NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071800

Metagenome / Metatranscriptome Family F071800

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071800
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 99 residues
Representative Sequence KSSDLSAIPLCGKHHRTGDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPTKAGLAGAIRRMSQLRREMETEVA
Number of Associated Samples 88
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 12.30 %
% of genes near scaffold ends (potentially truncated) 77.05 %
% of genes from short scaffolds (< 2000 bps) 82.79 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.361 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(23.770 % of family members)
Environment Ontology (ENVO) Unclassified
(50.820 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.262 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.84%    β-sheet: 14.63%    Coil/Unstructured: 45.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF01909NTP_transf_2 19.17
PF04014MazE_antitoxin 5.00
PF05565Sipho_Gp157 3.33
PF05168HEPN 3.33
PF04255DUF433 2.50
PF01850PIN 2.50
PF13470PIN_3 1.67
PF02452PemK_toxin 1.67
PF11848DUF3368 1.67
PF00072Response_reg 0.83
PF01041DegT_DnrJ_EryC1 0.83
PF01402RHH_1 0.83
PF09907HigB_toxin 0.83
PF05974DUF892 0.83
PF07589PEP-CTERM 0.83
PF12838Fer4_7 0.83
PF09970DUF2204 0.83
PF05973Gp49 0.83
PF07927HicA_toxin 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG1895HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 3.33
COG2250HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 3.33
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 2.50
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 1.67
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.83
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.83
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.83
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.83
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.83
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.83
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.83
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.83
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 0.83
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.36 %
UnclassifiedrootN/A1.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY02GQDDVAll Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4527Open in IMG/M
3300004478|Ga0068972_1375757All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4533Open in IMG/M
3300005329|Ga0070683_102025137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4553Open in IMG/M
3300005841|Ga0068863_101510397All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4680Open in IMG/M
3300005938|Ga0066795_10162278All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4666Open in IMG/M
3300005994|Ga0066789_10289241All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300009029|Ga0066793_10013036All Organisms → cellular organisms → Bacteria4424Open in IMG/M
3300009029|Ga0066793_10085410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41818Open in IMG/M
3300009029|Ga0066793_10255678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41015Open in IMG/M
3300009176|Ga0105242_12200595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4597Open in IMG/M
3300009524|Ga0116225_1298721All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4719Open in IMG/M
3300009525|Ga0116220_10203746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4858Open in IMG/M
3300009545|Ga0105237_11351559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4719Open in IMG/M
3300009630|Ga0116114_1006875All Organisms → cellular organisms → Bacteria3945Open in IMG/M
3300009643|Ga0116110_1005024All Organisms → cellular organisms → Bacteria6075Open in IMG/M
3300009645|Ga0116106_1004339All Organisms → cellular organisms → Bacteria5906Open in IMG/M
3300009839|Ga0116223_10218375All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41159Open in IMG/M
3300009839|Ga0116223_10388875All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4822Open in IMG/M
3300010376|Ga0126381_100502153All Organisms → cellular organisms → Bacteria1711Open in IMG/M
3300010379|Ga0136449_100041405All Organisms → cellular organisms → Bacteria10682Open in IMG/M
3300010379|Ga0136449_100795852All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41563Open in IMG/M
3300010379|Ga0136449_101660649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4966Open in IMG/M
3300010379|Ga0136449_101989167All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4859Open in IMG/M
3300012469|Ga0150984_122439896All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4533Open in IMG/M
3300012961|Ga0164302_11625048All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4538Open in IMG/M
3300014152|Ga0181533_1035324All Organisms → cellular organisms → Bacteria2816Open in IMG/M
3300014161|Ga0181529_10362361All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4792Open in IMG/M
3300014199|Ga0181535_10844461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4518Open in IMG/M
3300014200|Ga0181526_10344722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4947Open in IMG/M
3300014491|Ga0182014_10084108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41980Open in IMG/M
3300014491|Ga0182014_10109981All Organisms → cellular organisms → Bacteria1636Open in IMG/M
3300014491|Ga0182014_10301152All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4823Open in IMG/M
3300014491|Ga0182014_10631398All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4513Open in IMG/M
3300014492|Ga0182013_10135670All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300014492|Ga0182013_10250890All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41024Open in IMG/M
3300014494|Ga0182017_10194095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41300Open in IMG/M
3300014495|Ga0182015_10723591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4627Open in IMG/M
3300014496|Ga0182011_10473706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4808Open in IMG/M
3300014838|Ga0182030_10429357All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300014838|Ga0182030_11450254All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4569Open in IMG/M
3300014838|Ga0182030_11493610All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4558Open in IMG/M
3300014838|Ga0182030_11523638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4551Open in IMG/M
3300014839|Ga0182027_10755720All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300014839|Ga0182027_11993286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4556Open in IMG/M
3300017792|Ga0163161_11428016All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4605Open in IMG/M
3300017925|Ga0187856_1340952All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4509Open in IMG/M
3300017931|Ga0187877_1131313Not Available1020Open in IMG/M
3300017934|Ga0187803_10290103All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4652Open in IMG/M
3300017972|Ga0187781_10090605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42117Open in IMG/M
3300017972|Ga0187781_10892818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4647Open in IMG/M
3300017988|Ga0181520_10154973All Organisms → cellular organisms → Bacteria → Acidobacteria1858Open in IMG/M
3300018002|Ga0187868_1007110All Organisms → cellular organisms → Bacteria6210Open in IMG/M
3300018002|Ga0187868_1131112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4931Open in IMG/M
3300018008|Ga0187888_1333906All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4578Open in IMG/M
3300018014|Ga0187860_1092688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1390Open in IMG/M
3300018022|Ga0187864_10257490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4797Open in IMG/M
3300018025|Ga0187885_10033494All Organisms → cellular organisms → Bacteria2760Open in IMG/M
3300018030|Ga0187869_10012424All Organisms → cellular organisms → Bacteria5126Open in IMG/M
3300018030|Ga0187869_10605103All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4518Open in IMG/M
3300018033|Ga0187867_10102017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41671Open in IMG/M
3300018033|Ga0187867_10109638All Organisms → cellular organisms → Bacteria → Acidobacteria1604Open in IMG/M
3300018035|Ga0187875_10061156All Organisms → cellular organisms → Bacteria2180Open in IMG/M
3300018035|Ga0187875_10327771All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4825Open in IMG/M
3300018035|Ga0187875_10367234All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4772Open in IMG/M
3300018037|Ga0187883_10088552All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300018037|Ga0187883_10253117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4901Open in IMG/M
3300018040|Ga0187862_10018168All Organisms → cellular organisms → Bacteria5607Open in IMG/M
3300018042|Ga0187871_10135050All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300018042|Ga0187871_10250122All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes984Open in IMG/M
3300018042|Ga0187871_10772515All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4536Open in IMG/M
3300018043|Ga0187887_10528896All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4696Open in IMG/M
3300018043|Ga0187887_10891237All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4527Open in IMG/M
3300018044|Ga0187890_10518315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4671Open in IMG/M
3300018044|Ga0187890_10773093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4543Open in IMG/M
3300018044|Ga0187890_10858631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4512Open in IMG/M
3300018046|Ga0187851_10091075All Organisms → cellular organisms → Bacteria1906Open in IMG/M
3300018057|Ga0187858_10741384All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4584Open in IMG/M
3300018060|Ga0187765_10806222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4627Open in IMG/M
3300018062|Ga0187784_10071477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42815Open in IMG/M
3300018062|Ga0187784_10071477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42815Open in IMG/M
3300018062|Ga0187784_10217982Not Available1556Open in IMG/M
3300018085|Ga0187772_11307703All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4536Open in IMG/M
3300018433|Ga0066667_11778333All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4557Open in IMG/M
3300018468|Ga0066662_13013429All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4501Open in IMG/M
3300019082|Ga0187852_1447152All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4500Open in IMG/M
3300021861|Ga0213853_11070975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4629Open in IMG/M
3300023068|Ga0224554_1101707All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4661Open in IMG/M
3300025918|Ga0207662_11264399All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4524Open in IMG/M
3300026217|Ga0209871_1078722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4637Open in IMG/M
3300026273|Ga0209881_1186722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4517Open in IMG/M
3300027854|Ga0209517_10018090All Organisms → cellular organisms → Bacteria6799Open in IMG/M
3300027854|Ga0209517_10050482All Organisms → cellular organisms → Bacteria3152Open in IMG/M
3300027854|Ga0209517_10653540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4548Open in IMG/M
3300027911|Ga0209698_11287314All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4536Open in IMG/M
3300028566|Ga0302147_10230166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4620Open in IMG/M
3300028785|Ga0302201_10076286All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1569Open in IMG/M
3300028874|Ga0302155_10104945All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300029922|Ga0311363_10320386All Organisms → cellular organisms → Bacteria1720Open in IMG/M
3300029952|Ga0311346_11401734All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4529Open in IMG/M
3300030659|Ga0316363_10295122All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300030706|Ga0310039_10254436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4676Open in IMG/M
3300031128|Ga0170823_10403476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4515Open in IMG/M
3300031231|Ga0170824_110755668All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4531Open in IMG/M
3300031232|Ga0302323_103339835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4511Open in IMG/M
3300031469|Ga0170819_16172862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4568Open in IMG/M
3300031524|Ga0302320_10003181All Organisms → cellular organisms → Bacteria38336Open in IMG/M
3300031726|Ga0302321_102557892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4596Open in IMG/M
3300032160|Ga0311301_11388165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4878Open in IMG/M
3300032770|Ga0335085_10210359All Organisms → cellular organisms → Bacteria → Proteobacteria2373Open in IMG/M
3300032770|Ga0335085_12187881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4556Open in IMG/M
3300032783|Ga0335079_10195386All Organisms → cellular organisms → Bacteria2247Open in IMG/M
3300032783|Ga0335079_10195386All Organisms → cellular organisms → Bacteria2247Open in IMG/M
3300032805|Ga0335078_10026936All Organisms → cellular organisms → Bacteria → Proteobacteria8526Open in IMG/M
3300032892|Ga0335081_11484668All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4752Open in IMG/M
3300033158|Ga0335077_11639454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4610Open in IMG/M
3300033402|Ga0326728_10286945All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300033402|Ga0326728_10612717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4844Open in IMG/M
3300033402|Ga0326728_10616829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4840Open in IMG/M
3300033405|Ga0326727_11111173All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4561Open in IMG/M
3300033818|Ga0334804_181412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4510Open in IMG/M
3300033982|Ga0371487_0444892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4553Open in IMG/M
3300034091|Ga0326724_0181093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41271Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland23.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil12.30%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog8.20%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.74%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.74%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.92%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.10%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.10%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.28%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.46%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.46%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil2.46%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil2.46%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.64%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.64%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.82%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.82%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.82%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.82%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.82%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.82%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.82%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300004478Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026273Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028566Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_064899002170459010Grass SoilCSLCHTTRAVEAAQTGPHGLSQKSSDLSAIPLCEKHHRTGDDAYHKLGRRKFAEVHQLNILAIVARLSAKPSIRVESGAFVGRFGDQEYELGSTHAGLARAIRRMSQLRREIQTEMA
Ga0068972_137575713300004478Peatlands SoilEDSYHKLGPRKFSEVHGLNIPAMVARLSAKPCIRVESGAFVGRFGDQEYELGSTEAGLARAIRRMSTIRREIQAKVA*
Ga0070683_10202513713300005329Corn RhizosphereRWVEAAHTGPHGLGQKSSDLSAIPLCVKHHRAGNDSYHSLGPRKFAEVHQLNVRAIVARLNSKPSIRVESGIFVGLLGGQQYELGSTEAGLARAIRRMSALRREAHADVT*
Ga0068863_10151039713300005841Switchgrass RhizosphereHRTGADSYHRLGPRRFAEVHQLNTSTIVARLSAKPSIRVESGSFVGFVGNQEYMLGSTKGGIARAIHKMSELRREIQAGA*
Ga0066795_1016227813300005938SoilMPRTLPCSVCRTTRMIEAAHTGPHGLSQKSSDLSAIPLCARHHRTGDDSYHKLGPRKFAEVHQVSVRAIVARLSAKPWIHVESGAFVGRVGDQEYALGSTDAGVARAIRRMSELRREWEPEVA*
Ga0066789_1028924113300005994SoilHKLGPRKFAEAHRLNIGAIVARLSAKPSIRVESGTFVGRFADQEYELGTTAAGLVPAIRRMRELRRAIQTEMA*
Ga0066793_1001303633300009029Prmafrost SoilMIEAAHTGPHGLSQKSSDLSAIPLCARHHRTGDDSYHKLGPRKFAAVHQLNVRAIIARLSARPCIRVESGTFVGRFGDQEYALGSTEARLARAIRRMSELRRAIQAEVA*
Ga0066793_1008541043300009029Prmafrost SoilVCLTTCRIEAAHTGPHGLSQKSSDLSAIPLCARHHRTGDDSYHKLGPRKFAEVHQVSVRAIVARLSAKPWIHVESGAFVGRVGDQEYALGSTDAGVARAIRRMSELRREWEAEVA*
Ga0066793_1025567813300009029Prmafrost SoilLPCSVCHTARAVEAAHTGPHGLSQKSSDLSAIPLCARHHRTGYDSYHKLGPRKFAEVHQLNIRAIVSRLSAKPFIRVEMGGFVGRFGDQEYALGSTEAGVARAIRRMSELRREMQAEVA*
Ga0105242_1220059523300009176Miscanthus RhizosphereVCRTTRGVEAAHTGPHGLSQKSSDLCAIPLCVKHHRTGNDSYHKLGPRNFADVHQVNIRAIVARLSAKPFIYVQSGTFVGRVGDQEYELGSTHVDWLMSELRREIQEVA*
Ga0116225_129872113300009524Peatlands SoilVCRTTRAVEAAHTGPRGLSQKSSDLCAIPLCARHHRTGKDSYHKLGHRKFSEVHHLDLARLSAKPRIRVESGAFVGRLGDQEYELGTTEAGLARAIRRMSALRRESQAKVA*
Ga0116220_1020374623300009525Peatlands SoilTGEDSYHKLGPRKFSEVHGLNIPAMVARLSAKPCIRVESGAFVGRFGDQEYELGSTEAGLARAIRRMSALRREIQAKVA*
Ga0105237_1135155923300009545Corn RhizosphereCRTTRGVEAAHTGPHGLSQKSSDWSAIPLCARHHRTGIDSYHKLGPRKFSEVHRLNIPAMVTRLSAKPLIRVESGTFVGWCGDQEYELGSTEAGLARAIRRMNNLWREIQSEVA*
Ga0116114_100687583300009630PeatlandVVCRTTYAVEAAHTGPHGLGQKSSDLSAIPLCGRHHRTGDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRAESGAFVGRFGDQEYELGPTQAGLARAIRRMSQLRREMETEVA*
Ga0116110_100502413300009643PeatlandVNSFGSCRKGSSEAIGPHGLGQKSSDLSAIPLCGRHHRTGDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRAESGAFVGRFGDQEYELGPTQAGLARAIRRMSQLRREMETEVA*
Ga0116106_1004339133300009645PeatlandRSLPCAVCRTTYAVEAAHTGPHGLGQKSSDLSAIPLCGKHHRTADDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGSTEAGLARAIRRMSQLRREMETEVA*
Ga0116223_1021837523300009839Peatlands SoilVRASQKSSECAIPLCARHHRTGQDSYHKLGPRKFSEVHHLDLAAIVARLSAKPRIRVESGAFVGRFGDQEYELGTTEAGLARAIRRMSALRREIQEKVA*
Ga0116223_1038887523300009839Peatlands SoilVCRATRAVEAAHTGPHGLGQKASDLSAIPLCRRHHRTGDDSYHRLGPRKFAEVHQLNIRALVARLSAKPFIRVESGAFIGRFGDQEYELGSTEAGLARAIRKMSQLRQEIQAEVA*
Ga0126381_10050215333300010376Tropical Forest SoilLPCSVCRTTRTIEAAHTGPHGLSQKSSDLSAIPLCARHHRCGDDSYHRLGPRRFAEVHHLDIPAMVTRLSAKPHIRVERGTFVGRLADQDYELGPTKAGVARAIRRMNALRRETVAGAA*
Ga0136449_10004140593300010379Peatlands SoilVCRATRAVEAAHTGPHGLGQKASDLSAIPLCRRHHRTGDDSYHRLGPRKFAEVHQLNIRALVARLSAKPFIRVESGAFIGRFGDQEYELGSTEAGLARAIHKMSQLRQEIQAEVA*
Ga0136449_10079585233300010379Peatlands SoilVCRTTRAVEAAHTGPRGLSQKSSDLCAIPLCARHHRTGDDSYHKLGPRKFSEVHHLDLAAIVARLSAKPRIRVESGAFVGRFGDQEYELGTTEAGLARAIRRMSALRREIQEKVA*
Ga0136449_10166064913300010379Peatlands SoilVCRTTRSVEAAHTGPHGLSQKSSDLSAIPLCARHHRTAKDSYHKLGPRKFSEAHQVNIPAIVARLSAKPFIRVESGAFVGRLGDHEYDLGPTQAGLPRAIRRMSELRREMLAEVA*
Ga0136449_10198916723300010379Peatlands SoilHRTGDDSYHKLGPRKFSEVHRLNIPAIVARLSAKPFIRVESGVFVGRFGDQEYELGPTEAGLGRAIRRMTELRREVQPEVA*
Ga0150984_12243989613300012469Avena Fatua RhizosphereSDLSAIPLCARHHRTGNDSYHKLGPAKFAEVHRLCSREIATRLSGKSRIRVESGSFVGRFGDEDYRLGSVGSGVAQAIRRMSEFRRDSELK*
Ga0164302_1162504813300012961SoilVEAAHTGPHGLGQKSSDLCAIPLCVRHHRTGDESYHKLGPQKFAEVHQLNILTIVARLSVKPLIRVESGTFVGRFGGQEYELGSTEAGVAQAILRVRELRKEIQAEVA*
Ga0181533_103532443300014152BogAVEAAHTGPHGLSQKSSDLSAIPLCGRHHRTGDDSYHRLGPWKFAAVHELNIRAMVARLSGKACIRVETGSFVGRFEDREYELGSTEAGLARAIGKMRQLRREMEAKVA*
Ga0181529_1036236123300014161BogYAVEAAHTGPHGLGQKSSDLSAIPLCGRHHRTGDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGSTEAGLARAIRRMSQLRREMETEVA*
Ga0181535_1084446113300014199BogLCARHHRTGDDSYHRLGPRRFAEVHQVNVQAIVARLSAKPYIRVESGVFVGRFAGEEYDLGPTEAGLARAIRRMSQLRREREAAAA*
Ga0181526_1034472223300014200BogVEVAHTGPRGLSQKSSDTSAIPLCARHHRTGEDAYHKLGPRKFSEVHALDIPALVARLSAKPFIRVESGAFVGSLFGEEYLLGTTQIGIACAVRKMTEIRREMLMEVA*
Ga0182014_1008410843300014491BogVKHHRTGDDSYHRLGPRRFAEVHHLNIRAIVARLSGKPFIRVEAGSFVGRLGDQEYHLGFTEAGLARAISRMSQLRREREAEAA*
Ga0182014_1010998113300014491BogHGLGQKSSDLSAIPLCGKHHRTADDSYHRLGPRRFAEAHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPAEAGLARAIRRMSQLRREIETEVA*
Ga0182014_1030115223300014491BogLTPDTGDDSYHKLGPGKFAEVHRLNVRAVVARLSAKAIIRVESGSFVGRLGDQEYELGSTEAGVARAIRRMSELRREMEADAA*
Ga0182014_1063139813300014491BogAAHTGPHGLGQKSSDLSAIPLCGKHHRTGDDSYHRLGPRRFAEAHDLDIRATVARLSEKPFIRVESGTFVGRFGDQEYELGPTEAGLARAIRRMRQLRREMETEVA*
Ga0182013_1013567033300014492BogLTPDTGDDSYHKLGPGKFAEVHRLNVRAVVARLSAKAIIRVESGSFVGRLGDQEYELGSTEAGVARAIRRMSELRREMEAEAA*
Ga0182013_1025089023300014492BogMLPCSVCRTTRTVEAAHTGPHGLGQKSSDLSAIPLCARHHRIGDDSYHKLGPGKFAEVHRLNVRTVVARLSEKAIIRVESGSFVGRLGDREYELGSTEAGVARAIRRMSELRREMEAEAA
Ga0182017_1019409543300014494FenEAAHTGPHGLSQKSSDLSAIPLCGKHHRTGDDSYHKLGSRKFAEAHQLNIRAIAARLSAKPSIRVESGSFVGRLGDREYELGSTEGGVAQAIRRMSEIRREVEVEAA*
Ga0182015_1072359113300014495PalsaPTSAHFPARCAARRVRSRLHTGPHGISQKSSDLSAIPLCARHRRTGDDSYHKLGPRRFAEVHQVDVQAIVARLSAKPFIRVESGVFVGRLGGEGYDLGSTEAGLVRAIRRMSQLRREREAAAA*
Ga0182011_1047370623300014496FenRPDAPREIAGRRYRTTGKHHRTGDDSYHRLGPRRFAEAHQLDIQATVARLSEKPFIRVESGAFVGRYGDQEYVLGSTGAGLARAIRKMSQLRRELETEVA*
Ga0182030_1042935723300014838BogYTRLREWGHRLGPRRFAEVHQLDIRATVARLSEKPFIRVESGAFVGRFGDQEYELGPTEAGLVRAIRRMSQLRREMETEVA*
Ga0182030_1145025413300014838BogAPREIAGRRYRTTGKHHRTGDDSYHRLGPRRFAEAHQLDIQATVARLSEKPFIRVESGAFVGRYGDQEYVLGSTGAGLARAIRKMSQLRRELETEVA*
Ga0182030_1149361013300014838BogTYAVEAAHTGPHGLGQKSSDLSAIPLCGKHHRTGDDSYHKLGPRRFAEAHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPTEAGLARAIRRMRQLRREMETEVA*
Ga0182030_1152363813300014838BogAPREIAGRRYRTTGKHHRTGDDSYHRLGPRRFAEAHQLDIRATVARLSEKPFIRVESGAFVGRFGDQEYELGPTEADLARAIRRMSQPRREMETEVA*
Ga0182027_1075572033300014839FenSDLSAIPLCGKHHRTGDDSYHKLGPRKFAEVHRLNIRMIAARLSAKPSIRVESGSFVGRLRDREYELGRTEGGVARAIRRMSEIRREVEVEAA*
Ga0182027_1199328613300014839FenVEAAHTGPRGLSQKSSDLCAIPLCARHHRTGDDSYHKLGPRKFSEVHHLDLPAIVARLSAKPRIRVESGIFVGRFGDQEYELESTEAGLARAIRRMSAIRREIQAKVA*
Ga0163161_1142801613300017792Switchgrass RhizosphereMPLCERHHRTGNDSYHKLGPRRFAKVHQLNIQVIVARLSAKPRIRVASGSFVARVDNQEYVLGSTEAGVAQAIRKMSQLRQEIQTEMA
Ga0187856_134095213300017925PeatlandLPSIPGRTVWAKSHPICRPFLCAEGTTRTGDDSYHKLGPRKFAEVHQLNIREIMARLSARPFIRVESAACVGRFGDQEYELGPTEAGLARAIRRMSQLRREMETEEVA
Ga0187877_113131323300017931PeatlandGRHHRTGDDSYHRLGPRKFAEVHQLDIRATVARLIEKPFIRVESGAFVGRFGDQEYELGPTEAGLARAIRRMSQLRREMETEEVA
Ga0187803_1029010323300017934Freshwater SedimentCRTTRAVEAAHTGPHGLSQKSSDRSAIPLCARHHRIGDDSYHKLGPRKFSEVHSLNIPAIVTRLTAKPCIRVESGAFVGRFGDQEYDLGSTEAGLARAIRRMGALRREVQAKVA
Ga0187781_1009060523300017972Tropical PeatlandMPLCERHHRTGPDSNHKLGPRKFAKAHVLNVPAVVARLSAKPSIRVEAGRFVGRLHDQEYTLGTIQAGVARAIRTMSALRREMLAEVA
Ga0187781_1089281823300017972Tropical PeatlandLCARHHRTGPDSYHKLGPRKFAEAHQLSIPAIVARLTAKPSIRVEAGRFVGRLHDQEYMLGTTQAGVARAIRTMSALRREVLAELA
Ga0181520_1015497313300017988BogAIPRCGEHHRSGHGSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPTEAGLARAIRRMSQLRREMETEVA
Ga0187868_100711013300018002PeatlandPLCGRHHRTGDDSYHKLGPRKFAAVHQLNIRAIVARLSAKPSIRVESGAFVGRFGDQEYELGPTEAGVARAIRRMSQLRREMETEDVA
Ga0187868_113111233300018002PeatlandHPLSSQSNGDATGTGDRQHYAPHGLSQKSSDLSAIPLCGRHHRTGDDSYHRLGPRKFAEVHQLNIRAIVTRLSARPFIRVESGIFVGRFVDQEYELGPTEAGLARAIRRMSQLRREMEAEVA
Ga0187888_133390623300018008PeatlandGLGQKSSDLSAIPLCGKHHRTGDDSYHRLGPRRFAEAHQLDIRATVARLSEKPFIRVESGAFVGRFGDQEYELGPTGAGLARAIRRMSQLRREMETEVA
Ga0187860_109268813300018014PeatlandDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRAESGAFVGRFGDQEYELGPTQAGLARAIRRMSQLRREMETEVA
Ga0187864_1025749023300018022PeatlandRAVEAAHTGPHGLSQKSSDLCAIPLCGRHHRTGDDSYHRLGPRKFAEVHQLDIRATVARLIEKPFIRVESGAFVGRFGDQEYELGPTEAGLARAIRRMSQLRREMETEEVA
Ga0187885_1003349483300018025PeatlandCAEGTTRTGDDSYHKLGPRKFAEVHQLNIRAIMARLSARPFIRVESAACVGRFGDQEYELGPTEAGLARAIRRMSQLRREMETEEVA
Ga0187869_10012424123300018030PeatlandRHHRTGDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRAESGAFVGRFGDQEYELGPTQAGLARAIRRMSQLRREMETEVA
Ga0187869_1060510313300018030PeatlandRTMRDVEAAHTDPHGLSQESSDLSAIPLCGRHHRTGDDSYHKLGPRKFAAVHQLNLRAIVARLSGKPFIRVEGGSFIGRVGDQEYQLGSTATGLAWAIRRMSQLRREREAEAA
Ga0187867_1010201713300018033PeatlandHHRTGDDSYHRLGPRRFAEVHQLDIRATVARLSEKPFIRVESGAFVGRFGDQEYELGPTAAGLARAIRRMSQLRREMESEVA
Ga0187867_1010963813300018033PeatlandQKSSDLSAIPLCGKHHRTGDDSYHRLGPRRFAEAHQLDIRATVARLSEKPFIRVESGAFVGRFGDQEYELGPTGAGLARAIRRMSQLRREMETEVA
Ga0187875_1006115653300018035PeatlandKSSDLSAIPLCGKHHRTGDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPTKAGLAGAIRRMSQLRREMETEVA
Ga0187875_1032777133300018035PeatlandGKHHRTADDSYHRLGPRRFAEVHDLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPAEAGLARAIRRMSQLRREIETEVA
Ga0187875_1036723413300018035PeatlandGDDSYHRLGPRKFAEMHGLNIRAIVGRLSGKTFIRVERGSFVGRFRDQEYQLGPTEAGLARAIGRMSQLRREMEVKAA
Ga0187883_1008855243300018037PeatlandLSAIPLCGKHHRTADDSYHRLGPRRFAEVHDLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPAEAGLARAIRRMSQLRREIETEVA
Ga0187883_1025311713300018037PeatlandIPLCGKHHRTADDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGTFVGRFGDQEYELGSTEAGLARAIRRMRQLRREMETEVA
Ga0187862_10018168133300018040PeatlandDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRAESGAFVGRFGDQEYELGPTQAGLARAIRRMSQLRREMETEVA
Ga0187871_1013505013300018042PeatlandKHHRTADDSYHRLGPRRFAEVHDLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPAEAGLARAIRRMSQLRREIETEVA
Ga0187871_1025012213300018042PeatlandRRYRTTGKHHRTGDDSYHRLGPRRFAEPHQLDIRATVARLSEKPFIRVESGAFVGRFGDQEYELGPTEADLARAIRRMSQPRREMETEVA
Ga0187871_1077251523300018042PeatlandDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEFELGPTGAGLARAIRRMSQLRREMETEVA
Ga0187887_1052889613300018043PeatlandGKHHRTGDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPTKAGLARAIRRMSQLRREMETEVA
Ga0187887_1089123713300018043PeatlandLPCAVCRTTYAVEAAHTGPHGLGQKSSDLSAIPLCGKHHRTRDDSYHRLGPRRFAEVHDLDIRAIVARLSEKPFIRVESGTFVGRFGDQEYELGPAEAGLARAIRRMRQLRREMETEVA
Ga0187890_1051831513300018044PeatlandTGPHGISQKSSDLSAIPLCARHHRTGNDSYHKLGPRRFAEVHQVDIATIAARLSAKPFIRVESGAFVGRFGGEEYDLGPTEAGLVLAIRRMRQLRREREAAAA
Ga0187890_1077309323300018044PeatlandLCGKHHRTRDDSYHRLGPRRFAEVHDLDIRAIVARLSEKPFIRVESGTFVGRFGDQEYELGPAEAGLARAIRRMRQLRREMETEVA
Ga0187890_1085863123300018044PeatlandDSYHRLGPRKFAEVHGLNIRAIVTRLSGKAFIWVEGGSFVGRFGDQEYSLGPTEAGLARAIGRISQLRREMEVKAA
Ga0187851_1009107513300018046PeatlandRTTYAVEAAHTGPHGLGQKSSDLSAIPLCGKHHRTGDDSYHRLGPRRFAEAHDLDIRAIVARLSEKPLIRVESGAFVGRFGEQEYQLGSTEAGLARAISRMSQLRREMETEVA
Ga0187858_1074138413300018057PeatlandHRTGDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGTFVGRFGDQEYELGSTEAGLARAIRRMRQLRREMETEVA
Ga0187765_1080622223300018060Tropical PeatlandSYHKLGPRKFAEAHRLNIPAVVARLSAKPSIRVEAGSFVGRLGDQEYELGTTAAGLARAIRRISTLRREILAEVA
Ga0187784_1007147713300018062Tropical PeatlandMPLCERHHRTGPDSNHKLGPRKFAKAHALNVPAVVARLSAKPSIRVEAGRFVGRLHDQEYTLGTIQAGVARAIRTMSALRREMLAEVA
Ga0187784_1007147733300018062Tropical PeatlandMSEKPPLILDSWRPPFRSVSAIPLCARHHRTGPASYHKLGPRKFAEAHQLNIQAVVARLSAKPSIRVKAGSFVGRLGDQECTLGTIQGGVARAIRTMSALRREMLAEVA
Ga0187784_1021798213300018062Tropical PeatlandMWMKAGSQSRIPDVDPDCSVRATRGGEAAHTGPHGLGQKSSDLSAIPLCARHHRTGPDSYHKLGPRKFAEAHRLNVSAIVARLRAKPLDPGGSGQVRGPVGRSGVPAGNHGAGLARAIRRMGVLRREILAEVA
Ga0187772_1130770323300018085Tropical PeatlandMSALPLCARHHRTGPDSYHKLGPRKFAEAHRLDILARVARLSAKPSIRVEAGSFVGRLGDQEYTLGTTEAGLAHAIRRMGVLRREILAE
Ga0066667_1177833323300018433Grasslands SoilRAVEAAHTGPRGLSQKSSDLSAIPLCVRHHRTGDDSYHKLGPRKFAEVHQLNIPAMVARLSAKLVIRVESGAFVGQFGDREYVLGTTGAGLARAIRRMRELRREIQAEVA
Ga0066662_1301342923300018468Grasslands SoilAVCGSLRNIESAHTGPRGLSQKAPDTSAIPLCARHHRTGNDAYHKLGPRRFSEVHGLDIPAIVARLSAKPFIRVESGSFVSRCGDQEIVLGPVRLGLARAIRKITAVRSEVAI
Ga0187852_144715213300019082PeatlandGKHHRTGDDSYHRLGPRRFAEPHQLDIRATVARLSEKPFIRVESGAFVGRFGDQEYELGPTEADLARAIRRMSQPRREMETEVA
Ga0213853_1107097513300021861WatershedsTGPHGISQKSSDLSAIPLCVRHHRTADDSYHRLGPRKFAEAHQLNIRAIVARLSVKPFIRVESGSFVGRFRDQEYALGSTEAGLARAIRKMSELRRELEDEAA
Ga0224554_110170713300023068SoilGRRYRTTGKHHRTGDDSYHRLGPRRFAEAHQLDIRATVARLSEKPFIRVESGAFVGRFGDQEYELGPTEADLARAIRRMSQPRREMETEVA
Ga0207662_1126439913300025918Switchgrass RhizosphereEAAHTGPHGLGQKSSDLSAIPLCARHHRIGDDSYHKLGPRKVEVVHRLNVPAIVARLSAKPWIRVESGRFVGRLGNREYTLGATEGGLASAIRRMSEFRREVQSDAA
Ga0209871_107872213300026217Permafrost SoilVEEELKVKPVSSPGYLEWIRTLPCSVCHRTRGVEAAHTGPHGLSHKSSDRCAIPLCVRHHRTGNDSYHKLGPRKFGEVHHLNIRVIVARLGTKPFIRVESGRFVGRFGDQEYDLGSTETGLDRAIRRMSAFRREREVDAA
Ga0209881_118672213300026273SoilSGDDSYHKLGPRRFAEVHHLNLRAIVARLSEKPLIRVELSRFVGRFGDQEHALGSTEAGLARAIRRMSELRRERETEAA
Ga0209517_10018090183300027854Peatlands SoilHRTGKDSYHKLGHRKFSEVHHLDLARLSAKPRIRVESGAFVGRLGDQEYELGTTEAGLARAIRRMSALRRESQAKVA
Ga0209517_1005048273300027854Peatlands SoilGRHHRTGDDSYHRLGPRRFAEEHELDIRAIVARLSEKPFIRVESGTFMGRFGDQEYQLGSTEAGLARAIRRMSQLRREMETEVA
Ga0209517_1065354023300027854Peatlands SoilRTGEDSYHKLGPRKFSEVHGLNIPAMVARLSAKPCIRVESGAFVGRFGDQEYELGSTEAGLARAIRRMSTIRREIQAKVA
Ga0209698_1128731413300027911WatershedsPDTCGGSGSLPCSVCHTVRTVEAAHTGTHGLSQKSSDLSAIPLCMKHHRTGDESYHMLGPRRFADVHQLNIPAIVARLSAKPFIRVESGSFVAQISDQECELGATDAGLARAIRKLSDTFGGKWRIKRPDALI
Ga0302147_1023016613300028566BogDLSAIPLCGKHHRTRDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGTFVGRFGDQEYELGSTEAGLARAIRRMRQLRREMETEVA
Ga0302201_1007628633300028785BogPTLQGLGIRPDAPREIAGRRYRTTGKHHRTGDDSYHRLGPRRFAEAHQLDIQATVARLSEKPFIRVESGAFVGRYGDQEYVLGSTGAGLARAIRKMSQLRRELETEVA
Ga0302155_1010494513300028874BogCRTTYAVEAAHTGPHGLGQKSSDLSAIPLCGKHHRTRDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGTFVGRFGDQEYELGSTEAGLARAIRRMRQLRREMETEVA
Ga0311363_1032038663300029922FenLSAIPLCGKHHRTRDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGTFVGRFGDQEYELGSTEAGLARAIRRMRQLRREMETEVA
Ga0311346_1140173413300029952BogSVEAAHTGPHGISQKSSDLSAIPLCAKHHRTGDDSYHKLGPRKFAEVHQVNVQAIVARLSAKPFIRVESGVFVGRFGEEEYALGPTEAGLARAVRRMSQVRRERETEVA
Ga0316363_1029512223300030659Peatlands SoilHRTGDDSYHKLGPRKFSEVHHLDLAAIVARLSAKPRIRVESGAFVGRFGDQEYELGTTEAGLARAIRRMSALRREIQEKVA
Ga0310039_1025443613300030706Peatlands SoilLSAIPLCRRHHRTRDDSYHRLGPRKFAEVHQLNIRALVARLSAKPFIRVESGAFIGRFGDQEYELGSTEAGLARAIRKMSQLRQEIQAEVA
Ga0170823_1040347613300031128Forest SoilRTLPCSVCRTTRAVEAAHTGPHGLSQKSSDLRAIPLCIRHHRTGDDSYHKLGPRKFAEVHQLNILAIVARFSAKPLIRVESGTFVGRFVDREYELGSTEAGVARAIRRMRELRREIQAEV
Ga0170824_11075566813300031231Forest SoilLQWIRTLPCSVCRTTRAVEAAHTGPHGLSQKSSDWSAIPLCEKHHRTGDDSYHRLGPRKFAEVHQLNIREIVARLSAKPWIRVESGAFVGRFGDQEYELGSTHAGLARAIRRISQLRREIQTEMA
Ga0302323_10333983513300031232FenLRSITFTGAPGTTGPGPSYHKLGPRKCSEVHRLNIPAIVARLSAKPCIRVESGVFVGRFGDQEYVLGSTDAGLVRAIRRMSELHREIQAEVA
Ga0170819_1617286213300031469Forest SoilSVCRTRRAVEAAHTGPHGLSQKSSDLCAIPLCERHHRTGNDSYHKLGPRRFAEVHQLNLAAIVARLSEKPRIRVDSGTFVGRFGDQEYELGSTEAGVARAIRRMRELRREIQAEVA
Ga0302320_1000318123300031524BogLSAIPLCAKHHRTGDDSYHKLGPRKFAEVHQVNVQAIVARLSAKPFIRVESGVFVGRFGEEEYALGPTEAGLARAVRRMSQVRRERETEVA
Ga0302321_10255789213300031726FenDDSYHKLGPRKFAEVHQLNIRAIVERLSARPSIRVESGIFVGRFADQEYQLGSTQAGLARAVRKMSDLRREREAEVA
Ga0311301_1138816513300032160Peatlands SoilSDWSAIPLCARHHRTGDDSYHKLGPRKFSEVHHLEIPAIVAHLNAKPCIRVESGAFVGRFGDQEYELGSTEAGLAWAIRRMSELRREVQTEVA
Ga0335085_1021035943300032770SoilQKSSDLSAIPLCAGHHRTGADSYHKLGPRKFAEVHRLNIAAIVTRLSAKPTIRVEAGNFVGRLGEQEYELGTTDAGLARAIRRIRALRREILADVA
Ga0335085_1218788113300032770SoilEAAHTGPHGLGQKSSDLSAIPLCARHHRTGADSYHKLGPRKFAEVHRLNIAAIVTRLSAKPTIRVEAGNFVGRSGDQEFKLGTTVAGLARAIRRIRALRREILAEVA
Ga0335079_1019538613300032783SoilVSQKSSDWSAVPLCARHHRTGDDSYHKLGPRKFSEVHHLNIPAIVARLSAKPFIRVEAGAFIGRFGNQEYELGSTEAGLARAIRRMSELRREVQADVA
Ga0335079_1019538653300032783SoilLSQKSSDWSAIPLCASHHRTGMDSYHKLGLREFSEVHHLNIPAVVARLSAKPFIRVESGAFVGRFGDQEYELGSTEGLARAIRRMSELRREIQTDVGNLPLRNVEPTSGLIPHCGIL
Ga0335078_1002693693300032805SoilRHHRTGDDSYHKLGPRKFAEVHQLNVRAIVARLSAKPVIRVESGVFVGRFGNQDYELGSTEAGLARAIRRMSQLRREMEAEEAA
Ga0335081_1148466813300032892SoilPHGLSQKSSDLSAIPLCGRHHRTGPDSYHKLGPRRFSEVHGLDVEGLVARLSAKPRIRVEGGAYVGWIGGEGYELGRTEAGLAGAIRRMRELRWEALSRAA
Ga0335077_1163945413300033158SoilFVRHSPVCQAPPRGGDSYHRLGPRKFSEVHHLNIPAIVARLSAKPIIRVESGVFVGRFGDLEYELGSTEAGLARAIRRMSELRREIQADVVNLALRNGEPTCGLIPHCGIL
Ga0326728_1028694533300033402Peat SoilLSQKSSDLCAIPLCAGHHRTGEDSYHKLGPRKFSEVHHLDLPAIVARLSAKPCIRVESGIFVGRFGDQEYELGTTEAGLARAIRRMSAIRREIQAKVA
Ga0326728_1061271723300033402Peat SoilTTYAVEAAHTGPHGLGQKSSDLSAIPLCGKHHRTGDDSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGAFVGRLGDQEFGLGPTEAGLARAIRRMSQLRREMETEVA
Ga0326728_1061682913300033402Peat SoilDLSVIPLCARHHRTGDDSYHKLGPRKFSEVHHLDIPAIIARLSAKPRIRVESGAFVGRLGGQEYELGTTEAGLAWAIRRMSAIRREIQAKVA
Ga0326727_1111117313300033405Peat SoilAIPLCARHHRTGDDSYHKLGPRKFSEVHHLDLPSMVARLSAKPRIRVESGTFVGRFGDQEYELGSTEAGLARAIRRASELRREVQAEVA
Ga0334804_181412_2_3283300033818SoilRSRLHTGPHGISQKSSDLSAIPLCARHRRTGDDSYHKLGPRRFAEVHQVNVQAIVARLSAKPFIRVESGVFVGRLGGEGYDLGSTEAGLVRAIRRMSQLRREREAAAA
Ga0371487_0444892_175_4713300033982Peat SoilLSQKSSDLCAIPLCAGHHRTGEDSYHKLGPRKFSEVHHLDIPAIIARLSAKPRIRVESGAFVGRLGGQEYELGTTEAGLAWAIRRMSAIRREIQAKVA
Ga0326724_0181093_691_9873300034091Peat SoilLSQKSSDLCAIPLCAGHHRTGEDSYHKLGPRKFSEVHHLDLPTIVARLSAKPCIRVESGIFVGRFGDQEYELGTTEAGLARAIRRMSAIRREIQAKVA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.