Basic Information | |
---|---|
Family ID | F071705 |
Family Type | Metagenome |
Number of Sequences | 122 |
Average Sequence Length | 46 residues |
Representative Sequence | GMDYWRTPTIGYGTGGNNHEAGASNWYFPSDQWQEAVFTDIGGPQF |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 11.48 % |
% of genes near scaffold ends (potentially truncated) | 74.59 % |
% of genes from short scaffolds (< 2000 bps) | 85.25 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.902 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.852 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.607 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.180 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF01134 | GIDA | 41.80 |
PF13932 | GIDA_C | 5.74 |
PF03331 | LpxC | 4.10 |
PF00106 | adh_short | 3.28 |
PF00535 | Glycos_transf_2 | 2.46 |
PF03070 | TENA_THI-4 | 2.46 |
PF13462 | Thioredoxin_4 | 1.64 |
PF02870 | Methyltransf_1N | 1.64 |
PF14518 | Haem_oxygenas_2 | 1.64 |
PF02897 | Peptidase_S9_N | 1.64 |
PF02812 | ELFV_dehydrog_N | 0.82 |
PF02742 | Fe_dep_repr_C | 0.82 |
PF04023 | FeoA | 0.82 |
PF00664 | ABC_membrane | 0.82 |
PF07884 | VKOR | 0.82 |
PF07676 | PD40 | 0.82 |
PF09723 | Zn-ribbon_8 | 0.82 |
PF02678 | Pirin | 0.82 |
PF00291 | PALP | 0.82 |
PF12663 | DUF3788 | 0.82 |
PF13506 | Glyco_transf_21 | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 4.10 |
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 1.64 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 1.64 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 1.64 |
COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.82 |
COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 0.82 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.82 |
COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 0.82 |
COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.36 % |
Unclassified | root | N/A | 1.64 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10078417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1770 | Open in IMG/M |
3300001593|JGI12635J15846_10155543 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300003321|soilH1_10058273 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
3300003321|soilH1_10247086 | Not Available | 1749 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10020817 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
3300004153|Ga0063455_100200897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
3300005162|Ga0066814_10069587 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300005175|Ga0066673_10488958 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300005328|Ga0070676_11204255 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300005332|Ga0066388_100718659 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
3300005337|Ga0070682_100516425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 928 | Open in IMG/M |
3300005434|Ga0070709_10914877 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300005435|Ga0070714_100203191 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
3300005445|Ga0070708_100014227 | All Organisms → cellular organisms → Bacteria | 6538 | Open in IMG/M |
3300005537|Ga0070730_10784021 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300005547|Ga0070693_100220305 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300005560|Ga0066670_10487917 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300005598|Ga0066706_11332060 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005610|Ga0070763_10347230 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300005614|Ga0068856_100330398 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
3300005712|Ga0070764_10424886 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300005841|Ga0068863_100600446 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300005921|Ga0070766_10623428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter kilaueensis | 726 | Open in IMG/M |
3300005993|Ga0080027_10092225 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300006028|Ga0070717_10555781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
3300006028|Ga0070717_10830799 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300006046|Ga0066652_100335305 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300006046|Ga0066652_101868456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300006059|Ga0075017_101086046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300006163|Ga0070715_10209295 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300006176|Ga0070765_101283867 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300006237|Ga0097621_100027984 | All Organisms → cellular organisms → Bacteria | 4438 | Open in IMG/M |
3300006354|Ga0075021_10113423 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
3300006794|Ga0066658_10445864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
3300006954|Ga0079219_11538162 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300009012|Ga0066710_103824796 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300009038|Ga0099829_10030842 | All Organisms → cellular organisms → Bacteria | 3818 | Open in IMG/M |
3300009038|Ga0099829_10056807 | All Organisms → cellular organisms → Bacteria | 2920 | Open in IMG/M |
3300009088|Ga0099830_10954868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300009176|Ga0105242_10119498 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Enoplea → Dorylaimia → Trichinellida → Trichuridae → Trichuris → Trichuris trichiura | 2259 | Open in IMG/M |
3300009524|Ga0116225_1084814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1480 | Open in IMG/M |
3300009551|Ga0105238_11911514 | Not Available | 626 | Open in IMG/M |
3300010321|Ga0134067_10480861 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300010336|Ga0134071_10188583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
3300010397|Ga0134124_12057301 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300011269|Ga0137392_10039268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3495 | Open in IMG/M |
3300011269|Ga0137392_10917826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300011270|Ga0137391_10023093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5149 | Open in IMG/M |
3300012019|Ga0120139_1037199 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300012096|Ga0137389_10619543 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300012096|Ga0137389_11391598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300012199|Ga0137383_10094278 | All Organisms → cellular organisms → Bacteria | 2171 | Open in IMG/M |
3300012199|Ga0137383_10876131 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300012199|Ga0137383_11009322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300012206|Ga0137380_10597558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
3300012209|Ga0137379_10298120 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300012209|Ga0137379_11571456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300012210|Ga0137378_10614246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
3300012211|Ga0137377_10219924 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
3300012349|Ga0137387_10787276 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300012351|Ga0137386_10271334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1220 | Open in IMG/M |
3300012362|Ga0137361_10735683 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300012363|Ga0137390_10925921 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300012917|Ga0137395_10851330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300012957|Ga0164303_10790049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 651 | Open in IMG/M |
3300012975|Ga0134110_10439092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300012989|Ga0164305_11375131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300013100|Ga0157373_10626540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300015193|Ga0167668_1029581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1210 | Open in IMG/M |
3300015358|Ga0134089_10079289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
3300017654|Ga0134069_1029832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1669 | Open in IMG/M |
3300017924|Ga0187820_1079296 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300017943|Ga0187819_10075634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2007 | Open in IMG/M |
3300017943|Ga0187819_10277571 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300018006|Ga0187804_10379113 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300018043|Ga0187887_10456286 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300018062|Ga0187784_10019915 | All Organisms → cellular organisms → Bacteria | 5418 | Open in IMG/M |
3300018085|Ga0187772_10720599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300018431|Ga0066655_10414546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
3300018431|Ga0066655_10468096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
3300018433|Ga0066667_11855453 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300019361|Ga0173482_10274420 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300019888|Ga0193751_1071533 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300019890|Ga0193728_1039496 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
3300020580|Ga0210403_10123565 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Enoplea → Dorylaimia → Trichinellida → Trichuridae → Trichuris → Trichuris trichiura | 2108 | Open in IMG/M |
3300020580|Ga0210403_11031792 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300020583|Ga0210401_10100393 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Enoplea → Dorylaimia → Trichinellida → Trichuridae → Trichuris → Trichuris trichiura | 2719 | Open in IMG/M |
3300020583|Ga0210401_10858083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
3300021170|Ga0210400_11677537 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300021178|Ga0210408_10306069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1267 | Open in IMG/M |
3300021180|Ga0210396_10043537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4126 | Open in IMG/M |
3300021181|Ga0210388_10968951 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300021401|Ga0210393_10386021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
3300021402|Ga0210385_10463676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
3300021404|Ga0210389_11052015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300021432|Ga0210384_10963943 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300021474|Ga0210390_11103060 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300021478|Ga0210402_10239128 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin063 | 1675 | Open in IMG/M |
3300021479|Ga0210410_10080220 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
3300025898|Ga0207692_10078043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1763 | Open in IMG/M |
3300025900|Ga0207710_10011495 | All Organisms → cellular organisms → Bacteria | 3726 | Open in IMG/M |
3300025905|Ga0207685_10560275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300025910|Ga0207684_10803934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
3300025913|Ga0207695_11129189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
3300026088|Ga0207641_10564769 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300026490|Ga0257153_1092690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300027110|Ga0208488_1086952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300027641|Ga0208827_1209566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300027674|Ga0209118_1095373 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300027842|Ga0209580_10596427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300027862|Ga0209701_10221761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
3300027862|Ga0209701_10228576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
3300028047|Ga0209526_10554454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300028379|Ga0268266_12011308 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300030494|Ga0310037_10012445 | All Organisms → cellular organisms → Bacteria | 4138 | Open in IMG/M |
3300031446|Ga0170820_11164896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300031823|Ga0307478_10715945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
3300032074|Ga0308173_10804307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
3300032205|Ga0307472_102673113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300032805|Ga0335078_10829323 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300032955|Ga0335076_11039426 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300033475|Ga0310811_10671991 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.11% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.10% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.10% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.28% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.28% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.28% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.28% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.64% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.64% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.64% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.64% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.64% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.64% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.64% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.82% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.82% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.82% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.82% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.82% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_100784173 | 3300001356 | Peatlands Soil | PTIAYGPGGNNHEAGASNWYFPSDQWQEATFTDIGGPQF* |
JGI12635J15846_101555432 | 3300001593 | Forest Soil | SPTIPYGTGGNNHEAGASNWYFPSPDWQEASFTDVGGPQF* |
soilH1_100582731 | 3300003321 | Sugarcane Root And Bulk Soil | FDYWRDAHAQYGSGGNNHEAGASDWYFPSAEWQTAEFTDIPDGH* |
soilH1_102470864 | 3300003321 | Sugarcane Root And Bulk Soil | AGALLQVGFDYWRDAHSGYGSGGNNQEAGASDWYLPSDEWQTAEFTDSSARTDF* |
JGIcombinedJ51221_100208173 | 3300003505 | Forest Soil | MGMDYWRSSTVLYGPGGNNQEAGASNWYFPSAEWQEAIFTDFGGPQF* |
Ga0063455_1002008973 | 3300004153 | Soil | PPGRLAGCTAKARVKIGPGALLQMGFDYWRSASEPYGRGGNNHEAGASDWFFSSYGWQEAIFSDIGGSRF* |
Ga0066814_100695871 | 3300005162 | Soil | VRARVMISPGALLQMGMDYWRSPAIPYGSGGNNHEAGASHWYFPSPQWQEATFTDVGGPQF* |
Ga0066673_104889582 | 3300005175 | Soil | GMDYWRNPTVGYGSGGNNHEAGASDWYFPSSEWQDAVFSDIKP* |
Ga0070676_112042552 | 3300005328 | Miscanthus Rhizosphere | MDYWRSPTIAYGTGGNNREAGASNWYFPSPEWQEATFTDIGGPQF* |
Ga0066388_1007186593 | 3300005332 | Tropical Forest Soil | VKIGQGALLQMGSDYWRSTKATYGAGGNHHEAGASHWYFPSEAWQEAVFSGIGGPRF* |
Ga0070682_1005164251 | 3300005337 | Corn Rhizosphere | DYWRDAHTQYGSGGNNHEAGASDWYLPSDEWQTAEFTDIPDRR* |
Ga0070709_109148771 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LQMGMDYWRSPTVPYGSGGNNHEAGASDWYFPSPQWQEVSFTDVGGPQF* |
Ga0070714_1002031911 | 3300005435 | Agricultural Soil | VIVRARIASGALLQVGMDYWRNSAVGYGSGGNNHEAGASDWYFSSPDWQEA |
Ga0070708_1000142274 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDYWRHPTIGYGSGGNNHEAGASDWYFPSNEWQEAIFTEVGHH* |
Ga0070730_107840212 | 3300005537 | Surface Soil | VGFDYWRNSTIEYGPGGNNHEAGASDWYFPSPGWQEAKFSDIKR* |
Ga0070693_1002203051 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | RARVMISPGALLQMGMDYWRSPTIPYGSGGNNHEAGASHWYFSSPQWQEVTFTDIGGPQF |
Ga0066670_104879172 | 3300005560 | Soil | LLQVGMDYWRNSTVGYGAGGNNHEAGASDWYFPSSDWQEATFTDVHPR* |
Ga0066706_113320602 | 3300005598 | Soil | VGYGSGGNNHEAGVSNWYFPSSQWQEAAFTDIGGPQF* |
Ga0070763_103472302 | 3300005610 | Soil | DYWRSPTIAYGPGGNNHEAGASNWYFPSEQWQEAVFTDIGGPQF* |
Ga0068856_1003303981 | 3300005614 | Corn Rhizosphere | IGFDYWRDRTVAYGSGGNNHEAGASDWYFPAPEWQEATFSDIKSSDIKR* |
Ga0070764_104248861 | 3300005712 | Soil | DYWRLPTIPYGLGGNNHEAGARNWYFPSGQWQEAVFTDIGGPQF* |
Ga0068863_1006004461 | 3300005841 | Switchgrass Rhizosphere | DYWRSASEPYGRGGNNHEAGASDWFFSSDGWQEAIFSDIGGLRF* |
Ga0070766_106234281 | 3300005921 | Soil | VRVSAGAWLQVGMDYWRSPTTYGNGGNNHEAGVSDWYFPSPDWQEASFTDVGGPQF* |
Ga0080027_100922251 | 3300005993 | Prmafrost Soil | SPGAMVQIGMDYWRSPTVPYGPGGNNHEAGASDWYFPSPEWQEATFTDIPETH* |
Ga0070717_105557811 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDYWRHPTIGYSSGGNNHEAGASDWYFPSNEWQEAIFTEVGHH* |
Ga0070717_108307991 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LQIGMDYWRNPKIGYGAGGNNHEAGASDWYFPSDQWQEAVFTDTK* |
Ga0066652_1003353051 | 3300006046 | Soil | AKARVKIGPGALLQVGFDYWRSASEPYGRGGNNHEAGASDWFFSSDGWQEAIFSDIGGSRF* |
Ga0066652_1018684562 | 3300006046 | Soil | TTGYGSGGNNHEAGASDWYFPSDQWQEAMFTDIKKN* |
Ga0075017_1010860461 | 3300006059 | Watersheds | DYWRSPTIPYGSGGNNHEAGASDWYLPSPQWQEVSFTDIGGPQF* |
Ga0070715_102092951 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LQIGFDYWRDPTVAYGSGGNNHEAGASDWYFPATDWQEATFSDIKRGSVR* |
Ga0070765_1012838671 | 3300006176 | Soil | LQVGMDYWRSPTTYGNGGNNHEAGVSDWYFPSPDWQEASFTDVGGPQF* |
Ga0097621_1000279841 | 3300006237 | Miscanthus Rhizosphere | FDYWRDPTIDYGSGGNNHEAGASNWYFPSDKWQEATFSDIKK* |
Ga0075021_101134233 | 3300006354 | Watersheds | LQMGMDYWRSPTIPYGSGGNNHEAGASDWYLPSPQWQEVSFTDIGGPQF* |
Ga0066658_104458641 | 3300006794 | Soil | LAGCTAKARVKIGPGALLQMGFDYWRSASEPYGRGGNNHEAGASDWFFSSYGWQEAIFSDIGGSRF* |
Ga0079219_115381622 | 3300006954 | Agricultural Soil | MQLSGALLQIGMDYWRNSAVGYVSGGNNHEAGASDWYSPSPHWQDATFTDAPA* |
Ga0066710_1038247961 | 3300009012 | Grasslands Soil | YWRNPTAGYGSGENNHEAGVSNWYFPSSQWQEATSTDIGGPQF |
Ga0099829_100308424 | 3300009038 | Vadose Zone Soil | MDYWRHPTIGYGSGGNNHEAGASDWYFPSNDWQEAIFTDVGHH* |
Ga0099829_100568073 | 3300009038 | Vadose Zone Soil | MGMDYCRNPTIGFGSGGNNHEAGASQWYFLSDDWQEAIFTDINP* |
Ga0099830_109548682 | 3300009088 | Vadose Zone Soil | MDYWRNPTIGYGSGGNNHEAGASDWYFPSNDWQEAIFTDVGHH* |
Ga0105242_101194982 | 3300009176 | Miscanthus Rhizosphere | PAIPYGSGGNNHEAGASHWYFPSPQWQEATFTDVGGPQF* |
Ga0116225_10848142 | 3300009524 | Peatlands Soil | MGMDYWRTPTIGYGPGGNNHEAGASNWYFPSDQWQEATFTDIGGPQF* |
Ga0105238_119115141 | 3300009551 | Corn Rhizosphere | QVGFDYWRDANADYGSGGNNHEAGASEWYLPSEEWQTAEFTDIRDPN* |
Ga0134067_104808612 | 3300010321 | Grasslands Soil | ALLQIGLDYWRNSTVGYGTGGNNHEAGASDWYFPSPDWQEATFTDVPKVK* |
Ga0134071_101885831 | 3300010336 | Grasslands Soil | PTAGYGSGENNHEAGASNWYFPSSQWQEAAFTDIGGPQF* |
Ga0134124_120573012 | 3300010397 | Terrestrial Soil | AYGTGGNNREAGASNWYFPSPEWQYATFTDIGGPQF* |
Ga0137392_100392683 | 3300011269 | Vadose Zone Soil | MGMDYCRNPTIGFGSGGNNHEAGASQWYFLSDDWEEAIFTDINP* |
Ga0137392_109178262 | 3300011269 | Vadose Zone Soil | MGMDYWRNPTIGFGSGGNNHEAGASEWYFPSDDWQEAIFTHIKP* |
Ga0137391_100230935 | 3300011270 | Vadose Zone Soil | RHPTIGYGSGGNNHEAGASDWYFPSNDWQEAIFTDVGHH* |
Ga0120139_10371992 | 3300012019 | Permafrost | MGMDYWRNPTIGYGSGAGASDWYFPSNDWQDAVFTDIRYH* |
Ga0137389_106195431 | 3300012096 | Vadose Zone Soil | RVRISAGALLQVGMDYWRSPTVPYGSGGNNHEAGASDWYFPSPQWQEVSFTDIGGPQF* |
Ga0137389_113915981 | 3300012096 | Vadose Zone Soil | MGMDYWRNPTIGFGSGGNNHEAGASNWYLPSKDWQEAVFTDVHH* |
Ga0137383_100942783 | 3300012199 | Vadose Zone Soil | MGMDYWRNPTIGFGSGGNNHEAGASQWYFPSDDWQEAIFTDINP* |
Ga0137383_108761311 | 3300012199 | Vadose Zone Soil | TAGYGSGENNHEAGASNWYFPSSQWQEATFTDIGGQKF* |
Ga0137383_110093221 | 3300012199 | Vadose Zone Soil | VGIDYWRHPPIGYGSGGNNHEAGASDWYFPSHEWQEAVFTDAPKRP* |
Ga0137380_105975581 | 3300012206 | Vadose Zone Soil | MGMDYWRNPTIGYGSGGNNHEAGASDWYFPSGEWQEAVFTDIK* |
Ga0137379_102981201 | 3300012209 | Vadose Zone Soil | MDYWRNPTIGYGSGGNNHEAGASDWYFPSGEWQEAVFTDIK* |
Ga0137379_115714561 | 3300012209 | Vadose Zone Soil | MDYWRHPTIGYGSGGNNHQAGASDWYFPSNDWQEAIFTDVGHH* |
Ga0137378_106142462 | 3300012210 | Vadose Zone Soil | VGIDYWRHPTIGYGSGGNNHQAGASDWYFPSNDWQEAIFTDVGHH* |
Ga0137377_102199241 | 3300012211 | Vadose Zone Soil | MGMDYCRNPTIGFGSGGNNHEAGASQWYFPSDDWQEAIFTDINP* |
Ga0137387_107872762 | 3300012349 | Vadose Zone Soil | PTATYGTGGNNHEAGASDWYFPSDQWQDAVFTDAPKEP* |
Ga0137386_102713343 | 3300012351 | Vadose Zone Soil | LLQVGMDYWRNPTATYGTGGNNHEAGASDWYFPSDQWQDAVFTDAPKEP* |
Ga0137361_107356831 | 3300012362 | Vadose Zone Soil | VGIDYWRHPTIGYGSGGNNHEAGASDWYFPSNDWQEAIFTDVGHH* |
Ga0137390_109259212 | 3300012363 | Vadose Zone Soil | MGMDYWRNPTIGFGSGGNNHEAGASEWYFPSDDWQEAIFTDIKP* |
Ga0137395_108513301 | 3300012917 | Vadose Zone Soil | LLQIGFDYWRDPTVAYGSGGNNHEAGASDWYFPAPEWQEATFSDIKR* |
Ga0164303_107900491 | 3300012957 | Soil | WRNATIGYGTGGNNHEAGASDWYVASGRWQEAEFSDVRR* |
Ga0134110_104390922 | 3300012975 | Grasslands Soil | SSGALLQVGMDYWRNSSVGYGAGGNNHEAGASDWYFPSSSWQEAMFTDVREAK* |
Ga0164305_113751311 | 3300012989 | Soil | GLLQLGFDYWRSPSVPYGPGGNNQEAGASDWYLPSGQWQEAVFTDIGGPQF* |
Ga0157373_106265402 | 3300013100 | Corn Rhizosphere | SSAAMLQVGMDYWRNSTVGYGSGGNNHEAGASDWYFPSSDWQEATFTDIPRIN* |
Ga0167668_10295811 | 3300015193 | Glacier Forefield Soil | WRSSTVPYGAGGNNHEAGASNWYFPSPQWQDAVFTDLPGLQF* |
Ga0134089_100792893 | 3300015358 | Grasslands Soil | VGYGSGGNNHEAGVSNWYFPSSQWQEATFTGIGGPQF* |
Ga0134069_10298321 | 3300017654 | Grasslands Soil | PTAGYGSGENNHEAGASNWYFPSSQWQEAAFTDIGGPQF |
Ga0187820_10792962 | 3300017924 | Freshwater Sediment | LLQVGMDYWRSPTVPFGAGGNNHEAGASDWYFSSPRWQEVSFTDMGGPQF |
Ga0187819_100756341 | 3300017943 | Freshwater Sediment | ALLQMGMDYWRNTTVEYGSGGNNHEAGASNWYLPSERWQEAIFTDIGGPRF |
Ga0187819_102775711 | 3300017943 | Freshwater Sediment | ALLQMGMDYWRNTTVEYGSGGNNHEAGASNWYLPSERWQEAMFTDIGGPQF |
Ga0187804_103791132 | 3300018006 | Freshwater Sediment | YWRNATLPYARGNNHEAGASNWYFPSERWQEGVFTDIGGVRF |
Ga0187887_104562861 | 3300018043 | Peatland | GMDYWRTPTIGYGTGGNNHEAGASNWYFPSDQWQEAVFTDIGGPQF |
Ga0187784_100199151 | 3300018062 | Tropical Peatland | GALLQVGMDYWRDPTAPFGHGGNNHEAGASDWYFPSDQWQEAVFSDIRDFKF |
Ga0187772_107205991 | 3300018085 | Tropical Peatland | LLQMGMDDWRNATVEYGSGGNNHEAGASNWYFPSERWQEAWFTDVGGPRF |
Ga0066655_104145461 | 3300018431 | Grasslands Soil | LQVGFDYWRNPTVGYGSGGNNHEAGASRWYFPSAKWQEVEFTDVHH |
Ga0066655_104680961 | 3300018431 | Grasslands Soil | ARISKGALLQIGFDYWRDPTTGYGSGGNNHEAGASDWYFPSDQWQEAMFTDIKQN |
Ga0066667_118554531 | 3300018433 | Grasslands Soil | TVGYGSGGNNHEAGVSNWYFPSSQWQEAAFTDIGGPQF |
Ga0173482_102744201 | 3300019361 | Soil | LLQMGMDYWRSPTIPYGSGGNNHEAGASRWYFPSPQWQEVTFTDIGGSQF |
Ga0193751_10715332 | 3300019888 | Soil | MGMDYCNPTIGAGASDWYFPSNDWQDAVFTDIGYH |
Ga0193728_10394963 | 3300019890 | Soil | VGNPTIGYGSGGNDHEAGASDWYFPSTDCQDAVFTDVGHH |
Ga0210403_101235651 | 3300020580 | Soil | PTVPFGSGGNNHEAGASNWYFPSDKWQDAVFSDIGGPQL |
Ga0210403_110317922 | 3300020580 | Soil | VDYWRSPTIAYGPGGNNHEAGASNWYFASDQWQEAVFTDIGGPQF |
Ga0210401_101003931 | 3300020583 | Soil | TIPYRLGGNNHEAGARNWYFPSAQCQEVVFTDIGGPQS |
Ga0210401_108580831 | 3300020583 | Soil | DYWRSPTIAYGPGGNNHEAGASNWYFASDQWQEAVFTDIGGQQF |
Ga0210400_116775371 | 3300021170 | Soil | MGMDYWRSATVPHGAGGNNHETGAGNWCFPSSEWQEARFTDVGGVQF |
Ga0210408_103060691 | 3300021178 | Soil | STIPYGSGGNNHEAGASDWYFSSPQWQEVSFTDIGGSQF |
Ga0210396_100435375 | 3300021180 | Soil | DYWRTPTIAYGRGGNNHEAGASNWYFPSDQWQEATFTDIGGPQF |
Ga0210388_109689511 | 3300021181 | Soil | ALLQMGMDYWRNPTIEYRPGDSHEAGASNWYFPSERWQEAEFTDIGGVRF |
Ga0210393_103860212 | 3300021401 | Soil | TAKVKISRGALLQMGMDYWRNPTIGYGPGGNNYEAGASSWYFPSKNWQQAVFTDMKTH |
Ga0210385_104636761 | 3300021402 | Soil | WRNPTIGYGPGGNNHEAGASNWYFPSNQWQEATFTDIGGPQF |
Ga0210389_110520152 | 3300021404 | Soil | TIAYGLGGNNHEAGASNWYFASPQWQEAIFTDIGGPQF |
Ga0210384_109639431 | 3300021432 | Soil | YWRNPTIAYGVGDSHEAGASNWYFPSERWQEAEFTDIGGVKF |
Ga0210390_111030602 | 3300021474 | Soil | SPTIPYRLGGNNHEAGARNWYFPSAQCQEAVFTDIGGPQS |
Ga0210402_102391282 | 3300021478 | Soil | RSATVPYGKGGNNHEAGASNWYFPSPVWQEATFTDIGGPQF |
Ga0210410_100802202 | 3300021479 | Soil | MDYWRSSTIPYGSGGNNHEAGASDWYFSSPQWQEVSFTDIGGSQF |
Ga0207692_100780431 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TIVYESGGNNHEAGASDWYFPSHQWQEAVFTDIKQN |
Ga0207710_100114954 | 3300025900 | Switchgrass Rhizosphere | VMISPGALLQMGMDYWRSPTIPYGSGGNNHEAGASRWYFPSPKWQEVTFTDIGGSQF |
Ga0207685_105602751 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | PTIPYGSGGNNREAGASNWYFPSPEWQEATFTDIGGRQF |
Ga0207684_108039342 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDYWRNPSIGYGSGGNNHEAGASDWYFPSDRWQEAIFTDTPNAH |
Ga0207695_111291891 | 3300025913 | Corn Rhizosphere | IAYGTGGNNREAGASNWYFPSPEWQDATFTDIGGPQF |
Ga0207641_105647691 | 3300026088 | Switchgrass Rhizosphere | DYWRSASEPYGRGGNNHEAGASDWFFSSDGWQEAIFSDIGGLRF |
Ga0257153_10926901 | 3300026490 | Soil | GALLQMGMDYWRNPTIGFGSGGNNHEAGVSRWYFPSDEWQEAMFTDINP |
Ga0208488_10869522 | 3300027110 | Forest Soil | PTIAYGPGGNNHEAGASNWYFPSEQWQEAVFTDIGGPQF |
Ga0208827_12095662 | 3300027641 | Peatlands Soil | GMDYWRTPTVAYASGGNNHEAGASNWYFPSDQWQEATFTDIGGPQF |
Ga0209118_10953732 | 3300027674 | Forest Soil | SQAGIDYWRCPAVPYGSGGNNPEAGASDWYFPSPQWQEASFTGAGGPQF |
Ga0209580_105964272 | 3300027842 | Surface Soil | IGYGPGGNNHEAGASNWYFASGQWQEAAFTDIGGPQF |
Ga0209701_102217612 | 3300027862 | Vadose Zone Soil | MDYWRNPTIGYGSGGNNHEAGASDWYFPSNDWQEAIFTDVGHH |
Ga0209701_102285763 | 3300027862 | Vadose Zone Soil | MGMDYCRNPTIGFGSGGNNHEAGASQWYFLSDDWQEAIFTDINP |
Ga0209526_105544542 | 3300028047 | Forest Soil | MDYWRSSTIPYGSGGNNHEAGASDWYFSSLQWQEVSFTDIGGSQF |
Ga0268266_120113082 | 3300028379 | Switchgrass Rhizosphere | MDYWRSPTIAYGTGGNNREAGASNWYFPSPEWQDATFTDIGGPQ |
Ga0310037_100124451 | 3300030494 | Peatlands Soil | RTPTIAYGPGGNNHEAGASNWYFPSDQWQEATFTDIGGPQF |
Ga0170820_111648962 | 3300031446 | Forest Soil | KISPGALLQVGMDYWRNPTVGYGPGGNNHEAGASRWYFASDEWQTAEFTDIKP |
Ga0307478_107159452 | 3300031823 | Hardwood Forest Soil | TIPYGPGGNNHEAGASNWYFPSDQWQEAIFTDIGGPQF |
Ga0308173_108043071 | 3300032074 | Soil | QMGFDYWRSASEPYGRGGNNHEAGASDWFFSSDGWQEAIFSDIGGSRF |
Ga0307472_1026731132 | 3300032205 | Hardwood Forest Soil | TVAYSSGGNNHEAGASDWYFPAPEWQEATFSDIKFSDIKR |
Ga0335078_108293233 | 3300032805 | Soil | KVHLRISQGALVQIGMDYWKNPSVEYAPGNSHEAGASDWYFPFENWQEAVFTDIGGPQF |
Ga0335076_110394262 | 3300032955 | Soil | IGMDYWKNPIVDYAPGNSHEAGASNWYFPSKGWQEAVFTDIGRPQF |
Ga0310811_106719912 | 3300033475 | Soil | VMISPGALLQMGMDYWRSPTIPYGSGGNNHEAGASRWYFPSPQWQEVTFTDIGGSQF |
⦗Top⦘ |