


| Basic Information | |
|---|---|
| Family ID | F072234 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSEKIYVRKCERYTLWEATKPIEVDVEKLRKCEPPYEG |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.83 % |
| % of genes near scaffold ends (potentially truncated) | 95.04 % |
| % of genes from short scaffolds (< 2000 bps) | 76.86 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.413 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (42.975 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.975 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.388 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.09% β-sheet: 15.15% Coil/Unstructured: 75.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF01713 | Smr | 12.40 |
| PF00085 | Thioredoxin | 6.61 |
| PF13517 | FG-GAP_3 | 4.96 |
| PF01467 | CTP_transf_like | 4.13 |
| PF00136 | DNA_pol_B | 3.31 |
| PF00175 | NAD_binding_1 | 2.48 |
| PF13385 | Laminin_G_3 | 2.48 |
| PF10417 | 1-cysPrx_C | 2.48 |
| PF01555 | N6_N4_Mtase | 1.65 |
| PF07728 | AAA_5 | 1.65 |
| PF01464 | SLT | 1.65 |
| PF00037 | Fer4 | 1.65 |
| PF00118 | Cpn60_TCP1 | 0.83 |
| PF01883 | FeS_assembly_P | 0.83 |
| PF04023 | FeoA | 0.83 |
| PF01755 | Glyco_transf_25 | 0.83 |
| PF10504 | DUF2452 | 0.83 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.83 |
| PF00565 | SNase | 0.83 |
| PF14284 | PcfJ | 0.83 |
| PF10688 | Imp-YgjV | 0.83 |
| PF04055 | Radical_SAM | 0.83 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 3.31 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.65 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.65 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.65 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 0.83 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.41 % |
| All Organisms | root | All Organisms | 49.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 42.98% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.26% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 7.44% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.61% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.79% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.96% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.13% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.13% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.48% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.48% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.65% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.65% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.65% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.83% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.83% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.83% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001822 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM39, ROCA_DNA108_2.0um_23a | Environmental | Open in IMG/M |
| 3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
| 3300003345 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA | Environmental | Open in IMG/M |
| 3300003621 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300016742 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017960 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaG | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025684 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028131 | Seawater microbial communities from Monterey Bay, California, United States - 53D | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NpDRAFT_101202972 | 3300000929 | Freshwater And Marine | MSEKIYVRKCERYTIWESSKPVEVDVEKLRKCEPPYDGDS |
| NpDRAFT_101618191 | 3300000929 | Freshwater And Marine | MNKVYVRKCERYTIWEASKPFEVDVEKLRKCEPPFEGNSDED* |
| ACM39_1020021 | 3300001822 | Marine Plankton | MSEKLYVRQVERYTVWEATEPIEIDVEKLRKCEPPY |
| GOS2221_10181003 | 3300001938 | Marine | METVYVRAVERYTVWEATQPIEVNVKILRGCTPPFEGETEQDLL |
| JGI26080J50196_10845951 | 3300003345 | Marine | MSEKIYVRKCERYTVWEASEPIEVDVEKLRQCEPPYEGDSA |
| JGI26083J51738_1001616810 | 3300003621 | Marine | IYVRKCERYTVWEASEPIEVDVEKLRKCEPPYEGIQLKSY* |
| JGI26083J51738_100349724 | 3300003621 | Marine | MSEKIYVRKCERYTVWEASEPIEVDVEKLRQCEPPYEGIQRKSY* |
| Ga0078893_106310391 | 3300005837 | Marine Surface Water | MSEKLYVRRCEKYTIWEATEEPIEVHVDKLRKCEP |
| Ga0098048_11347041 | 3300006752 | Marine | MNKVYVRKCERYTIWEASEPFEVDVEKLRKCEPPFEGETEQ |
| Ga0070752_12626892 | 3300007345 | Aqueous | MSEEKLYVRMCERYTIWEASEPYEVNVEALRKCNPPY |
| Ga0070753_10594813 | 3300007346 | Aqueous | MSEEKLYVRMCERYTIWEASEPIEVNVETLRKCTPAY |
| Ga0070753_10680751 | 3300007346 | Aqueous | MSEKIYVRKVERFTQWQASQPIEIDVETLRKCTPP |
| Ga0099849_10745405 | 3300007539 | Aqueous | MEEKLFVRRCEKFTQWTATQPIEVDVEKLRKCEPPYEGNTEQELFDYLN |
| Ga0099849_10796753 | 3300007539 | Aqueous | MSEKLYIRKCERYTAWEATEPIEVDVEKLRKCDPPYEGETAEDLLHYFE |
| Ga0099850_12084813 | 3300007960 | Aqueous | MSEKIYVRKVERYTVWEASKPIEVDVEKLRKCEPPYEG |
| Ga0075480_103030261 | 3300008012 | Aqueous | MSDKVYVRMCEKFTQWRASTPIEVDVEKLRKCDPPYEGDSHEELL |
| Ga0102963_13435223 | 3300009001 | Pond Water | MSEKLHIRKVERYTLWEATKPVEVDVEKLRKCEPPYEGNSHEE |
| Ga0115005_106804571 | 3300009432 | Marine | MSEKIYVRKCERYTVWEASDPIEVDVEKLTKCVPPYEG |
| Ga0115005_111730931 | 3300009432 | Marine | MSEKIYIRKCESYTLWEASEPIEVDVEKLRKCEPPYEGETNEDLLN |
| Ga0115561_13634652 | 3300009440 | Pelagic Marine | MSEKIYVRKCERYTLWEATKPIEVDVEKLRKCEPPYEGNT |
| Ga0115557_13235631 | 3300009443 | Pelagic Marine | MSEEKVYVRFCESYRIAQASEPIEVDVESLRKCTPAYEGNTAEEL |
| Ga0115555_13526583 | 3300009476 | Pelagic Marine | MSEKIYVRKCERFTQWEASEPIEVDVEKLRNCVPHYEGET |
| Ga0115003_100973795 | 3300009512 | Marine | MSEKIYVRKCERYTVWEASEPIEVDVEKLTKCVPPYEGSTEEHLLE |
| Ga0129348_12099181 | 3300010296 | Freshwater To Marine Saline Gradient | MSEEKLYVRMCERYTIWEASEPIEVNVETLRKCTPA |
| Ga0129342_10958782 | 3300010299 | Freshwater To Marine Saline Gradient | MSEEKLYVRMCERYTICEASEPIEVDVETLRKCTPAYEG |
| Ga0129333_104610873 | 3300010354 | Freshwater To Marine Saline Gradient | MSEKIYVRKVESWTIQAASEPIEVDVEKLRSCEPPY |
| Ga0163109_105384823 | 3300012936 | Surface Seawater | MSEKLYVRRCEKYTIWEATEEPIEVHVDKLRKCEPPYEGSTTEELWKYL |
| (restricted) Ga0172363_106656052 | 3300013130 | Sediment | MDKIYVRKCERYTVWEASEPIEVNLEKLRQCDPPFEG |
| Ga0182052_11511016 | 3300016742 | Salt Marsh | MSEKIYVRMCERFTQWRASEPVEIDVEKLRKCEPPYEGNSHE |
| Ga0182095_14892773 | 3300016791 | Salt Marsh | MSEKVYVRMCERFTQWRASTPVEVDVEKLRKCDPPYEGNSHEEL |
| Ga0181388_10233825 | 3300017724 | Seawater | MDKVYVRKCERYTIWEASEPFEVDVEKLRKCEPPFEGETEQELLDYLT |
| Ga0181401_10321366 | 3300017727 | Seawater | MTEKLYVRRCERYTIWEATEEPIEVDVDKLRKCEPPYEGSTTEE |
| Ga0181396_10212471 | 3300017729 | Seawater | MSEKIYVRKCERYTLWEATKPIEVDVEKLRKCEPPYEGNTPEELLNYF |
| Ga0181389_10661211 | 3300017746 | Seawater | MSEKIYVRKCERYTLWEATKPIEVDVEKLRKCEPPYEGNTP |
| Ga0181405_11290783 | 3300017750 | Seawater | MNKVYVRKCERYTIWEASKPFEVDVEKLRKCEPPFEGETEQELLDYLT |
| Ga0181410_11759881 | 3300017763 | Seawater | MSEKIYVRKCERYTLWEATKPIEVDVEKLRKCEQPY |
| Ga0181424_100195878 | 3300017786 | Seawater | MSEKLYIRKCEKYTIWEATEPFEVDVEKLRQCEPPYEGETPEDLIT |
| Ga0181584_102496494 | 3300017949 | Salt Marsh | MDKVYVRAVERYTVWEATEPIEVNVEKLRQCEPPFEGE |
| Ga0181607_103161014 | 3300017950 | Salt Marsh | MSKVYVRKCERFTQWEASEPIEVDVEKLRNCVPPYEGETE |
| Ga0181577_1001486711 | 3300017951 | Salt Marsh | MEKLFVRKCERYTLWEASTPIEIDVEKLRKCDPPYEGDSA |
| Ga0181583_103786224 | 3300017952 | Salt Marsh | MEKLFVRKCERYTLWEAPTPIEIDVEKLRKCDPPYEGDSA |
| Ga0181580_1000892016 | 3300017956 | Salt Marsh | MSEKFYVRRCEKYTLWEATEEPIEVDVDKLRKCEPPYE |
| Ga0181580_1001572516 | 3300017956 | Salt Marsh | MDKVYVRAVERYTVWEATEPIEVNVEKLRQCEPPFEGETE |
| Ga0181580_104658611 | 3300017956 | Salt Marsh | MSEKLHIRKVERYTLWEATEPVEVDVEKLRKCEPPYE |
| Ga0181580_106068931 | 3300017956 | Salt Marsh | MSKVYVRKCERFTQWEASEPIEVDVEKLRNCVPPYEGETEKDL |
| Ga0180429_112817773 | 3300017960 | Hypersaline Lake Sediment | MSEKIYVRKVERYTVWEASKPIEVDVEKLRKCEPPYEGDS |
| Ga0181581_101414014 | 3300017962 | Salt Marsh | MSKVYVRKCERFTQWEASEPIEVDVEKLRNCVPPYEGETEKDLL |
| Ga0181590_100130671 | 3300017967 | Salt Marsh | MSEKFYVRRCEKYTLWEATAEPIEVDVDKLRKCEPPYEGN |
| Ga0181590_100880451 | 3300017967 | Salt Marsh | MSEKFYVRRCEKYTLWEATEEPIEVDVDKLRKCEPPYEGNT |
| Ga0181590_106474722 | 3300017967 | Salt Marsh | MSKVYVRKCERFTQWEASEPIEVDVEKLRNCVPPYEGE |
| Ga0181590_109529462 | 3300017967 | Salt Marsh | MSEKFYVRRCEKYTLWEATAEPIEVDVDKLRKCEPPYEG |
| Ga0181576_100049971 | 3300017985 | Salt Marsh | MEKLFVRKCERYTLWEASTPIEIDVEKLRKCDPPYEGDSAKEVLDYLQEN |
| Ga0181576_100267921 | 3300017985 | Salt Marsh | MSEKLFVRKCERYTLWEASKPIEIDVEKLRKCDPPYEGDSAQEVLD |
| Ga0181569_100950807 | 3300017986 | Salt Marsh | MSEKLFVRKCERYTLWEASTPIEIDVEKLRKCDPPYEGDSA |
| Ga0181569_109583632 | 3300017986 | Salt Marsh | MSEKLFVRKCERYTLWEASTPIEIDVEKLRKCDPPYE |
| Ga0180432_101878093 | 3300017989 | Hypersaline Lake Sediment | MSEKIYVRKVERYTVWEASKPIEVDVEKLRKCEPPYEGD |
| Ga0181601_101309061 | 3300018041 | Salt Marsh | MSEEKLYVRMCERYTIWEASEPIEIDVETLRKCTPAYEGETSSDL |
| Ga0181601_106003503 | 3300018041 | Salt Marsh | MSKVYVRKCERFTQWEASEPIEVDVEKLRNCVPPYEGETEKDLLD |
| Ga0181561_101204045 | 3300018410 | Salt Marsh | MEKVYVRAVERYTVWEATQPIEVNVEKLRQCEPPFEGE |
| Ga0181553_100419347 | 3300018416 | Salt Marsh | MENVYVRAVERYTVWEATQPIEVNVEKLRQCEPPFEGETEQDLLEYL |
| Ga0181563_105082501 | 3300018420 | Salt Marsh | MSDKIYVRKCERYTLWEASTPIEIDVEKLRKCDPPYEGDSAQEVLDYL |
| Ga0181592_100941651 | 3300018421 | Salt Marsh | MSEKFYVRRCEKYTIWEATAEPIEVDVEKLRKCEPPYEGNTSEELWNYLETNLY |
| Ga0181566_100962017 | 3300018426 | Salt Marsh | MSEKLFVRKCERYTLWEASKPIEIDVEKLRKCDPPYEGDSAQEVLDYL |
| Ga0181566_102046724 | 3300018426 | Salt Marsh | MSKVYVRKCERFTQWEASEPIEVDVEKLRNCVPPYEGETEKD |
| Ga0181566_109998542 | 3300018426 | Salt Marsh | MEKLFVRKCERYTLWEASTPIEIDVEKLRKCDPPYEGDSAQEVLDYL |
| Ga0181568_100108111 | 3300018428 | Salt Marsh | MEKLFVRKCERYTLWEASTPIEIDVEKLRKCDPPYEGDSAQEVLDYLQENVH |
| Ga0181564_103421611 | 3300018876 | Salt Marsh | MSEKFYVRRCEKYTLWEATEEPIEVDVDKLRKCEP |
| Ga0181575_101308621 | 3300020055 | Salt Marsh | MSEKLFVRKCERYTLWEASTPIEIDVEKLRKCDPP |
| Ga0181575_101363851 | 3300020055 | Salt Marsh | MEKLFVRKCERYTLWEASTPIEIDVEKLRKCDPPYEGD |
| Ga0181603_101391933 | 3300020174 | Salt Marsh | MSEEKLYVRMCERYTIWEASEPIEVDVETLRKCTPAYEGET |
| Ga0181603_102791573 | 3300020174 | Salt Marsh | MENVYVRAVERYTVWEATEPIEVNVEKLRQCEPPFDGET |
| Ga0181570_100463345 | 3300020207 | Salt Marsh | MEKLFVRKCERYTLWEASTPIEIDVEKLRKCDPPYEG |
| Ga0211532_100650901 | 3300020403 | Marine | MSEKLYVRRCEKYTIWEATEKPIEVNVDKLRKCKPPYEGSTTEELW |
| Ga0211532_100963123 | 3300020403 | Marine | MSEKLYVRRCEKYTIWEATEKPIEVDVEKLRKCKPPYEGSTTEELW |
| Ga0211651_103287622 | 3300020408 | Marine | MSEKLYVRRCEKYTLWEATEEPIEVHVDRLRKCEPPYEGSTTEELWKYLEEN |
| Ga0211559_105347341 | 3300020442 | Marine | MSEKFYVRRCEKYTIWEATAEPVEVDVDKLRKCEPPYE |
| Ga0211577_102534074 | 3300020469 | Marine | MNKVYVRKCERYTIWEASKPFEVDVEKLRKCEPPFEGETEQEL |
| Ga0213858_105353401 | 3300021356 | Seawater | MSEKLFVRKCERYTLWEASKPIEIDVEKLRKCDPPYEGD |
| Ga0213860_100986237 | 3300021368 | Seawater | MADKLFVRRCEKFTQWTATQPIEVDVEKLRKCEPPYEGNTEQELF |
| Ga0213860_104554421 | 3300021368 | Seawater | MSEKLFVRKCERYTLWEASKPIEIDVEKLRKCDPPYEGDSAQEVL |
| Ga0213864_104821982 | 3300021379 | Seawater | MSEKFYVRRCEKYTLWEATEEPIEVDVDKLRKCEPPYEG |
| Ga0222717_100907711 | 3300021957 | Estuarine Water | MSEKIYVRKCERYTLWEATKPIEVDVEKLRKCEPPYEGNTPEELLNYLGDNVW |
| Ga0222715_101602441 | 3300021960 | Estuarine Water | MSEKIYVRKCERYTLWEATKPIEVDVEKLRKCEPPYEGNTPE |
| Ga0222719_105712341 | 3300021964 | Estuarine Water | MSEKIYLRKVERFTVWEASKPIEVDVEKLRNCEPP |
| Ga0255755_10221161 | 3300022909 | Salt Marsh | MSEKFYVRRCEKYTLWEATAEPIEVDVEKLRKCEPPYEGNTSEE |
| Ga0255755_11451583 | 3300022909 | Salt Marsh | MSKVYVRKCERFTQWEASEPIEVDVEKLRNCVPPY |
| Ga0255773_101840754 | 3300022925 | Salt Marsh | MSEKFYVRRCEKYTLWEATEEPIEVDVDKLRKCEPPYEGN |
| Ga0255769_102992721 | 3300022927 | Salt Marsh | MSKVYVRKCERFTQWEASEPIEVDVEKLRNCVPPYEGETEK |
| Ga0255758_100067691 | 3300022928 | Salt Marsh | MKNVYVRAVERYTVWEATQPIEVNVEKLRQCEPPFEGETEQD |
| Ga0255758_100957465 | 3300022928 | Salt Marsh | MSKVYVRKCERFTQWEASEPIEVDVEKLRNCVPPYEGETEKDLLDYL |
| Ga0255752_100205121 | 3300022929 | Salt Marsh | MKNVYVRAVERYTVWEATQPIEVNVEKLRQCEPPFEGETE |
| Ga0255781_101798911 | 3300022934 | Salt Marsh | MSEKLFVRKCERYTLWEASTPIEIDVEKLRKCDPPYEGD |
| Ga0255782_101482871 | 3300023105 | Salt Marsh | MSKVYVRKCERFTQWEASEPIEVDVEKLRNCVPPYEGET |
| Ga0255784_101110893 | 3300023108 | Salt Marsh | MSEKLFVRKCERYTLWEASTPIEIDVEKLRKCDPPYEGDSAQEVLD |
| Ga0255743_103494213 | 3300023110 | Salt Marsh | MSEKLHIRKVERYTLWEATEPVEVDVEKLRKCEPPY |
| Ga0255761_1001227316 | 3300023170 | Salt Marsh | MSKVYVRKCERFTQWEASEPIEVDVEKLRNCVPPYEG |
| Ga0255761_103116292 | 3300023170 | Salt Marsh | MSEKFYVRRCEKYTLWEATAEPIEVDVEKLRKCEPPY |
| Ga0255772_100308921 | 3300023176 | Salt Marsh | MSEKFYVRRCEKYTLWEATAEPIEVDVEKLRKCEPPYEGNTSEEL |
| Ga0255768_100869161 | 3300023180 | Salt Marsh | MDKVYVRAVERYTVWEATEPIEVNVEKLRQCEPPFEGETEQ |
| Ga0255768_101770705 | 3300023180 | Salt Marsh | MSEKLHIRKVERYTLWEATEPVEVDVEKLRKCEPPYEGNSEKELFQYL |
| Ga0255768_101799721 | 3300023180 | Salt Marsh | MSEKFYVRRCEKYTLWEATAEPIEVDVEKLRKCEPPYEGNTSEELWN |
| Ga0233402_10376643 | 3300024229 | Seawater | MSEKIYVRKCERYTLWEATKPIEVDVEKLRKCEPP |
| Ga0208791_10092384 | 3300025083 | Marine | MNKVYVRKCERYTIWEASEPFEVDVEKLRKCEPPF |
| Ga0208792_10153561 | 3300025085 | Marine | MDKVYVRKCERYTIWEASEPFEVDVEKLRKCEPPFE |
| Ga0208669_11134462 | 3300025099 | Marine | MSEKIYVRKCERYTLWEATKPIEVDVEKLRKCEPPYEGNTPEELLNYLGDNVWC |
| Ga0208666_10576301 | 3300025102 | Marine | MSEKLYVRRCEKYTIWEATEKPIEVDVDKLRKCKPPYEGSTTE |
| Ga0209136_10308696 | 3300025636 | Marine | MADKVYVRMCEKFTQWRASEPVEVDVEKLRKCEPPYEGNSHEELLQYL |
| Ga0208161_11195712 | 3300025646 | Aqueous | MSEEKLYVRMCERYTIWEASEPIEVNVETLRKCTPAYE |
| Ga0209601_11933552 | 3300025666 | Pelagic Marine | MSEKIYVRKCERYTLWEATEPIEVDVEKLRKCEPPYEGNTPEELL |
| Ga0209652_10574471 | 3300025684 | Marine | MEKIYVRKCERYTVWEASEPIEVDVEKLRQCEPPYGGETEQDLLEYL |
| Ga0209652_10654341 | 3300025684 | Marine | MEKIYVRKCERYTVWEASDPIEVDVEILRKCEPPYEGDSAEELLEY |
| Ga0209771_12295133 | 3300025701 | Marine | MADKVYVRMCEKFTQWRASEPVEVDVEKLRKCEPPYEGNS |
| Ga0209137_10101761 | 3300025767 | Marine | MEKIYVRKCERYTVWEASEPIEVDVEKLRKCEPPYEGDSAEE |
| Ga0208767_10622601 | 3300025769 | Aqueous | MADKLFVRRCEKFTQWTATQPIEVDVEKLRKCEPPYEGNTEQELFDYLN |
| Ga0209714_11501521 | 3300025822 | Pelagic Marine | MSEKIYVRKCERYTLWEATEPIEVDVEKLRKCEPPYEGNTPEELLNYLGD |
| Ga0208544_102606671 | 3300025887 | Aqueous | MSEEKVYVRFCESYRIAQASEPIEVDVESLRKCTPAYE |
| Ga0209951_10355743 | 3300026138 | Pond Water | MDKVYVRQAERYTVWEATEPVEVNVEKLRKCEPPF |
| Ga0209702_100549828 | 3300027976 | Freshwater | MEKIFVRKCERYTVWTASEPIEVDVEKLRKCEPPF |
| Ga0228642_10171361 | 3300028131 | Seawater | MSEKIYVRKCERYTLWEATKPIEVDVEKLRKCEPPYEG |
| Ga0315907_101770093 | 3300031758 | Freshwater | MEKIFVRKCERYTVWEATSPIEVDVEKLRKCDPPFEGTNEEDLLFYLRD |
| Ga0315321_103805841 | 3300032088 | Seawater | MNKVYVRKCERYTIWEASKPFEVDVEKLRKCEPPFEGETEQELLDYL |
| ⦗Top⦘ |