → Proteobacteria1727Open in IMG/M
3300015371|Ga0132258_12197341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas1385Open in IMG/M
3300015371|Ga0132258_13484167Not Available1078Open in IMG/M
3300015374|Ga0132255_100347327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2148Open in IMG/M
3300017792|Ga0163161_11798333Not Available545Open in IMG/M
3300017944|Ga0187786_10031623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1488Open in IMG/M
3300017944|Ga0187786_10044957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1305Open in IMG/M
3300017944|Ga0187786_10311704Not Available650Open in IMG/M
3300017947|Ga0187785_10000756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium11559Open in IMG/M
3300017947|Ga0187785_10006273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae3946Open in IMG/M
3300017947|Ga0187785_10015938All Organisms → cellular organisms → Bacteria2615Open in IMG/M
3300017947|Ga0187785_10035254All Organisms → cellular organisms → Bacteria → Proteobacteria1828Open in IMG/M
3300017974|Ga0187777_10157778All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1516Open in IMG/M
3300018028|Ga0184608_10470584Not Available539Open in IMG/M
3300018054|Ga0184621_10141698Not Available864Open in IMG/M
3300018064|Ga0187773_10164763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1154Open in IMG/M
3300018072|Ga0184635_10033507Not Available1941Open in IMG/M
3300021478|Ga0210402_10769280Not Available888Open in IMG/M
3300021560|Ga0126371_13281030All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae547Open in IMG/M
3300022507|Ga0222729_1027514Not Available706Open in IMG/M
3300022533|Ga0242662_10082903Not Available888Open in IMG/M
3300022533|Ga0242662_10131337Not Available742Open in IMG/M
3300022694|Ga0222623_10017026Not Available2691Open in IMG/M
3300022756|Ga0222622_10010223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14624422Open in IMG/M
3300025893|Ga0207682_10452637Not Available608Open in IMG/M
3300025915|Ga0207693_10009737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae7825Open in IMG/M
3300025915|Ga0207693_10470083Not Available982Open in IMG/M
3300025942|Ga0207689_10043380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3718Open in IMG/M
3300025981|Ga0207640_10573134Not Available952Open in IMG/M
3300027523|Ga0208890_1085951Not Available521Open in IMG/M
3300027894|Ga0209068_10866309Not Available534Open in IMG/M
3300027910|Ga0209583_10740170Not Available517Open in IMG/M
3300030945|Ga0075373_10183966Not Available506Open in IMG/M
3300031231|Ga0170824_119731895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales8731Open in IMG/M
3300031455|Ga0307505_10565755Not Available551Open in IMG/M
3300031538|Ga0310888_10042290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2089Open in IMG/M
3300031720|Ga0307469_11111594Not Available743Open in IMG/M
3300031744|Ga0306918_11023199Not Available641Open in IMG/M
3300032017|Ga0310899_10042099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1627Open in IMG/M
3300032075|Ga0310890_11189313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas620Open in IMG/M
3300032174|Ga0307470_10378673Not Available992Open in IMG/M
3300032180|Ga0307471_101694091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas786Open in IMG/M
3300033004|Ga0335084_11182975Not Available765Open in IMG/M
3300033412|Ga0310810_10233952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2039Open in IMG/M
3300033433|Ga0326726_10016899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6350Open in IMG/M
3300033433|Ga0326726_11944557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria573Open in IMG/M
3300034090|Ga0326723_0230089Not Available824Open in IMG/M
3300034090|Ga0326723_0282272All Organisms → cellular organisms → Bacteria743Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil9.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.44%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland7.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.13%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.31%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.31%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.31%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.48%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.48%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.48%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.83%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.83%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000041Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphereHost-AssociatedOpen in IMG/M
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005161Soil and rhizosphere microbial communities from Laval, Canada - mgLPAEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012480Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610Host-AssociatedOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_062163313300000033SoilMLRLLATLAFAASFEIILFDGRYLHAADKVAVAIIRSF*
ARcpr5oldR_01863823300000041Arabidopsis RhizosphereMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQXF*
NODE_063500023300000156Sugar Cane Bagasse Incubating BioreactorVRAYALRMLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF*
AF_2010_repII_A1DRAFT_1000336153300000597Forest SoilMLLRILAMLAFAWSLDGKYISAVDKVAVAIFQSF*
AF_2010_repII_A1DRAFT_1006004333300000597Forest SoilMLRLLATLAFVASFDILLFGGSHITAADRLAVQIFQHF*
Ga0066398_1022191113300004268Tropical Forest SoilMLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF*ARAPQSQSIG
Ga0066395_1089980313300004633Tropical Forest SoilNRMLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF*
Ga0062594_10024438823300005093SoilMLLRILATLAFAASFDTLILDGKYISAVDKVAVTIFQSF*
Ga0066821_101766713300005147SoilMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0066807_101291123300005161SoilMLLRILATLAFAASFDILIMDGKYISAVDKVAVAIIQSF*
Ga0066388_10488557913300005332Tropical Forest SoilRMLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF*
Ga0070682_10016781033300005337Corn RhizosphereTYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0070660_10071942413300005339Corn RhizosphereHMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0070660_10097596813300005339Corn RhizosphereSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0070694_10192791013300005444Corn, Switchgrass And Miscanthus RhizosphereFETYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0070665_10081266343300005548Switchgrass RhizosphereMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0068864_10009941653300005618Switchgrass RhizosphereMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQS
Ga0066905_10000213523300005713Tropical Forest SoilMLRLLATLAFAASFDIILFDGRYLNAADKVAVAIIRSF*
Ga0066905_10029712023300005713Tropical Forest SoilMLLRILATLAFAASFDILILDGKYISAVDKVAAIFQSF*
Ga0066905_10068501423300005713Tropical Forest SoilMLCLLATLAFAASFDIILFDGRYITAVDKVAVAIFRSF*
Ga0066905_10187848313300005713Tropical Forest SoilMLRLLATLAFAASFDIVLFDGKYISAVDRVAVAIFRGF*
Ga0068861_10266296313300005719Switchgrass RhizosphereMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0066903_10035809733300005764Tropical Forest SoilLANLAFAASFDILLFDGKCISTVDKIAVQIIGHF*
Ga0066903_10385691713300005764Tropical Forest SoilMLLRILATLAFAASFDILGLDGKYISAVDKVAVAIFQSF*
Ga0066903_10407010633300005764Tropical Forest SoilMLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF*
Ga0066903_10645993623300005764Tropical Forest SoilMLRLLATLAFAASFDIVLFDGKYISAVDRVAVAIFRSF*
Ga0068863_10143752913300005841Switchgrass RhizosphereLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0075023_10029124723300006041WatershedsMLRLLTTMAIAASFDILLFDGKYTDAAHQLAVIAIQHF*
Ga0075023_10058364123300006041WatershedsMLLRILATLAFAASFDILIMDGKYIGAVDKLAVAIFQSF*
Ga0075026_10047445923300006057WatershedsMLRLLATLAFAASFDILLFDGKYIGAVSKIAVAIIQHF*
Ga0075026_10054157723300006057WatershedsMLLRILATLAFAASFDILIMDGKYIGAVDKVAVAIIQSF*
Ga0075026_10078163223300006057WatershedsMLLRILATLAFAASFDILILDGKYISAGDKVAVAIFQSF*
Ga0070716_10095505923300006173Corn, Switchgrass And Miscanthus RhizosphereMLRLLATLAFAASFDILLNDGKYISAVNKLAVAVIHHF*
Ga0070712_10055794813300006175Corn, Switchgrass And Miscanthus RhizosphereRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0070712_10189852023300006175Corn, Switchgrass And Miscanthus RhizosphereRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0075367_1088477223300006178Populus EndosphereAAHMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0097621_10085652313300006237Miscanthus RhizosphereIFETYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0074048_1234710013300006581SoilMLRLLATLAFAASFDILIMDGKYISAVDKVAVAIIQSF*
Ga0079220_1209578123300006806Agricultural SoilMLRLLATLAFAASFDILLFDGKYITAVDRIAAQIIQ
Ga0075428_10066353013300006844Populus RhizosphereYTARMLRLLATLAFAASFEIILFDGRYLHAADKVAVAIIRSF*
Ga0075435_10071256213300007076Populus RhizosphereYASHMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0105240_1034274533300009093Corn RhizosphereMLRLLATLAFAASFDILLFDGKYISAVANIAVAIVQHF*
Ga0105243_1053361313300009148Miscanthus RhizosphereMLLRILATLAFAASFDTLILDGKYISAVHKLAVAIIQHF*
Ga0126380_1022265923300010043Tropical Forest SoilMQRFLATLAFAAAFDILILDGKYVSAVNHVALTFFRGF*
Ga0126380_1052951823300010043Tropical Forest SoilMLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF*
Ga0126380_1095167223300010043Tropical Forest SoilMLLRILATLAFAASFDILIMDGKYISAVDKVAVAIFQSF*
Ga0126380_1145685623300010043Tropical Forest SoilMLRLLATLAFAASFDIILFDGRYITAVDKVAVAIYRSF*
Ga0126384_1006420913300010046Tropical Forest SoilMQRFLATLAFAAAFDILFLDGKYLSAVNQVALVYFRGF*
Ga0126384_1167291023300010046Tropical Forest SoilMLLRILAMLTFAWSLDGKYISAVDKVAVAIFQSF*
Ga0126382_1046737523300010047Tropical Forest SoilMLRLLATLAFAVGFDILLSDGKFTDAAHRVAVAAIQNL*
Ga0126376_1045851823300010359Tropical Forest SoilMLLRILATLAIAASFDILILDGKYISAVDKVALAIFQSF*
Ga0126376_1283297613300010359Tropical Forest SoilMLRLLATLAFAAGFDILLSDGKFTDAAYRVAVAAIQNL*
Ga0126372_1026261233300010360Tropical Forest SoilMLRLLATLAFAASFDILLCDGKYITAVDRIAVQIIQHF*
Ga0126379_1141176323300010366Tropical Forest SoilMLRLLATPAFAASFDILLFDGKCTSTVDKIAVQIIGHF*
Ga0105239_1058232433300010375Corn RhizosphereDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0134126_1017583833300010396Terrestrial SoilMLRLLATLAVAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0134124_1144011433300010397Terrestrial SoilFETYDSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0134121_1003491613300010401Terrestrial SoilMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIF
Ga0134121_1023183313300010401Terrestrial SoilTYDSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0150983_1071806733300011120Forest SoilMPRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF*
Ga0137463_118676923300011444SoilMLRLLATLAFAVSFDILLFDGKYVNAVEHIALAVVQKF*
Ga0157346_100833423300012480Arabidopsis RhizosphereMLLRILATLAFAASFDSLIMDGKYLSAVDKVAVAIFQSF*
Ga0157337_102467123300012483Arabidopsis RhizosphereLATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0157343_100214423300012488Arabidopsis RhizosphereMLLCILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0164300_1025502733300012951SoilIIAVQESTSLIFETYDSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0164303_1008519253300012957SoilMLRLLATLGFAVSFDILLFDGKYVNAVEHIALAVVQKF*
Ga0164299_1054634613300012958SoilMLRLLATLAFAASFDILLFDGKYITAVDKIAVALIQHF*
Ga0164309_1021758443300012984SoilETYDSRMLRLLATLAFAASFDILLFDGRYISAVANIAVAIVQHF*
Ga0164308_1038238933300012985SoilMLRLLATLAFAASFDILLFDGKYISAVHILAVAIIQHF*
Ga0164307_1129179623300012987SoilMLRLLATLAFAASFDILLNDGKYISAVNKLAVAIIQHF*
Ga0164306_1143981413300012988SoilIFETYDSRMLRLLATLAFAASFDILLFDGKYISAVANIAVAIVQHF*
Ga0157369_1031484043300013105Corn RhizosphereMLRLLATLAFAASFDILLFDCKYISAVHKLAVAIIQHF*
Ga0075352_127222633300014324Natural And Restored WetlandsLLATLAFAASFDIILFDGKYISAVDKVAVAIIRNF*
Ga0132258_1145996513300015371Arabidopsis RhizosphereMLRLLATLAFVASFDILLFDGKYITVVNKIAVQIIQHF*
Ga0132258_1219734133300015371Arabidopsis RhizosphereMLRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF*
Ga0132258_1348416723300015371Arabidopsis RhizosphereMLLRILATLAFAASFDTLILDGKYISAVDKVAVAIFQSF*
Ga0132255_10034732713300015374Arabidopsis RhizosphereAVQESTSLIFETYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0163161_1179833323300017792Switchgrass RhizosphereMLLRILATLAFAASFDTLILDGKYISAVDKVAVTIFQSF
Ga0187786_1003162343300017944Tropical PeatlandMMRLLLATLAFAVSFDVLLFDGKYTDAVHRIAVIAIQHF
Ga0187786_1004495713300017944Tropical PeatlandMQRFLATLAFAAAFDILFLDGKYISAVDHVALAFFRGF
Ga0187786_1031170423300017944Tropical PeatlandVGAYAPRMLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF
Ga0187785_10000756123300017947Tropical PeatlandMLRLLLATLVFAVSFDVLLFDGKYTDAVHQIAVVAVQHF
Ga0187785_1000627353300017947Tropical PeatlandMLLRILATLAFAASFDILIMDGKYISAVDKVAVAIFQSF
Ga0187785_1001593823300017947Tropical PeatlandMQRFLATLAFAAAFDILFLDGKYISAVDRAALAFFRGF
Ga0187785_1003525433300017947Tropical PeatlandMLRLLSTTLAFVVSFDVLLFDGEYTDAVHQIAVVAIQHF
Ga0187777_1015777823300017974Tropical PeatlandMLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF
Ga0184608_1047058423300018028Groundwater SedimentMLRFLAFAASFDILLLEGKYISAVDKVAVAIVRSF
Ga0184621_1014169823300018054Groundwater SedimentMLRLLATLAFAASFDIILFDGKYISAVDKVAVAIVR
Ga0187773_1016476343300018064Tropical PeatlandMPRLSATPTFAASFDILLFDGKYISAVDKVAVAVIRSF
Ga0184635_1003350713300018072Groundwater SedimentMLRILATLAFAASFDIILFDGKYISAVDKVAVAIVRSF
Ga0210402_1076928023300021478SoilMLRLLATLAFAASFDILLCDGKYISAVNKLAVAIIQHF
Ga0126371_1328103013300021560Tropical Forest SoilMLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHFCARSPQS
Ga0222729_102751413300022507SoilMPRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF
Ga0242662_1008290333300022533SoilMLRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF
Ga0242662_1013133733300022533SoilMLRLLATLAFAASFDILLFDGKYICAGDKIAVALIQHF
Ga0222623_1001702623300022694Groundwater SedimentMLRLLATLAFAASFDIILFDGKYISAVDKVAVAIVRSF
Ga0222622_10010223103300022756Groundwater SedimentMLRFLVTLAFAASFDILLLEGKYISAVDKVAVAIVRSF
Ga0207682_1045263723300025893Miscanthus RhizosphereMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF
Ga0207693_1000973713300025915Corn, Switchgrass And Miscanthus RhizosphereHMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF
Ga0207693_1047008343300025915Corn, Switchgrass And Miscanthus RhizosphereMLRLLATLAFAASFDILLFDGKYISAVANIAVAIVQHF
Ga0207689_1004338063300025942Miscanthus RhizosphereMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSV
Ga0207640_1057313433300025981Corn RhizosphereNSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF
Ga0208890_108595113300027523SoilMLRLLTTMAIAASFDILLFDGKYTDAAHQLAVIAIQ
Ga0209068_1086630923300027894WatershedsMLRLLATLAFAASFDILLFDGKYISAVDKLAVAIIQHF
Ga0209583_1074017023300027910WatershedsMLLRILATLAFAASFDILIMDGKYIGAVDKLAVAIFQSF
Ga0075373_1018396613300030945SoilMLRLLATLAFAASFDILLFDGKYIGAVSKIAVAIIQHF
Ga0170824_119731895113300031231Forest SoilMLRFLVTLAFAASFDILLLEGKYISAVDKVAVAIVRSY
Ga0307505_1056575513300031455SoilMLRLLATLAFAASFDILFFDGKYIGAVSKIAVAIIQHF
Ga0310888_1004229013300031538SoilEHIVGDYASHMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF
Ga0307469_1111159413300031720Hardwood Forest SoilMLRLLATLAFAASFDILLNDGKYISAVNKLAVAIIQHF
Ga0306918_1102319913300031744SoilMLRLLATPAFAASFDILLFDGISTVDKIAVQIIGNF
Ga0310899_1004209923300032017SoilMLLCILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF
Ga0310890_1118931323300032075SoilMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAI
Ga0307470_1037867323300032174Hardwood Forest SoilMLRLLATLAFAASFDILLNDGKYISAVNKLAVAII
Ga0307471_10169409113300032180Hardwood Forest SoilMLRLLATLAFAASFDVLLNDGKYISAVNKLAVAIIQHF
Ga0335084_1118297523300033004SoilMLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF
Ga0310810_1023395213300033412SoilITKIYDEIMLRLLATLGFAVSFDILLFDGKYVNAVEHIALAVVQKF
Ga0326726_1001689973300033433Peat SoilMLRLLITMAIAASFDILLFDGKYADAAHQLAVIAIQHF
Ga0326726_1194455723300033433Peat SoilMFRLLATLAFVVGSDILLFDGKYTDAAHQLAVIAIQHL
Ga0326723_0230089_595_7113300034090Peat SoilMLRLLTTMAIAASFDILLFDGKYTDAAHQLAVIALQHF
Ga0326723_0282272_299_4153300034090Peat SoilMLRLSATLAFAASFDILLFDGKNISAVDKVAVAIIRSF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.