Basic Information | |
---|---|
Family ID | F071770 |
Family Type | Metagenome |
Number of Sequences | 122 |
Average Sequence Length | 45 residues |
Representative Sequence | KRNKLRARIAAAPATGRAALEAKVQRTYSPSHSMMKEKLPPAVV |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.82 % |
% of genes near scaffold ends (potentially truncated) | 95.08 % |
% of genes from short scaffolds (< 2000 bps) | 91.80 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.951 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (9.836 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.623 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.639 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF13360 | PQQ_2 | 6.56 |
PF13709 | DUF4159 | 3.28 |
PF00069 | Pkinase | 3.28 |
PF01979 | Amidohydro_1 | 2.46 |
PF03781 | FGE-sulfatase | 2.46 |
PF00692 | dUTPase | 2.46 |
PF00106 | adh_short | 1.64 |
PF03551 | PadR | 1.64 |
PF09180 | ProRS-C_1 | 1.64 |
PF00144 | Beta-lactamase | 1.64 |
PF06172 | Cupin_5 | 1.64 |
PF07690 | MFS_1 | 1.64 |
PF00575 | S1 | 1.64 |
PF12121 | DD_K | 0.82 |
PF00072 | Response_reg | 0.82 |
PF13564 | DoxX_2 | 0.82 |
PF01436 | NHL | 0.82 |
PF13376 | OmdA | 0.82 |
PF00583 | Acetyltransf_1 | 0.82 |
PF13493 | DUF4118 | 0.82 |
PF06983 | 3-dmu-9_3-mt | 0.82 |
PF00486 | Trans_reg_C | 0.82 |
PF13826 | DUF4188 | 0.82 |
PF13466 | STAS_2 | 0.82 |
PF13860 | FlgD_ig | 0.82 |
PF06057 | VirJ | 0.82 |
PF12779 | WXXGXW | 0.82 |
PF13460 | NAD_binding_10 | 0.82 |
PF13000 | Acatn | 0.82 |
PF07676 | PD40 | 0.82 |
PF14534 | DUF4440 | 0.82 |
PF07853 | DUF1648 | 0.82 |
PF00529 | CusB_dom_1 | 0.82 |
PF13649 | Methyltransf_25 | 0.82 |
PF13290 | CHB_HEX_C_1 | 0.82 |
PF08241 | Methyltransf_11 | 0.82 |
PF07883 | Cupin_2 | 0.82 |
PF13557 | Phenol_MetA_deg | 0.82 |
PF13365 | Trypsin_2 | 0.82 |
PF01263 | Aldose_epim | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 13.11 |
COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 2.46 |
COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 2.46 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 2.46 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.64 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.64 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.64 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.64 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.64 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.64 |
COG3542 | Predicted sugar epimerase, cupin superfamily | General function prediction only [R] | 1.64 |
COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.64 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.82 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.82 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.82 |
COG3946 | Type IV secretory pathway, VirJ component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.82 |
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.95 % |
Unclassified | root | N/A | 27.05 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664021|ICCgaii200_c0331514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300000891|JGI10214J12806_11154079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
3300000956|JGI10216J12902_100478837 | Not Available | 922 | Open in IMG/M |
3300000956|JGI10216J12902_105954769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2790 | Open in IMG/M |
3300000956|JGI10216J12902_113111190 | Not Available | 2355 | Open in IMG/M |
3300001431|F14TB_100685667 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300004114|Ga0062593_101179383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
3300004156|Ga0062589_101057364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300004479|Ga0062595_100431171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 959 | Open in IMG/M |
3300004479|Ga0062595_101319522 | Not Available | 651 | Open in IMG/M |
3300004643|Ga0062591_100354466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1188 | Open in IMG/M |
3300005169|Ga0066810_10184083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 517 | Open in IMG/M |
3300005290|Ga0065712_10153392 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300005330|Ga0070690_100108850 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
3300005331|Ga0070670_101322133 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300005331|Ga0070670_101331637 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300005339|Ga0070660_100781661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
3300005354|Ga0070675_102171499 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300005355|Ga0070671_101366193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300005364|Ga0070673_100121564 | All Organisms → cellular organisms → Bacteria | 2179 | Open in IMG/M |
3300005366|Ga0070659_101499769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 601 | Open in IMG/M |
3300005436|Ga0070713_101408439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300005444|Ga0070694_100508300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
3300005445|Ga0070708_100755176 | Not Available | 915 | Open in IMG/M |
3300005457|Ga0070662_101359123 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300005458|Ga0070681_11046091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300005467|Ga0070706_101915203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Amphritea → Amphritea balenae | 538 | Open in IMG/M |
3300005526|Ga0073909_10186292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
3300005539|Ga0068853_101024527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
3300005543|Ga0070672_100824359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 817 | Open in IMG/M |
3300005544|Ga0070686_100497460 | Not Available | 945 | Open in IMG/M |
3300005546|Ga0070696_100796024 | Not Available | 778 | Open in IMG/M |
3300005564|Ga0070664_100764162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
3300005564|Ga0070664_101897819 | Not Available | 565 | Open in IMG/M |
3300005616|Ga0068852_101816620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300005617|Ga0068859_102308856 | Not Available | 593 | Open in IMG/M |
3300005719|Ga0068861_100675986 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300005719|Ga0068861_101973230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Pseudogulbenkiania → unclassified Pseudogulbenkiania → Pseudogulbenkiania sp. NH8B | 582 | Open in IMG/M |
3300006049|Ga0075417_10423934 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300006845|Ga0075421_101999110 | Not Available | 618 | Open in IMG/M |
3300006876|Ga0079217_11635113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300006894|Ga0079215_11215253 | Not Available | 575 | Open in IMG/M |
3300006969|Ga0075419_10766032 | Not Available | 688 | Open in IMG/M |
3300007004|Ga0079218_12498524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37 | 610 | Open in IMG/M |
3300009148|Ga0105243_11090272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 806 | Open in IMG/M |
3300009162|Ga0075423_11696644 | Not Available | 680 | Open in IMG/M |
3300009609|Ga0105347_1114085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
3300010037|Ga0126304_10096228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis | 1866 | Open in IMG/M |
3300010040|Ga0126308_11131288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
3300010045|Ga0126311_11816130 | Not Available | 517 | Open in IMG/M |
3300010373|Ga0134128_12819413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300010397|Ga0134124_10479072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1200 | Open in IMG/M |
3300010401|Ga0134121_11034683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 809 | Open in IMG/M |
3300011424|Ga0137439_1171750 | Not Available | 513 | Open in IMG/M |
3300012166|Ga0137350_1105679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300012232|Ga0137435_1256056 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 531 | Open in IMG/M |
3300012469|Ga0150984_104722583 | Not Available | 507 | Open in IMG/M |
3300012469|Ga0150984_110772454 | Not Available | 591 | Open in IMG/M |
3300012469|Ga0150984_111292727 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300012906|Ga0157295_10120856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
3300012955|Ga0164298_11307872 | Not Available | 556 | Open in IMG/M |
3300012960|Ga0164301_10908446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 684 | Open in IMG/M |
3300013306|Ga0163162_10569157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Parvularcula | 1260 | Open in IMG/M |
3300013306|Ga0163162_12376336 | Not Available | 609 | Open in IMG/M |
3300014325|Ga0163163_12407551 | Not Available | 585 | Open in IMG/M |
3300015200|Ga0173480_10006712 | All Organisms → cellular organisms → Bacteria | 4552 | Open in IMG/M |
3300015200|Ga0173480_10155127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
3300015357|Ga0134072_10293721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300015372|Ga0132256_100652831 | Not Available | 1167 | Open in IMG/M |
3300015372|Ga0132256_103021288 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300015372|Ga0132256_103283081 | Not Available | 544 | Open in IMG/M |
3300015373|Ga0132257_100100517 | All Organisms → cellular organisms → Bacteria | 3328 | Open in IMG/M |
3300015373|Ga0132257_100229208 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
3300015373|Ga0132257_100924385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
3300018067|Ga0184611_1169994 | Not Available | 774 | Open in IMG/M |
3300018068|Ga0184636_1300631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300018422|Ga0190265_13422661 | Not Available | 529 | Open in IMG/M |
3300018469|Ga0190270_10855388 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300018481|Ga0190271_13099839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300020016|Ga0193696_1069366 | Not Available | 919 | Open in IMG/M |
3300022756|Ga0222622_10048754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2379 | Open in IMG/M |
3300022886|Ga0247746_1147581 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300025315|Ga0207697_10275820 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300025907|Ga0207645_10223373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
3300025920|Ga0207649_10049488 | Not Available | 2596 | Open in IMG/M |
3300025925|Ga0207650_10665321 | Not Available | 878 | Open in IMG/M |
3300025925|Ga0207650_11038383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Parvularcula | 697 | Open in IMG/M |
3300025926|Ga0207659_10103772 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
3300025926|Ga0207659_10388484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Parvularcula | 1165 | Open in IMG/M |
3300025926|Ga0207659_10848242 | Not Available | 785 | Open in IMG/M |
3300025933|Ga0207706_10252435 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
3300025933|Ga0207706_11219842 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300025937|Ga0207669_10731559 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300025940|Ga0207691_11512322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Parvularcula | 548 | Open in IMG/M |
3300025941|Ga0207711_10610111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
3300025972|Ga0207668_10400521 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300025981|Ga0207640_11091751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 705 | Open in IMG/M |
3300026078|Ga0207702_11317703 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300026121|Ga0207683_10723388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
3300026142|Ga0207698_11743664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300027639|Ga0209387_1169786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300027787|Ga0209074_10433632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300027886|Ga0209486_10079727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1700 | Open in IMG/M |
3300028802|Ga0307503_10228857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
3300029923|Ga0311347_10899742 | Not Available | 538 | Open in IMG/M |
3300031547|Ga0310887_11055161 | Not Available | 520 | Open in IMG/M |
3300031716|Ga0310813_11250124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
3300031740|Ga0307468_101832734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300031854|Ga0310904_10236344 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300031908|Ga0310900_11096795 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300031908|Ga0310900_11902643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 507 | Open in IMG/M |
3300032003|Ga0310897_10158301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
3300032003|Ga0310897_10312945 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300032003|Ga0310897_10542113 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300032013|Ga0310906_10280121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
3300032017|Ga0310899_10137860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1028 | Open in IMG/M |
3300032017|Ga0310899_10188788 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300032075|Ga0310890_10702161 | Not Available | 792 | Open in IMG/M |
3300032179|Ga0310889_10026272 | Not Available | 2089 | Open in IMG/M |
3300032180|Ga0307471_102674545 | Not Available | 633 | Open in IMG/M |
3300032180|Ga0307471_103095722 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300033408|Ga0316605_11709494 | Not Available | 612 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.02% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 6.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.10% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.10% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.28% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.28% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.46% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.46% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.46% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.46% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.46% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.46% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.64% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.64% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.82% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.82% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.82% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
3300012166 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2 | Environmental | Open in IMG/M |
3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICCgaii200_03315141 | 2228664021 | Soil | HRTKKRNKLRARIAAAPASGRAALEAKLQRTYSPFHTMTKEKLPPAPD |
JGI10214J12806_111540792 | 3300000891 | Soil | NKLRARIAAAPATGRAALEAKVQRTYSPFHSMMKATLPPAVG* |
JGI10216J12902_1004788373 | 3300000956 | Soil | RIAAAPAAGRAALEAKVQRTYSSSHSMMKEKPPPEVV* |
JGI10216J12902_1059547694 | 3300000956 | Soil | VAKREKLRARIAAAPTGRAAFEAKLLRTYSPFHTMTKEKLPPTVV* |
JGI10216J12902_1131111904 | 3300000956 | Soil | KKRDKLRARIAAAPATERAALEARVQRTYSPFHSVMKQKLP* |
F14TB_1006856671 | 3300001431 | Soil | ARIAAAPAAGRAALEARVQRTYSPFHPLTKEKPPPPVV* |
Ga0062593_1011793831 | 3300004114 | Soil | KKRNKLRARIAAAPATGRAELEAKLQRTYSPFHSMMKEKLPPVVV* |
Ga0062589_1010573641 | 3300004156 | Soil | QHRAKKRNKLRARIAAAPATGRAELEAKLQRTYSPFHSMMKEKLPPVVV* |
Ga0062595_1004311712 | 3300004479 | Soil | KLRARIAAAPATGRAALEAKVQRTYSAFHSKTKEKLPPAVV* |
Ga0062595_1013195221 | 3300004479 | Soil | QHRAKKRNKLRARIAAAPANGRAALEARVLRTYSPFHSVMKEKLP* |
Ga0062591_1003544661 | 3300004643 | Soil | KRNKLRARIAAAPASGRAALEAKLQRTYSPFHTMTKEKLPPAPD* |
Ga0066810_101840831 | 3300005169 | Soil | KLRARIAAAPATGRAALEAKVQRTYSPSHSMMKEKLPPAVV* |
Ga0065712_101533921 | 3300005290 | Miscanthus Rhizosphere | VKKRNKLRARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV* |
Ga0070690_1001088503 | 3300005330 | Switchgrass Rhizosphere | QHRAKKRNKLRARIAAAPATGRAALEIKVQRTYSPFHSTMKEKLPTEVVSPAE* |
Ga0070670_1013221332 | 3300005331 | Switchgrass Rhizosphere | RQHRAKKRNKLRARIAAAPATGRAALEAKVQRTYSPSHRTMKEKPPPALV* |
Ga0070670_1013316372 | 3300005331 | Switchgrass Rhizosphere | LRQHRSKKRDKLRARIAAAPATGRAALEAKVQRTYSPFHTMKAKVPPAEA* |
Ga0070660_1007816612 | 3300005339 | Corn Rhizosphere | HLRQHRAKKRNKLRARIAAAPAAARAALEAKLQRTYSPLHTMTKE* |
Ga0070675_1021714992 | 3300005354 | Miscanthus Rhizosphere | QYRKAKRDKLRARIAAASVSATGRAAFEAKLQRTYSPFHMMMKEKLPPTVV* |
Ga0070671_1013661931 | 3300005355 | Switchgrass Rhizosphere | KKRNKLRARIAAAPATGRAALEIKVQRTYSPFHSTMKEKLPTEVVSPAE* |
Ga0070673_1001215643 | 3300005364 | Switchgrass Rhizosphere | RQHRAKKRHKLRARIAAAPTTGRAALETKVQRTYSAFHSIMKEKTPPAVV* |
Ga0070659_1014997691 | 3300005366 | Corn Rhizosphere | HRAKKRNKLRARIAAAPATGRAALEAKVQRTYSPFHSMKREKLPQAVV* |
Ga0070713_1014084392 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KKRNKLRARIAAAPATGRAALEAKVQRTYSPSHSMMREKLPPAVV* |
Ga0070694_1005083001 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | KKRNKLRARIAAAPATGRAALEAKVQRTYSLSHSMMREKLPPAVV* |
Ga0070708_1007551761 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RAKKRNKLRARIAAAPATGRAALEAKVQRTYSPSHRMMKEKLPPALV* |
Ga0070662_1013591232 | 3300005457 | Corn Rhizosphere | QHRVKKRNKLRARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV* |
Ga0070681_110460911 | 3300005458 | Corn Rhizosphere | KLRARIAAAPATGRAALEAKVQRTYSPSHSMMKEKLPPTVV* |
Ga0070706_1019152031 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RQHRVKKRNKLRARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV* |
Ga0073909_101862921 | 3300005526 | Surface Soil | LRARIAAAPAAGRAALEAKVQRTYSPFHRMTEEKLPPAVV* |
Ga0068853_1010245273 | 3300005539 | Corn Rhizosphere | HRAKKRAKLRARIAAAPAAGRAALEAKVEKAYSPFHSKMKEKPSPPEL* |
Ga0070672_1008243591 | 3300005543 | Miscanthus Rhizosphere | KKRNKLRARIAAAPATGRAALEARVLRTYSAFHSTREKLPPAPG* |
Ga0070686_1004974601 | 3300005544 | Switchgrass Rhizosphere | RAKKRNKLRARIAAAPAVAVAALEARVQRTYSPFHSMREKLPRAVL* |
Ga0070696_1007960241 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RQHRAKKRNKLRARIAAAPAAGRAALETKLQRTYSPSHSMKETLPPAVV* |
Ga0070664_1007641622 | 3300005564 | Corn Rhizosphere | HRAKKRNKLRARIAAAPATGRAALEAKLQRTYSPSHSMMKEKLPPTVV* |
Ga0070664_1018978191 | 3300005564 | Corn Rhizosphere | LRARIAAAPMVGRAALEAKVQRTYSAFHVPAKLKPPPAAV* |
Ga0068852_1018166201 | 3300005616 | Corn Rhizosphere | LRQHRAKKRNKLRARIAAAPATGRAALEARVQRTYSPFHSMREKLPGTVI* |
Ga0068859_1023088562 | 3300005617 | Switchgrass Rhizosphere | RNKLRARIAAAPAGGRAVLEAKVLKTYSAFHSLTKEKSTPEAV* |
Ga0068861_1006759861 | 3300005719 | Switchgrass Rhizosphere | LRARIAAAPATGRAALEAKLQRTYSPFHSMMKEKLPPAGV* |
Ga0068861_1019732302 | 3300005719 | Switchgrass Rhizosphere | QHRVKKRNKLRARIAAASPTGRAALEARVQRTYSPFHSMQREKLPQAVV* |
Ga0075417_104239341 | 3300006049 | Populus Rhizosphere | KRNKLRARIAASPSGRAAFEAKLQRTYSPFHSMMKEKLPPAVV* |
Ga0075421_1019991101 | 3300006845 | Populus Rhizosphere | KLRARIAAAPASGRAALEAKVQRTYSRSHSMMKEKLPPAVV* |
Ga0079217_116351132 | 3300006876 | Agricultural Soil | KKRNKLRARIAAAPSTGRAALEAKVQRTYSPFHSVMKETLPPAVV* |
Ga0079215_112152531 | 3300006894 | Agricultural Soil | RQHRVAKRNKLRARIAAEPAGRAAFEAKLQRTYSPFHTMTKEKLPPTVV* |
Ga0075419_107660322 | 3300006969 | Populus Rhizosphere | LRARIAAAPATGRAALEAKVQRTYSSSHSMVKEKLPPAVA* |
Ga0079218_124985242 | 3300007004 | Agricultural Soil | RARIAAAPASGRAALEAKVQRTYSAFNSTSKEKQPPTTA* |
Ga0105243_110902721 | 3300009148 | Miscanthus Rhizosphere | LRQHRAKKRNKLRARIAAAPAAGRAALEAKVLRTYSSSHSVMKEKVPPTVL* |
Ga0075423_116966441 | 3300009162 | Populus Rhizosphere | KKRNKLRARIAAASATGRAVLEAKLQRTYSYSHSTTKKNLPPAVV* |
Ga0105347_11140852 | 3300009609 | Soil | VEKRNKLRARIAATPATGRAALEARLQRTYSPFHSMMKEKEKLPPVVA* |
Ga0126304_100962282 | 3300010037 | Serpentine Soil | VAKRHKLRARIAAAPAGRAAFEAKLQRTYSPFHTMLKEKLPPTVV* |
Ga0126308_111312881 | 3300010040 | Serpentine Soil | HRAKKRNKLRARIAAAPATGRAALELKVQRTYSPFHSMMKEKLPPAVV* |
Ga0126311_118161302 | 3300010045 | Serpentine Soil | VAKRNKLRARIAAAPAGRAAFEAKLQRTYSPFHTMLKE |
Ga0134128_128194131 | 3300010373 | Terrestrial Soil | LRARIAAAPAIGRAALEAKLQRTYSPFHTMTKEKLPPAPD* |
Ga0134124_104790723 | 3300010397 | Terrestrial Soil | RQHRAKKRDKLRARIAAAPTTGRAALEAKVQRTYSPSHSMMKEKLPPAVV* |
Ga0134121_110346831 | 3300010401 | Terrestrial Soil | RDKLRARIAAAPATVRAALEAKVQRTYSAFHSKTKEKLPPAVV* |
Ga0137439_11717501 | 3300011424 | Soil | KRNKLRARIAAAPAAGRATLEAKVLRTYSPFHSMMKEKLPRGVV* |
Ga0137350_11056791 | 3300012166 | Soil | KLRARIAAAPATGRAALEARLQRTYSPFHSMMKEKLPPTVV* |
Ga0137435_12560563 | 3300012232 | Soil | RQHRAKKRNKLRARIAAGPATGVAALEAKVLRTYSAFHSLMKEKQPPETV* |
Ga0150984_1047225832 | 3300012469 | Avena Fatua Rhizosphere | KRAKLRARIAAAPAAGRAALEARVQRTYSPFHVMRDELPKVAAK* |
Ga0150984_1107724541 | 3300012469 | Avena Fatua Rhizosphere | RQHRAKKRDKLRARIAAAPAIGRAALEAKMQRTYSPFHMKEKLPPTVV* |
Ga0150984_1112927271 | 3300012469 | Avena Fatua Rhizosphere | RNKLRARIAAAAPAARAALEARVLRTYSAFHTAQKEKQPPADA* |
Ga0157295_101208561 | 3300012906 | Soil | KLRARIAAAPAAGRAPLEARVLRTYSAFHREMKEKLTPAPVEP* |
Ga0164298_113078721 | 3300012955 | Soil | TKKRDKLRARIAASPLVGRAALEARVLRTYSPFHVPAKQKLPPVVV* |
Ga0164301_109084461 | 3300012960 | Soil | KRNKLRARIAAAPPTGRAALEARVQRTYSPFHSMKREKLPQAVV* |
Ga0163162_105691571 | 3300013306 | Switchgrass Rhizosphere | RNKLRARIAASPMVGRAALEAKVLRTYSTFHVPAKEKVPPVVA* |
Ga0163162_123763362 | 3300013306 | Switchgrass Rhizosphere | LRQHRVKKRNKLRARIAAAPPNGRAALEARVLRTYSPFHSMKEKLPRAG* |
Ga0163163_124075512 | 3300014325 | Switchgrass Rhizosphere | REKKRNKLRARIAAAPAAGRAALEARVLRTYSPFHSLREKLPRAVV* |
Ga0173480_100067123 | 3300015200 | Soil | KKRDKLRARIAAAPATGRAVLEAKVLRTYSPFHSAMRAKLPPAAV* |
Ga0173480_101551271 | 3300015200 | Soil | KRDKLRARIAAAPATGRAALEAKVQRTYSPFHTMKAKVPPAEA* |
Ga0134072_102937212 | 3300015357 | Grasslands Soil | KKLRAQIAAAPATGRAALEAKVQRTYSPFHMVMKEKLPPAIV* |
Ga0132256_1006528311 | 3300015372 | Arabidopsis Rhizosphere | QHRAKKRHKLRARIAAAPTTGRAALEAKVQRTYSAFHSITKEKTPPAVV* |
Ga0132256_1030212882 | 3300015372 | Arabidopsis Rhizosphere | RHRVKKRNKLRARIAAAPATGRAALEARLQRTYSAFHTATKEKPPPTEV* |
Ga0132256_1032830811 | 3300015372 | Arabidopsis Rhizosphere | KRDKLRARIAAAPPTGRAPLEAKMQRTYSASHSMMKENSPPEAV* |
Ga0132257_1001005171 | 3300015373 | Arabidopsis Rhizosphere | KRAKLRARIAAGPANGRAALEARVLRTYSPFHSMKEKLPRAG* |
Ga0132257_1002292085 | 3300015373 | Arabidopsis Rhizosphere | RAKKRAKLRARIAAAPAAGRAALEAKVQRTYSSSHSMMKEKLPPAAV* |
Ga0132257_1009243853 | 3300015373 | Arabidopsis Rhizosphere | AAAPATGRAALEAKVQRTYSPSHRMMKEKLPPALV* |
Ga0184611_11699941 | 3300018067 | Groundwater Sediment | HRAKKRNKLRARIAAAPATGRATLEAKVQRTYSTSHSMMKEKLPPAVA |
Ga0184636_13006312 | 3300018068 | Groundwater Sediment | RIAAAPASGRAALEARVLRTYSAFHSTREKLPPAAV |
Ga0190265_134226612 | 3300018422 | Soil | LRQHRAKKRDKLRARIAAAPAAGRAALEAKVQRTYSPFHSTTKETPPPAVV |
Ga0190270_108553882 | 3300018469 | Soil | TSASTSNEEANKLRARIAAAPATGRVALEARLQRTYSAFHSMMKEKPPPAAV |
Ga0190271_130998392 | 3300018481 | Soil | QHRRKKRDKLRARIAAKPAVGRAALEAKVLRTYSAFHFPAKEKPPVVAV |
Ga0193696_10693661 | 3300020016 | Soil | LRARIAAAPAAGRAALEAKVQRTYSSSHSMMKEKLPPAVV |
Ga0222622_100487541 | 3300022756 | Groundwater Sediment | ARIAAAPATGRAALEAKVLKTYSAFHSFLKEKAPPEAV |
Ga0247746_11475811 | 3300022886 | Soil | KLRARIAAAPATGRAELEAKLQRTYSPFHSMMKEKLPPVVV |
Ga0207697_102758202 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VKKRNKLRARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV |
Ga0207645_102233731 | 3300025907 | Miscanthus Rhizosphere | KLRARIAAAPATGRAALEAKLQRTYSPSHSMMKEKLPPTVVEP |
Ga0207649_100494882 | 3300025920 | Corn Rhizosphere | RQHRAKKRNKLRARIAAAPASGRAALEAKVQRTYSPSHSMMKEKLPPTVV |
Ga0207650_106653212 | 3300025925 | Switchgrass Rhizosphere | RARIAASPMVGRAALEAKVQRTYSPFHKAAKAKLPPVVA |
Ga0207650_110383831 | 3300025925 | Switchgrass Rhizosphere | KRNKLRARIAASPMVGRAALEAKVLRTYSTFHVPAKEKVPPVVA |
Ga0207659_101037724 | 3300025926 | Miscanthus Rhizosphere | RVKKRNKLRARIAAASPTGRAALEARVQRTYSPFHSMQREKLPQAVV |
Ga0207659_103884842 | 3300025926 | Miscanthus Rhizosphere | HRAKKRNKLRARIAASPMVGRAALEAKVLRTYSTFHVPAKEKVPPVVA |
Ga0207659_108482422 | 3300025926 | Miscanthus Rhizosphere | KLRARIAAAPATGRAALEARVERTYSPFHSTMKEPLPPAVV |
Ga0207706_102524351 | 3300025933 | Corn Rhizosphere | ARIAASPTGKAAFEAKLQRTYSPFHTMAKEKLPPTVV |
Ga0207706_112198422 | 3300025933 | Corn Rhizosphere | RARIAAAPATARAALEARLQRTYSAFHTATKEKPPPTVV |
Ga0207669_107315591 | 3300025937 | Miscanthus Rhizosphere | NKLRARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV |
Ga0207691_115123222 | 3300025940 | Miscanthus Rhizosphere | QHRAKKRNKLRARIAASPMVGRAALEAKVLRTYSTFHVPAKEKVPPVVA |
Ga0207711_106101112 | 3300025941 | Switchgrass Rhizosphere | QHRLKKRNKLRARLASAPATGRAALEAKLLRTYSPFHSMMKEKQPPPAV |
Ga0207668_104005212 | 3300025972 | Switchgrass Rhizosphere | KLRARIAAAPAGGRAVLEAKVLKTYSAFHSLTKEKSTPEAV |
Ga0207640_110917512 | 3300025981 | Corn Rhizosphere | NKLRARIAAAPATARAALEAKVQRTYSPSHSMMKEKLPPTVV |
Ga0207702_113177032 | 3300026078 | Corn Rhizosphere | KLRARIAAAPASGRAALEAKLQRTYSPFHMMTKEKLPPAPD |
Ga0207683_107233882 | 3300026121 | Miscanthus Rhizosphere | LRQHRAKKRNKLRARIAAAPATGRAALEAKLQRTYSPFHSMMKEKLPPVVA |
Ga0207698_117436641 | 3300026142 | Corn Rhizosphere | LRQHRAKKRNKLRARIAAAPATGRAALEARVQRTYSPFHSMREKLPGTVI |
Ga0209387_11697862 | 3300027639 | Agricultural Soil | IAAAPAAGRAALEVKVQRTYSPFHSMMKEKLPPAVV |
Ga0209074_104336321 | 3300027787 | Agricultural Soil | IAAAPATGRAALEAKLLRTYSPFHSMMKAKLPPAAV |
Ga0209486_100797271 | 3300027886 | Agricultural Soil | KRNKLRARIAAAPATGRAALEAKVQRTYSPSHSMMKEKLPPAVV |
Ga0307503_102288571 | 3300028802 | Soil | YRLKKRNKLRARIAAAPASGRAALEARVLRTYSAFHSTREKLPPAAV |
Ga0311347_108997421 | 3300029923 | Fen | HRTKKRDKLRARIAAAPAVGRAALEAKVERTYSPFHIAAKEKLPPVVA |
Ga0310887_110551611 | 3300031547 | Soil | LLARIAAAPATGRAALEAKVQRTYSRSHSMMKEKLPPAVV |
Ga0310813_112501241 | 3300031716 | Soil | LRARIAAAPASERAALEAKVQRTYAPSHSMTKEKLPPPSV |
Ga0307468_1018327342 | 3300031740 | Hardwood Forest Soil | HRAKKRDKLRARIAAAPAGGRAVLEAKVQRTYSLFHSKAEEQLLPEVQR |
Ga0310904_102363441 | 3300031854 | Soil | SKKRDKLRARIAAAPATGRAALEAKVQRTYSPFHTMKAKVPPAEA |
Ga0310900_110967951 | 3300031908 | Soil | AKKRNKLRARIAAAPATGRAALEAKLQRTYSPFHSMMKEKLPPVVV |
Ga0310900_119026431 | 3300031908 | Soil | KLRARLAAAPATGRAALEAKLQRTYSPFHTMAKEKLPPAPD |
Ga0310897_101583011 | 3300032003 | Soil | KRNKLRARIAAAPASGRAALEAKLQRTYSPFHTMTKEKLPPAPD |
Ga0310897_103129452 | 3300032003 | Soil | RIAAASVSATGRAAFEAKLQRTYSPFHMMMKEKPPPTVV |
Ga0310897_105421131 | 3300032003 | Soil | RQHRVKKRNKLRARIAAAPASAGRAALEAKVLRTYSPFHSTATKKLPPEL |
Ga0310906_102801211 | 3300032013 | Soil | AKKRKKLRARIAAAPATGRASLEAKLQRTYSPFHSMMKEKLPPVVA |
Ga0310899_101378602 | 3300032017 | Soil | ARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV |
Ga0310899_101887881 | 3300032017 | Soil | PHRVKKRNKLRARIAAAPASAGRAALEAKVLRTYSPFHSTATKKLPPEL |
Ga0310890_107021611 | 3300032075 | Soil | LRARIAAAPTTGRAALETKVQRTYSAFHSITKEKTPPAVV |
Ga0310889_100262721 | 3300032179 | Soil | KKRAKLRARIAAAPATGRAALEAKVQRTYSPFHSMMKEKLPPAGA |
Ga0307471_1026745451 | 3300032180 | Hardwood Forest Soil | HRAKKRNKLRARIAAAPATGRAALEAKVQRTYSPSHRMMKEKVPPALV |
Ga0307471_1030957222 | 3300032180 | Hardwood Forest Soil | QHRAKKRAKLRARIAAAPATGRAALEAKVQRTYSPFHSMMKEKLPPPVV |
Ga0316605_117094941 | 3300033408 | Soil | RQHRAKKRRKLLARIAATPAAGRAALEAKVQRTYSPFHSMTKEGLPPPTV |
⦗Top⦘ |