Basic Information | |
---|---|
Family ID | F072661 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 121 |
Average Sequence Length | 39 residues |
Representative Sequence | MLRLLATLAFAASFDILLFDGKYISAVDKLAVAIIQHF |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 121 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 53.72 % |
% of genes near scaffold ends (potentially truncated) | 31.40 % |
% of genes from short scaffolds (< 2000 bps) | 83.47 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (52.066 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.917 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.934 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 121 Family Scaffolds |
---|---|---|
PF13561 | adh_short_C2 | 17.36 |
PF03734 | YkuD | 17.36 |
PF00839 | Cys_rich_FGFR | 5.79 |
PF04311 | DUF459 | 4.13 |
PF00106 | adh_short | 3.31 |
PF09594 | GT87 | 2.48 |
PF00188 | CAP | 1.65 |
PF00497 | SBP_bac_3 | 1.65 |
PF02617 | ClpS | 1.65 |
PF03775 | MinC_C | 0.83 |
PF04773 | FecR | 0.83 |
PF06186 | DUF992 | 0.83 |
PF00657 | Lipase_GDSL | 0.83 |
PF04055 | Radical_SAM | 0.83 |
PF13398 | Peptidase_M50B | 0.83 |
PF03992 | ABM | 0.83 |
PF01464 | SLT | 0.83 |
PF00144 | Beta-lactamase | 0.83 |
COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
---|---|---|---|
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 17.36 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 17.36 |
COG2845 | Peptidoglycan O-acetyltransferase, SGNH hydrolase family | Cell wall/membrane/envelope biogenesis [M] | 4.13 |
COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 1.65 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 1.65 |
COG0850 | Septum site-determining protein MinC | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.83 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 52.07 % |
All Organisms | root | All Organisms | 47.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c0621633 | Not Available | 572 | Open in IMG/M |
3300000041|ARcpr5oldR_c018638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
3300000156|NODE_c0635000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2014 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10003361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4344 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10060043 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
3300004268|Ga0066398_10221911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 507 | Open in IMG/M |
3300004633|Ga0066395_10899803 | Not Available | 536 | Open in IMG/M |
3300005093|Ga0062594_100244388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1305 | Open in IMG/M |
3300005147|Ga0066821_1017667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas | 578 | Open in IMG/M |
3300005161|Ga0066807_1012911 | Not Available | 791 | Open in IMG/M |
3300005332|Ga0066388_104885579 | Not Available | 682 | Open in IMG/M |
3300005337|Ga0070682_100167810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1523 | Open in IMG/M |
3300005339|Ga0070660_100719424 | Not Available | 837 | Open in IMG/M |
3300005339|Ga0070660_100975968 | Not Available | 716 | Open in IMG/M |
3300005444|Ga0070694_101927910 | Not Available | 505 | Open in IMG/M |
3300005548|Ga0070665_100812663 | Not Available | 948 | Open in IMG/M |
3300005618|Ga0068864_100099416 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
3300005713|Ga0066905_100002135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7230 | Open in IMG/M |
3300005713|Ga0066905_100297120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1266 | Open in IMG/M |
3300005713|Ga0066905_100685014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
3300005713|Ga0066905_101878483 | Not Available | 554 | Open in IMG/M |
3300005719|Ga0068861_102662963 | Not Available | 504 | Open in IMG/M |
3300005764|Ga0066903_100358097 | Not Available | 2365 | Open in IMG/M |
3300005764|Ga0066903_103856917 | Not Available | 805 | Open in IMG/M |
3300005764|Ga0066903_104070106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Starkeya → unclassified Starkeya → Starkeya sp. ORNL1 | 783 | Open in IMG/M |
3300005764|Ga0066903_106459936 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300005841|Ga0068863_101437529 | Not Available | 698 | Open in IMG/M |
3300006041|Ga0075023_100291247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
3300006041|Ga0075023_100583641 | Not Available | 517 | Open in IMG/M |
3300006057|Ga0075026_100474459 | Not Available | 716 | Open in IMG/M |
3300006057|Ga0075026_100541577 | Not Available | 676 | Open in IMG/M |
3300006057|Ga0075026_100781632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
3300006173|Ga0070716_100955059 | Not Available | 675 | Open in IMG/M |
3300006175|Ga0070712_100557948 | Not Available | 966 | Open in IMG/M |
3300006175|Ga0070712_101898520 | Not Available | 521 | Open in IMG/M |
3300006178|Ga0075367_10884772 | Not Available | 569 | Open in IMG/M |
3300006237|Ga0097621_100856523 | Not Available | 844 | Open in IMG/M |
3300006581|Ga0074048_12347100 | Not Available | 508 | Open in IMG/M |
3300006806|Ga0079220_12095781 | Not Available | 506 | Open in IMG/M |
3300006844|Ga0075428_100663530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1112 | Open in IMG/M |
3300007076|Ga0075435_100712562 | Not Available | 872 | Open in IMG/M |
3300009093|Ga0105240_10342745 | Not Available | 1697 | Open in IMG/M |
3300009148|Ga0105243_10533613 | Not Available | 1118 | Open in IMG/M |
3300010043|Ga0126380_10222659 | Not Available | 1282 | Open in IMG/M |
3300010043|Ga0126380_10529518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 911 | Open in IMG/M |
3300010043|Ga0126380_10951672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 718 | Open in IMG/M |
3300010043|Ga0126380_11456856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas | 604 | Open in IMG/M |
3300010046|Ga0126384_10064209 | All Organisms → cellular organisms → Bacteria | 2585 | Open in IMG/M |
3300010046|Ga0126384_11672910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas | 601 | Open in IMG/M |
3300010047|Ga0126382_10467375 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300010359|Ga0126376_10458518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1167 | Open in IMG/M |
3300010359|Ga0126376_12832976 | Not Available | 535 | Open in IMG/M |
3300010360|Ga0126372_10262612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1490 | Open in IMG/M |
3300010366|Ga0126379_11411763 | Not Available | 802 | Open in IMG/M |
3300010375|Ga0105239_10582324 | Not Available | 1276 | Open in IMG/M |
3300010396|Ga0134126_10175838 | Not Available | 2577 | Open in IMG/M |
3300010397|Ga0134124_11440114 | Not Available | 716 | Open in IMG/M |
3300010401|Ga0134121_10034916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4087 | Open in IMG/M |
3300010401|Ga0134121_10231833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1608 | Open in IMG/M |
3300011120|Ga0150983_10718067 | Not Available | 763 | Open in IMG/M |
3300011444|Ga0137463_1186769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 778 | Open in IMG/M |
3300012480|Ga0157346_1008334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
3300012483|Ga0157337_1024671 | Not Available | 579 | Open in IMG/M |
3300012488|Ga0157343_1002144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1050 | Open in IMG/M |
3300012951|Ga0164300_10255027 | Not Available | 893 | Open in IMG/M |
3300012957|Ga0164303_10085192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1520 | Open in IMG/M |
3300012958|Ga0164299_10546346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas | 781 | Open in IMG/M |
3300012984|Ga0164309_10217584 | Not Available | 1325 | Open in IMG/M |
3300012985|Ga0164308_10382389 | Not Available | 1146 | Open in IMG/M |
3300012987|Ga0164307_11291796 | Not Available | 609 | Open in IMG/M |
3300012988|Ga0164306_11439814 | Not Available | 588 | Open in IMG/M |
3300013105|Ga0157369_10314840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1627 | Open in IMG/M |
3300014324|Ga0075352_1272226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 529 | Open in IMG/M |
3300015371|Ga0132258_11459965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1727 | Open in IMG/M |
3300015371|Ga0132258_12197341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas | 1385 | Open in IMG/M |
3300015371|Ga0132258_13484167 | Not Available | 1078 | Open in IMG/M |
3300015374|Ga0132255_100347327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2148 | Open in IMG/M |
3300017792|Ga0163161_11798333 | Not Available | 545 | Open in IMG/M |
3300017944|Ga0187786_10031623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1488 | Open in IMG/M |
3300017944|Ga0187786_10044957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1305 | Open in IMG/M |
3300017944|Ga0187786_10311704 | Not Available | 650 | Open in IMG/M |
3300017947|Ga0187785_10000756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 11559 | Open in IMG/M |
3300017947|Ga0187785_10006273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae | 3946 | Open in IMG/M |
3300017947|Ga0187785_10015938 | All Organisms → cellular organisms → Bacteria | 2615 | Open in IMG/M |
3300017947|Ga0187785_10035254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1828 | Open in IMG/M |
3300017974|Ga0187777_10157778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1516 | Open in IMG/M |
3300018028|Ga0184608_10470584 | Not Available | 539 | Open in IMG/M |
3300018054|Ga0184621_10141698 | Not Available | 864 | Open in IMG/M |
3300018064|Ga0187773_10164763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1154 | Open in IMG/M |
3300018072|Ga0184635_10033507 | Not Available | 1941 | Open in IMG/M |
3300021478|Ga0210402_10769280 | Not Available | 888 | Open in IMG/M |
3300021560|Ga0126371_13281030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 547 | Open in IMG/M |
3300022507|Ga0222729_1027514 | Not Available | 706 | Open in IMG/M |
3300022533|Ga0242662_10082903 | Not Available | 888 | Open in IMG/M |
3300022533|Ga0242662_10131337 | Not Available | 742 | Open in IMG/M |
3300022694|Ga0222623_10017026 | Not Available | 2691 | Open in IMG/M |
3300022756|Ga0222622_10010223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4422 | Open in IMG/M |
3300025893|Ga0207682_10452637 | Not Available | 608 | Open in IMG/M |
3300025915|Ga0207693_10009737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7825 | Open in IMG/M |
3300025915|Ga0207693_10470083 | Not Available | 982 | Open in IMG/M |
3300025942|Ga0207689_10043380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3718 | Open in IMG/M |
3300025981|Ga0207640_10573134 | Not Available | 952 | Open in IMG/M |
3300027523|Ga0208890_1085951 | Not Available | 521 | Open in IMG/M |
3300027894|Ga0209068_10866309 | Not Available | 534 | Open in IMG/M |
3300027910|Ga0209583_10740170 | Not Available | 517 | Open in IMG/M |
3300030945|Ga0075373_10183966 | Not Available | 506 | Open in IMG/M |
3300031231|Ga0170824_119731895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8731 | Open in IMG/M |
3300031455|Ga0307505_10565755 | Not Available | 551 | Open in IMG/M |
3300031538|Ga0310888_10042290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2089 | Open in IMG/M |
3300031720|Ga0307469_11111594 | Not Available | 743 | Open in IMG/M |
3300031744|Ga0306918_11023199 | Not Available | 641 | Open in IMG/M |
3300032017|Ga0310899_10042099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1627 | Open in IMG/M |
3300032075|Ga0310890_11189313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas | 620 | Open in IMG/M |
3300032174|Ga0307470_10378673 | Not Available | 992 | Open in IMG/M |
3300032180|Ga0307471_101694091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas | 786 | Open in IMG/M |
3300033004|Ga0335084_11182975 | Not Available | 765 | Open in IMG/M |
3300033412|Ga0310810_10233952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2039 | Open in IMG/M |
3300033433|Ga0326726_10016899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6350 | Open in IMG/M |
3300033433|Ga0326726_11944557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
3300034090|Ga0326723_0230089 | Not Available | 824 | Open in IMG/M |
3300034090|Ga0326723_0282272 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.44% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.44% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.13% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.31% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.31% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.31% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.48% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.48% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.48% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.65% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.65% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.83% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_06216331 | 3300000033 | Soil | MLRLLATLAFAASFEIILFDGRYLHAADKVAVAIIRSF* |
ARcpr5oldR_0186382 | 3300000041 | Arabidopsis Rhizosphere | MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQXF* |
NODE_06350002 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | VRAYALRMLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF* |
AF_2010_repII_A1DRAFT_100033615 | 3300000597 | Forest Soil | MLLRILAMLAFAWSLDGKYISAVDKVAVAIFQSF* |
AF_2010_repII_A1DRAFT_100600433 | 3300000597 | Forest Soil | MLRLLATLAFVASFDILLFGGSHITAADRLAVQIFQHF* |
Ga0066398_102219111 | 3300004268 | Tropical Forest Soil | MLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF*ARAPQSQSIG |
Ga0066395_108998031 | 3300004633 | Tropical Forest Soil | NRMLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF* |
Ga0062594_1002443882 | 3300005093 | Soil | MLLRILATLAFAASFDTLILDGKYISAVDKVAVTIFQSF* |
Ga0066821_10176671 | 3300005147 | Soil | MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF* |
Ga0066807_10129112 | 3300005161 | Soil | MLLRILATLAFAASFDILIMDGKYISAVDKVAVAIIQSF* |
Ga0066388_1048855791 | 3300005332 | Tropical Forest Soil | RMLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF* |
Ga0070682_1001678103 | 3300005337 | Corn Rhizosphere | TYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF* |
Ga0070660_1007194241 | 3300005339 | Corn Rhizosphere | HMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF* |
Ga0070660_1009759681 | 3300005339 | Corn Rhizosphere | SRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF* |
Ga0070694_1019279101 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | FETYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF* |
Ga0070665_1008126634 | 3300005548 | Switchgrass Rhizosphere | MLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF* |
Ga0068864_1000994165 | 3300005618 | Switchgrass Rhizosphere | MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQS |
Ga0066905_1000021352 | 3300005713 | Tropical Forest Soil | MLRLLATLAFAASFDIILFDGRYLNAADKVAVAIIRSF* |
Ga0066905_1002971202 | 3300005713 | Tropical Forest Soil | MLLRILATLAFAASFDILILDGKYISAVDKVAAIFQSF* |
Ga0066905_1006850142 | 3300005713 | Tropical Forest Soil | MLCLLATLAFAASFDIILFDGRYITAVDKVAVAIFRSF* |
Ga0066905_1018784831 | 3300005713 | Tropical Forest Soil | MLRLLATLAFAASFDIVLFDGKYISAVDRVAVAIFRGF* |
Ga0068861_1026629631 | 3300005719 | Switchgrass Rhizosphere | MLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF* |
Ga0066903_1003580973 | 3300005764 | Tropical Forest Soil | LANLAFAASFDILLFDGKCISTVDKIAVQIIGHF* |
Ga0066903_1038569171 | 3300005764 | Tropical Forest Soil | MLLRILATLAFAASFDILGLDGKYISAVDKVAVAIFQSF* |
Ga0066903_1040701063 | 3300005764 | Tropical Forest Soil | MLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF* |
Ga0066903_1064599362 | 3300005764 | Tropical Forest Soil | MLRLLATLAFAASFDIVLFDGKYISAVDRVAVAIFRSF* |
Ga0068863_1014375291 | 3300005841 | Switchgrass Rhizosphere | LRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF* |
Ga0075023_1002912472 | 3300006041 | Watersheds | MLRLLTTMAIAASFDILLFDGKYTDAAHQLAVIAIQHF* |
Ga0075023_1005836412 | 3300006041 | Watersheds | MLLRILATLAFAASFDILIMDGKYIGAVDKLAVAIFQSF* |
Ga0075026_1004744592 | 3300006057 | Watersheds | MLRLLATLAFAASFDILLFDGKYIGAVSKIAVAIIQHF* |
Ga0075026_1005415772 | 3300006057 | Watersheds | MLLRILATLAFAASFDILIMDGKYIGAVDKVAVAIIQSF* |
Ga0075026_1007816322 | 3300006057 | Watersheds | MLLRILATLAFAASFDILILDGKYISAGDKVAVAIFQSF* |
Ga0070716_1009550592 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRLLATLAFAASFDILLNDGKYISAVNKLAVAVIHHF* |
Ga0070712_1005579481 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF* |
Ga0070712_1018985202 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF* |
Ga0075367_108847722 | 3300006178 | Populus Endosphere | AAHMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF* |
Ga0097621_1008565231 | 3300006237 | Miscanthus Rhizosphere | IFETYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF* |
Ga0074048_123471001 | 3300006581 | Soil | MLRLLATLAFAASFDILIMDGKYISAVDKVAVAIIQSF* |
Ga0079220_120957812 | 3300006806 | Agricultural Soil | MLRLLATLAFAASFDILLFDGKYITAVDRIAAQIIQ |
Ga0075428_1006635301 | 3300006844 | Populus Rhizosphere | YTARMLRLLATLAFAASFEIILFDGRYLHAADKVAVAIIRSF* |
Ga0075435_1007125621 | 3300007076 | Populus Rhizosphere | YASHMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF* |
Ga0105240_103427453 | 3300009093 | Corn Rhizosphere | MLRLLATLAFAASFDILLFDGKYISAVANIAVAIVQHF* |
Ga0105243_105336131 | 3300009148 | Miscanthus Rhizosphere | MLLRILATLAFAASFDTLILDGKYISAVHKLAVAIIQHF* |
Ga0126380_102226592 | 3300010043 | Tropical Forest Soil | MQRFLATLAFAAAFDILILDGKYVSAVNHVALTFFRGF* |
Ga0126380_105295182 | 3300010043 | Tropical Forest Soil | MLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF* |
Ga0126380_109516722 | 3300010043 | Tropical Forest Soil | MLLRILATLAFAASFDILIMDGKYISAVDKVAVAIFQSF* |
Ga0126380_114568562 | 3300010043 | Tropical Forest Soil | MLRLLATLAFAASFDIILFDGRYITAVDKVAVAIYRSF* |
Ga0126384_100642091 | 3300010046 | Tropical Forest Soil | MQRFLATLAFAAAFDILFLDGKYLSAVNQVALVYFRGF* |
Ga0126384_116729102 | 3300010046 | Tropical Forest Soil | MLLRILAMLTFAWSLDGKYISAVDKVAVAIFQSF* |
Ga0126382_104673752 | 3300010047 | Tropical Forest Soil | MLRLLATLAFAVGFDILLSDGKFTDAAHRVAVAAIQNL* |
Ga0126376_104585182 | 3300010359 | Tropical Forest Soil | MLLRILATLAIAASFDILILDGKYISAVDKVALAIFQSF* |
Ga0126376_128329761 | 3300010359 | Tropical Forest Soil | MLRLLATLAFAAGFDILLSDGKFTDAAYRVAVAAIQNL* |
Ga0126372_102626123 | 3300010360 | Tropical Forest Soil | MLRLLATLAFAASFDILLCDGKYITAVDRIAVQIIQHF* |
Ga0126379_114117632 | 3300010366 | Tropical Forest Soil | MLRLLATPAFAASFDILLFDGKCTSTVDKIAVQIIGHF* |
Ga0105239_105823243 | 3300010375 | Corn Rhizosphere | DSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF* |
Ga0134126_101758383 | 3300010396 | Terrestrial Soil | MLRLLATLAVAASFDILLFDGKYISAVHKLAVAIIQHF* |
Ga0134124_114401143 | 3300010397 | Terrestrial Soil | FETYDSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF* |
Ga0134121_100349161 | 3300010401 | Terrestrial Soil | MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIF |
Ga0134121_102318331 | 3300010401 | Terrestrial Soil | TYDSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF* |
Ga0150983_107180673 | 3300011120 | Forest Soil | MPRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF* |
Ga0137463_11867692 | 3300011444 | Soil | MLRLLATLAFAVSFDILLFDGKYVNAVEHIALAVVQKF* |
Ga0157346_10083342 | 3300012480 | Arabidopsis Rhizosphere | MLLRILATLAFAASFDSLIMDGKYLSAVDKVAVAIFQSF* |
Ga0157337_10246712 | 3300012483 | Arabidopsis Rhizosphere | LATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF* |
Ga0157343_10021442 | 3300012488 | Arabidopsis Rhizosphere | MLLCILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF* |
Ga0164300_102550273 | 3300012951 | Soil | IIAVQESTSLIFETYDSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF* |
Ga0164303_100851925 | 3300012957 | Soil | MLRLLATLGFAVSFDILLFDGKYVNAVEHIALAVVQKF* |
Ga0164299_105463461 | 3300012958 | Soil | MLRLLATLAFAASFDILLFDGKYITAVDKIAVALIQHF* |
Ga0164309_102175844 | 3300012984 | Soil | ETYDSRMLRLLATLAFAASFDILLFDGRYISAVANIAVAIVQHF* |
Ga0164308_103823893 | 3300012985 | Soil | MLRLLATLAFAASFDILLFDGKYISAVHILAVAIIQHF* |
Ga0164307_112917962 | 3300012987 | Soil | MLRLLATLAFAASFDILLNDGKYISAVNKLAVAIIQHF* |
Ga0164306_114398141 | 3300012988 | Soil | IFETYDSRMLRLLATLAFAASFDILLFDGKYISAVANIAVAIVQHF* |
Ga0157369_103148404 | 3300013105 | Corn Rhizosphere | MLRLLATLAFAASFDILLFDCKYISAVHKLAVAIIQHF* |
Ga0075352_12722263 | 3300014324 | Natural And Restored Wetlands | LLATLAFAASFDIILFDGKYISAVDKVAVAIIRNF* |
Ga0132258_114599651 | 3300015371 | Arabidopsis Rhizosphere | MLRLLATLAFVASFDILLFDGKYITVVNKIAVQIIQHF* |
Ga0132258_121973413 | 3300015371 | Arabidopsis Rhizosphere | MLRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF* |
Ga0132258_134841672 | 3300015371 | Arabidopsis Rhizosphere | MLLRILATLAFAASFDTLILDGKYISAVDKVAVAIFQSF* |
Ga0132255_1003473271 | 3300015374 | Arabidopsis Rhizosphere | AVQESTSLIFETYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF* |
Ga0163161_117983332 | 3300017792 | Switchgrass Rhizosphere | MLLRILATLAFAASFDTLILDGKYISAVDKVAVTIFQSF |
Ga0187786_100316234 | 3300017944 | Tropical Peatland | MMRLLLATLAFAVSFDVLLFDGKYTDAVHRIAVIAIQHF |
Ga0187786_100449571 | 3300017944 | Tropical Peatland | MQRFLATLAFAAAFDILFLDGKYISAVDHVALAFFRGF |
Ga0187786_103117042 | 3300017944 | Tropical Peatland | VGAYAPRMLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF |
Ga0187785_1000075612 | 3300017947 | Tropical Peatland | MLRLLLATLVFAVSFDVLLFDGKYTDAVHQIAVVAVQHF |
Ga0187785_100062735 | 3300017947 | Tropical Peatland | MLLRILATLAFAASFDILIMDGKYISAVDKVAVAIFQSF |
Ga0187785_100159382 | 3300017947 | Tropical Peatland | MQRFLATLAFAAAFDILFLDGKYISAVDRAALAFFRGF |
Ga0187785_100352543 | 3300017947 | Tropical Peatland | MLRLLSTTLAFVVSFDVLLFDGEYTDAVHQIAVVAIQHF |
Ga0187777_101577782 | 3300017974 | Tropical Peatland | MLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF |
Ga0184608_104705842 | 3300018028 | Groundwater Sediment | MLRFLAFAASFDILLLEGKYISAVDKVAVAIVRSF |
Ga0184621_101416982 | 3300018054 | Groundwater Sediment | MLRLLATLAFAASFDIILFDGKYISAVDKVAVAIVR |
Ga0187773_101647634 | 3300018064 | Tropical Peatland | MPRLSATPTFAASFDILLFDGKYISAVDKVAVAVIRSF |
Ga0184635_100335071 | 3300018072 | Groundwater Sediment | MLRILATLAFAASFDIILFDGKYISAVDKVAVAIVRSF |
Ga0210402_107692802 | 3300021478 | Soil | MLRLLATLAFAASFDILLCDGKYISAVNKLAVAIIQHF |
Ga0126371_132810301 | 3300021560 | Tropical Forest Soil | MLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHFCARSPQS |
Ga0222729_10275141 | 3300022507 | Soil | MPRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF |
Ga0242662_100829033 | 3300022533 | Soil | MLRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF |
Ga0242662_101313373 | 3300022533 | Soil | MLRLLATLAFAASFDILLFDGKYICAGDKIAVALIQHF |
Ga0222623_100170262 | 3300022694 | Groundwater Sediment | MLRLLATLAFAASFDIILFDGKYISAVDKVAVAIVRSF |
Ga0222622_1001022310 | 3300022756 | Groundwater Sediment | MLRFLVTLAFAASFDILLLEGKYISAVDKVAVAIVRSF |
Ga0207682_104526372 | 3300025893 | Miscanthus Rhizosphere | MLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF |
Ga0207693_100097371 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | HMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF |
Ga0207693_104700834 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRLLATLAFAASFDILLFDGKYISAVANIAVAIVQHF |
Ga0207689_100433806 | 3300025942 | Miscanthus Rhizosphere | MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSV |
Ga0207640_105731343 | 3300025981 | Corn Rhizosphere | NSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF |
Ga0208890_10859511 | 3300027523 | Soil | MLRLLTTMAIAASFDILLFDGKYTDAAHQLAVIAIQ |
Ga0209068_108663092 | 3300027894 | Watersheds | MLRLLATLAFAASFDILLFDGKYISAVDKLAVAIIQHF |
Ga0209583_107401702 | 3300027910 | Watersheds | MLLRILATLAFAASFDILIMDGKYIGAVDKLAVAIFQSF |
Ga0075373_101839661 | 3300030945 | Soil | MLRLLATLAFAASFDILLFDGKYIGAVSKIAVAIIQHF |
Ga0170824_11973189511 | 3300031231 | Forest Soil | MLRFLVTLAFAASFDILLLEGKYISAVDKVAVAIVRSY |
Ga0307505_105657551 | 3300031455 | Soil | MLRLLATLAFAASFDILFFDGKYIGAVSKIAVAIIQHF |
Ga0310888_100422901 | 3300031538 | Soil | EHIVGDYASHMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF |
Ga0307469_111115941 | 3300031720 | Hardwood Forest Soil | MLRLLATLAFAASFDILLNDGKYISAVNKLAVAIIQHF |
Ga0306918_110231991 | 3300031744 | Soil | MLRLLATPAFAASFDILLFDGISTVDKIAVQIIGNF |
Ga0310899_100420992 | 3300032017 | Soil | MLLCILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF |
Ga0310890_111893132 | 3300032075 | Soil | MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAI |
Ga0307470_103786732 | 3300032174 | Hardwood Forest Soil | MLRLLATLAFAASFDILLNDGKYISAVNKLAVAII |
Ga0307471_1016940911 | 3300032180 | Hardwood Forest Soil | MLRLLATLAFAASFDVLLNDGKYISAVNKLAVAIIQHF |
Ga0335084_111829752 | 3300033004 | Soil | MLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF |
Ga0310810_102339521 | 3300033412 | Soil | ITKIYDEIMLRLLATLGFAVSFDILLFDGKYVNAVEHIALAVVQKF |
Ga0326726_100168997 | 3300033433 | Peat Soil | MLRLLITMAIAASFDILLFDGKYADAAHQLAVIAIQHF |
Ga0326726_119445572 | 3300033433 | Peat Soil | MFRLLATLAFVVGSDILLFDGKYTDAAHQLAVIAIQHL |
Ga0326723_0230089_595_711 | 3300034090 | Peat Soil | MLRLLTTMAIAASFDILLFDGKYTDAAHQLAVIALQHF |
Ga0326723_0282272_299_415 | 3300034090 | Peat Soil | MLRLSATLAFAASFDILLFDGKNISAVDKVAVAIIRSF |
⦗Top⦘ |