Basic Information | |
---|---|
Family ID | F071624 |
Family Type | Metagenome |
Number of Sequences | 122 |
Average Sequence Length | 48 residues |
Representative Sequence | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALT |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 31.15 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.62 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.672 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (12.295 % of family members) |
Environment Ontology (ENVO) | Unclassified (54.918 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (73.770 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.95% β-sheet: 0.00% Coil/Unstructured: 48.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF00691 | OmpA | 88.52 |
PF00486 | Trans_reg_C | 1.64 |
PF14464 | Prok-JAB | 0.82 |
PF13360 | PQQ_2 | 0.82 |
PF13533 | Biotin_lipoyl_2 | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.67 % |
Unclassified | root | N/A | 30.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000787|JGI11643J11755_11314631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300000953|JGI11615J12901_10228736 | Not Available | 549 | Open in IMG/M |
3300003319|soilL2_10030933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5960 | Open in IMG/M |
3300003321|soilH1_10077770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2000 | Open in IMG/M |
3300003322|rootL2_10168308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
3300003324|soilH2_10074444 | Not Available | 1099 | Open in IMG/M |
3300004052|Ga0055490_10173391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300004479|Ga0062595_102017027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300004480|Ga0062592_102653408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300004643|Ga0062591_102942277 | Not Available | 505 | Open in IMG/M |
3300005294|Ga0065705_10407481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
3300005332|Ga0066388_102589363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
3300005335|Ga0070666_11061896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300005406|Ga0070703_10354323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300005406|Ga0070703_10553427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300005441|Ga0070700_100830350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
3300005441|Ga0070700_101930076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300005457|Ga0070662_101418222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300005458|Ga0070681_11721295 | Not Available | 553 | Open in IMG/M |
3300005467|Ga0070706_101083156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300005518|Ga0070699_100239552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1619 | Open in IMG/M |
3300005518|Ga0070699_100328470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1375 | Open in IMG/M |
3300005546|Ga0070696_100133008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1812 | Open in IMG/M |
3300005546|Ga0070696_101884752 | Not Available | 518 | Open in IMG/M |
3300005547|Ga0070693_100323593 | Not Available | 1047 | Open in IMG/M |
3300005548|Ga0070665_102493242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300005577|Ga0068857_102054098 | Not Available | 561 | Open in IMG/M |
3300005578|Ga0068854_102080789 | Not Available | 524 | Open in IMG/M |
3300005615|Ga0070702_100069533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2075 | Open in IMG/M |
3300005615|Ga0070702_100784852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
3300005617|Ga0068859_101120468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
3300005617|Ga0068859_101351540 | Not Available | 785 | Open in IMG/M |
3300005617|Ga0068859_102111238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300005719|Ga0068861_102160874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300005842|Ga0068858_101075446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
3300005842|Ga0068858_101109189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300006169|Ga0082029_1137861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
3300006755|Ga0079222_12471659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300006852|Ga0075433_11173937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300006854|Ga0075425_103086356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300006871|Ga0075434_102475543 | Not Available | 520 | Open in IMG/M |
3300006880|Ga0075429_100447470 | Not Available | 1132 | Open in IMG/M |
3300006894|Ga0079215_11190333 | Not Available | 579 | Open in IMG/M |
3300009093|Ga0105240_11837268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300009093|Ga0105240_12040171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300009101|Ga0105247_10162128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1481 | Open in IMG/M |
3300009101|Ga0105247_11493306 | Not Available | 551 | Open in IMG/M |
3300009148|Ga0105243_10407131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1265 | Open in IMG/M |
3300009148|Ga0105243_12114291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300009177|Ga0105248_13308255 | Not Available | 512 | Open in IMG/M |
3300009545|Ga0105237_12027909 | Not Available | 584 | Open in IMG/M |
3300009553|Ga0105249_12283350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300009553|Ga0105249_12897069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300010166|Ga0126306_10655100 | Not Available | 840 | Open in IMG/M |
3300010166|Ga0126306_10713137 | Not Available | 805 | Open in IMG/M |
3300010359|Ga0126376_12189451 | Not Available | 598 | Open in IMG/M |
3300010397|Ga0134124_10269488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1574 | Open in IMG/M |
3300010397|Ga0134124_12619953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300010400|Ga0134122_12325390 | Not Available | 582 | Open in IMG/M |
3300010403|Ga0134123_11357369 | Not Available | 749 | Open in IMG/M |
3300012212|Ga0150985_120868994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
3300012960|Ga0164301_10739914 | Not Available | 745 | Open in IMG/M |
3300013100|Ga0157373_10693260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
3300013102|Ga0157371_10198177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1439 | Open in IMG/M |
3300013296|Ga0157374_10233311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1808 | Open in IMG/M |
3300013297|Ga0157378_12452708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300013306|Ga0163162_10010186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 9131 | Open in IMG/M |
3300013306|Ga0163162_11701294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300013308|Ga0157375_13420597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300013308|Ga0157375_13811489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300014268|Ga0075309_1114076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
3300015372|Ga0132256_102067471 | Not Available | 675 | Open in IMG/M |
3300015374|Ga0132255_105156917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 553 | Open in IMG/M |
3300018429|Ga0190272_11905647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300018429|Ga0190272_13093312 | Not Available | 517 | Open in IMG/M |
3300018476|Ga0190274_10592012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
3300021184|Ga0196959_10044269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
3300024251|Ga0247679_1081327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300024330|Ga0137417_1495815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3420 | Open in IMG/M |
3300025885|Ga0207653_10197589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300025900|Ga0207710_10366089 | Not Available | 736 | Open in IMG/M |
3300025900|Ga0207710_10678158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300025901|Ga0207688_10392499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
3300025907|Ga0207645_10439105 | Not Available | 880 | Open in IMG/M |
3300025911|Ga0207654_11391325 | Not Available | 512 | Open in IMG/M |
3300025914|Ga0207671_10116401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2039 | Open in IMG/M |
3300025920|Ga0207649_11023603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300025920|Ga0207649_11609058 | Not Available | 514 | Open in IMG/M |
3300025922|Ga0207646_10885010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
3300025924|Ga0207694_11324293 | Not Available | 609 | Open in IMG/M |
3300025933|Ga0207706_11129769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300025935|Ga0207709_11079512 | Not Available | 659 | Open in IMG/M |
3300025940|Ga0207691_10653252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
3300025941|Ga0207711_12051735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300025944|Ga0207661_11658409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300025945|Ga0207679_10660605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
3300025949|Ga0207667_11044217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
3300025960|Ga0207651_11201211 | Not Available | 681 | Open in IMG/M |
3300025961|Ga0207712_10034115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3446 | Open in IMG/M |
3300025961|Ga0207712_11117618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
3300025981|Ga0207640_11457853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300026035|Ga0207703_11057833 | Not Available | 779 | Open in IMG/M |
3300026035|Ga0207703_11070361 | Not Available | 774 | Open in IMG/M |
3300026075|Ga0207708_11870494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300026078|Ga0207702_11647907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
3300026088|Ga0207641_10275705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1580 | Open in IMG/M |
3300026089|Ga0207648_10128729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2228 | Open in IMG/M |
3300026089|Ga0207648_11363703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 666 | Open in IMG/M |
3300026089|Ga0207648_12036603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300026095|Ga0207676_10939853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
3300026118|Ga0207675_100891603 | Not Available | 905 | Open in IMG/M |
3300026142|Ga0207698_11755621 | Not Available | 636 | Open in IMG/M |
3300026142|Ga0207698_12208734 | Not Available | 563 | Open in IMG/M |
3300027266|Ga0209215_1005737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1437 | Open in IMG/M |
3300027886|Ga0209486_10636196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 681 | Open in IMG/M |
3300027909|Ga0209382_10362067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1622 | Open in IMG/M |
3300028379|Ga0268266_10547304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
3300031226|Ga0307497_10178476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
3300031547|Ga0310887_10466189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
3300031824|Ga0307413_10060025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2339 | Open in IMG/M |
3300032012|Ga0310902_11090207 | Not Available | 558 | Open in IMG/M |
3300033179|Ga0307507_10556356 | Not Available | 603 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.30% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.02% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 8.20% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.10% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.10% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.28% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.28% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.46% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.46% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.46% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.64% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.64% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.64% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.82% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.82% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.82% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.82% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11643J11755_113146311 | 3300000787 | Soil | MFPLDPLEILQVVGYGVGALLPLWLAVQLVSHREKLSSLERLLALLAVTMGGWHT |
JGI11615J12901_102287362 | 3300000953 | Soil | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNI |
soilL2_100309337 | 3300003319 | Sugarcane Root And Bulk Soil | MSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLTNIERLLAL |
soilH1_100777701 | 3300003321 | Sugarcane Root And Bulk Soil | MSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLTNIERLLALL |
rootL2_101683082 | 3300003322 | Sugarcane Root And Bulk Soil | LIAMSPLDPLEILQVIGYSIGAMLPLWMLFQLVTHRSKLTNIE |
soilH2_100744441 | 3300003324 | Sugarcane Root And Bulk Soil | MSPLDPLEILQVIGYSIGAMLPLWMLFQLVTHRSKLTNIERLLALLALT |
Ga0055490_101733911 | 3300004052 | Natural And Restored Wetlands | MSPLDPLQILQLVGYSIGALLPLWMAVQLVRNRSHLAPHERMLA |
Ga0062595_1020170272 | 3300004479 | Soil | MSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLALTMAGWHTSN |
Ga0062592_1026534081 | 3300004480 | Soil | MFPLDPLEILQVIGYSVGALLPLWMAVQLVLHRSKLSSLERLLAALALTMGGWHTS |
Ga0062591_1029422771 | 3300004643 | Soil | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSNLSNIERILALLALT |
Ga0065705_104074811 | 3300005294 | Switchgrass Rhizosphere | MSPLDPLQILQLVGYSVGALLPLWMAIQLVSHRNRLTSLERMLALLALTMGG |
Ga0066388_1025893631 | 3300005332 | Tropical Forest Soil | MFPLDPLEILQVIGYSIGALLPLWMAVQLVRRRTKLTSLERLLAALAL |
Ga0070666_110618961 | 3300005335 | Switchgrass Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALTMGGWHT |
Ga0070703_103543231 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRDKLTSIERILAALALTMGGWHT |
Ga0070703_105534272 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWLLFQLVTHRNKLTNIERILAALALTMGGWHTSNL |
Ga0070700_1008303501 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSKLSNIER |
Ga0070700_1019300762 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWLLFQLVTHRNKLTNIERILAALAL |
Ga0070662_1014182221 | 3300005457 | Corn Rhizosphere | MSPLEILQLVGYSVGALLPMWMAYQLVSNRNRLTSLERMLFALALTMGG |
Ga0070681_117212952 | 3300005458 | Corn Rhizosphere | LFPLDPLEILQVIGYSVGALLPLWMAVQLVLTRRKLSSLERLLAALALTMGGWH |
Ga0070706_1010831562 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLQILQLVGYSVGALLPLWMAVQLVTHRNRLTSLERMLA |
Ga0070699_1002395522 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLQILQLVGYSIGALLPLWMAVQLVSHRSKLTSLERMLALLALTMGG |
Ga0070699_1003284702 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERLLALLALTMGGWHT |
Ga0070696_1001330081 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLAITMGG |
Ga0070696_1018847521 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLQILQIVGYSIGALLPTWMAIQLVSNRAKLTSLERMLALLALTMGGWHTSNLV |
Ga0070693_1003235931 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MFPLDPLEILQVIGYSVGALLPLWMAVQLVLTKRKLSSLERLLAALALTMGGWHTSNL |
Ga0070665_1024932421 | 3300005548 | Switchgrass Rhizosphere | MFPLDPLEILQVVGYGVGALLPLWLAVQLVSHREKLSSLERL |
Ga0068857_1020540982 | 3300005577 | Corn Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSSLTNIERLLALLALTMGGWHTSNLV |
Ga0068854_1020807892 | 3300005578 | Corn Rhizosphere | MSPLDPLQILQIIGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLALTMGGWHT |
Ga0070702_1000695333 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWLLFQLVTHRNKLTNIERIL |
Ga0070702_1007848521 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLEILQVIGYSVGALLPLWMAVQLVLTRRKLTTLERLLAALALTM |
Ga0068859_1011204681 | 3300005617 | Switchgrass Rhizosphere | MSPLDPLEILQVIGYSVGALLPLWMAVQLVLHRSKLSPLERLLAALALTMGGWH |
Ga0068859_1013515402 | 3300005617 | Switchgrass Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERLL |
Ga0068859_1021112381 | 3300005617 | Switchgrass Rhizosphere | MSPLDPLEILQVIGYGIGASLPLWMLFQLITHRSKLTNIERIL |
Ga0068861_1021608742 | 3300005719 | Switchgrass Rhizosphere | MSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSKL |
Ga0068858_1010754461 | 3300005842 | Switchgrass Rhizosphere | MSPLDPLEILQLVGYSVGALLPVWMAIQLVAHRSKLTSLERMLALLALTMG |
Ga0068858_1011091891 | 3300005842 | Switchgrass Rhizosphere | MSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSKLSNIERLLALL |
Ga0082029_11378612 | 3300006169 | Termite Nest | MSPLHLLEILHVFGYSIGALLPLWMLFQLVTHRSKLSDIERLLALLAATMGGWH |
Ga0079222_124716592 | 3300006755 | Agricultural Soil | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLSSIER |
Ga0075433_111739372 | 3300006852 | Populus Rhizosphere | MSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLA |
Ga0075425_1030863561 | 3300006854 | Populus Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLISHRSRLSNIERLLAAL |
Ga0075434_1024755432 | 3300006871 | Populus Rhizosphere | MSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLAITMGGWHTSNLII |
Ga0075429_1004474701 | 3300006880 | Populus Rhizosphere | MSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSK |
Ga0079215_111903332 | 3300006894 | Agricultural Soil | MSPLDPHEILQVIGYSIGALLPLWMLFQLVTHRSKLTSI |
Ga0105240_118372681 | 3300009093 | Corn Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSDIERLLALLALTMGGWHTSNL |
Ga0105240_120401711 | 3300009093 | Corn Rhizosphere | MSPLEPLEILQVIGYSIGALLPLWMLSQLVTHRSKLSNIERLLALLA |
Ga0105247_101621282 | 3300009101 | Switchgrass Rhizosphere | MSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLA |
Ga0105247_114933061 | 3300009101 | Switchgrass Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALTMG |
Ga0105243_104071311 | 3300009148 | Miscanthus Rhizosphere | MSPLDPLQILQLVGYSVGALLPLWMAVQLVTHRNRLTSLERMLALLAL |
Ga0105243_121142912 | 3300009148 | Miscanthus Rhizosphere | MSPLDPLQILQIVGYSIGALLPTWMAIQLVTHRAKLT |
Ga0105248_133082552 | 3300009177 | Switchgrass Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALTMGGWHTSNLV |
Ga0105237_120279092 | 3300009545 | Corn Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIE |
Ga0105249_122833502 | 3300009553 | Switchgrass Rhizosphere | MSPLDPLQILQLVGYSVGALLPLWMAIQLVKHRAKLTSLERMLALLALTMGGWHT |
Ga0105249_128970692 | 3300009553 | Switchgrass Rhizosphere | MFPLDPLEILQVVGYSVGALLPLWLAVQLVSHRKTLSSLERLLALLAVTMGGWHTSN |
Ga0126306_106551002 | 3300010166 | Serpentine Soil | MSPLDPLEILQVIGYSIGALLPLWMVFQLVSHRSKLTSIERLLAALALTMGGWHTSNLA |
Ga0126306_107131372 | 3300010166 | Serpentine Soil | MSPLDPHEILQVIGYSIGALLPLWMLLQLVTHRNNLTSIERILALLALTMGGWH |
Ga0126376_121894512 | 3300010359 | Tropical Forest Soil | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLS |
Ga0134124_102694882 | 3300010397 | Terrestrial Soil | MFPLDPLEILQVVGYGVGALLPLWLAVQLVSHREKLSSLERLLALLAVTMGGW |
Ga0134124_126199532 | 3300010397 | Terrestrial Soil | MSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRARLTSLERMLALL |
Ga0134122_123253901 | 3300010400 | Terrestrial Soil | MSPLEPLEILQVIGYSIGAMLPLWMLFQLVTHRSKLTDIERLLALL |
Ga0134123_113573691 | 3300010403 | Terrestrial Soil | MSPLEILQLVGYSVGALLPLWMAFQLVSHRTTLTPTERLLACLALTMG |
Ga0150985_1208689941 | 3300012212 | Avena Fatua Rhizosphere | MSPLDPLQILQLVGYSVGALLPLWMAIQLVNHRSKLPPLE |
Ga0164301_107399141 | 3300012960 | Soil | MSPLDPLQILQIIGYSIGALLPTWMAIQLVRHRTNLTSLERMLALLALT |
Ga0157373_106932602 | 3300013100 | Corn Rhizosphere | LFPLDPLEILQVIGYSVGALLPLWMAVQLVLTRRKLSSLERLLAALALTMGGWHTSNLVI |
Ga0157371_101981771 | 3300013102 | Corn Rhizosphere | MFPLDPLEILQVVGYSVGALLPLWLAVQLVSHRKTLSSLERLLALLAVTMGGWHTSNL |
Ga0157374_102333112 | 3300013296 | Miscanthus Rhizosphere | MSPLDPLEILQLVGYSVGALLPLWMAIQLVSHRSKLTSLERMLALLAL |
Ga0157378_124527081 | 3300013297 | Miscanthus Rhizosphere | MFPLDPLEILQVVGYSVGALLPLWLAVQLVSHRKT |
Ga0163162_1001018610 | 3300013306 | Switchgrass Rhizosphere | MFLASMSPLDPLQILQLVGYSVGAILPIFMAVQLVRNR |
Ga0163162_117012941 | 3300013306 | Switchgrass Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVRHRSKLTSIEQLLA |
Ga0157375_134205971 | 3300013308 | Miscanthus Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALT |
Ga0157375_138114891 | 3300013308 | Miscanthus Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMAVQLVRHRDKLTNVERILAALALT |
Ga0075309_11140761 | 3300014268 | Natural And Restored Wetlands | MSPLDPLEILQVIGYSIGALLPLWMLVQLVTHRSKLTNIE |
Ga0132256_1020674711 | 3300015372 | Arabidopsis Rhizosphere | MSALEILQLVGYSVGALLPLWMAFQLVSHRTTLTPTERLLACLALTM |
Ga0132255_1051569172 | 3300015374 | Arabidopsis Rhizosphere | MSPLEILQLVGYSVGALLPLWMAFQLVSHRTTLTPTERLLACLALTMGGWHM |
Ga0190272_119056471 | 3300018429 | Soil | MSPLDPLEILQVIGYSVGALLPLWMAVQLVLHRSKLTTLERLLAALALTMAGWHTSNLA |
Ga0190272_130933121 | 3300018429 | Soil | MSPLDPLEILQVIGYSIGAVLPLWMVVQLVTHRRKLTIIER |
Ga0190274_105920122 | 3300018476 | Soil | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTDIERLLALLA |
Ga0196959_100442692 | 3300021184 | Soil | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTSIERILAALALTMGGWHTSNL |
Ga0247679_10813271 | 3300024251 | Soil | MFPLEPLEILQVIGYSIGALLPLWLAVQLVLHRSRLSNLERLLAALALTMGGW |
Ga0137417_14958151 | 3300024330 | Vadose Zone Soil | MSPLDILQLVGYSIAALLPLWMAVQLVSHRARLTSLERMLFALALTM |
Ga0207653_101975891 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRDKLTSIERILAALALTMG |
Ga0207710_103660892 | 3300025900 | Switchgrass Rhizosphere | MSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNI |
Ga0207710_106781582 | 3300025900 | Switchgrass Rhizosphere | MSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLAL |
Ga0207688_103924991 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLDPLEILQVIGYTIGALLPLWMAVQLVRRRTKLTNIERMLAAL |
Ga0207645_104391051 | 3300025907 | Miscanthus Rhizosphere | MSPLDPLEILQVIGYSIGAVLPLWMLFQLVTHRSKLTNIERLLALLALT |
Ga0207654_113913252 | 3300025911 | Corn Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERL |
Ga0207671_101164013 | 3300025914 | Corn Rhizosphere | MSPLEPLEILQVIGYSIGALLPLWMLYQLVTHRSKL |
Ga0207649_110236032 | 3300025920 | Corn Rhizosphere | MSPLDPLQILQLVGYSVGALLPLWMAVQLVTHRNRLTSLERMLALLALT |
Ga0207649_116090581 | 3300025920 | Corn Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLAL |
Ga0207646_108850102 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MFPLDPLEILQVIGYSVGALLPLWMAVQLVLHRSKLSRLETLLAALALTMG |
Ga0207694_113242932 | 3300025924 | Corn Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERLLALLALTMGGW |
Ga0207706_111297691 | 3300025933 | Corn Rhizosphere | MSPLDPLEILQVIGYSIGATLPLWMLFQLITHRSKLTDIERLLALLALTMGGWHTS |
Ga0207709_110795121 | 3300025935 | Miscanthus Rhizosphere | MSALEILQLVGYSVGALLPLWMAFQLVSHRTTLSSTERLLACLA |
Ga0207691_106532522 | 3300025940 | Miscanthus Rhizosphere | MFLASMSPLDPLQILQLVGYSVGAILPIFMAVQLVRNRGRLTSLERMLALLAL |
Ga0207711_120517352 | 3300025941 | Switchgrass Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVRHRSKLSNIERLLAL |
Ga0207661_116584091 | 3300025944 | Corn Rhizosphere | MSPLDPLEILQLVGYSVGALLPLWMAIQLVSHRSKLTA |
Ga0207679_106606052 | 3300025945 | Corn Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMAVQLVRHRAKLTSVERLLAALA |
Ga0207667_110442172 | 3300025949 | Corn Rhizosphere | MSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLALTMAG |
Ga0207651_112012112 | 3300025960 | Switchgrass Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALTMGGW |
Ga0207712_100341151 | 3300025961 | Switchgrass Rhizosphere | MSPLDPLQILQLVGYSVGALLPLWMAVQLVTHRNRLTSLERMLALLALTMGG |
Ga0207712_111176182 | 3300025961 | Switchgrass Rhizosphere | MSPLDPLEILQVIGYTIGALLPLWMAVQLVRRRTKLTNIERMLAALALTMGGWHTSN |
Ga0207640_114578532 | 3300025981 | Corn Rhizosphere | MSPLDPLEILQVIGYTIGALLPLWMLFQLVTHRSKLTSMERILALLALTMGGWHTSN |
Ga0207703_110578331 | 3300026035 | Switchgrass Rhizosphere | MSALEILQLVGYSVGALLPLWMAFQLVSHRTTLSSTERLLACLALTMGGW |
Ga0207703_110703612 | 3300026035 | Switchgrass Rhizosphere | MSPLDPLEILQVIGYSIGALLPLWMFFQLVTHRTKLTSIER |
Ga0207708_118704942 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRDKLSNMERLLALLALTMGG |
Ga0207702_116479071 | 3300026078 | Corn Rhizosphere | MSPLDPLEILQVIGYSIGAVLPLWMLFQLVTHRSKLTNIERLLALLALTMGGWHTS |
Ga0207641_102757052 | 3300026088 | Switchgrass Rhizosphere | MSPLDPLEILQLVGYSVGALLPLWMAIQLVSHRSKLTALERMLALL |
Ga0207648_101287293 | 3300026089 | Miscanthus Rhizosphere | MSPLDPLEILQVIGYSIGAMLPLWMLFQLVTHRSKLTDIERLLALLALTMGG |
Ga0207648_113637031 | 3300026089 | Miscanthus Rhizosphere | MSPLDPLEILQLVGYSVGALLPLWMAIQLVSHRSKLTALERMLALLA |
Ga0207648_120366032 | 3300026089 | Miscanthus Rhizosphere | MSPLDPLEILQLVGYSVGALLPVWMAIQLVAHRSKLTSLERMLALLA |
Ga0207676_109398532 | 3300026095 | Switchgrass Rhizosphere | MSPLDPHEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALTMGGWH |
Ga0207675_1008916033 | 3300026118 | Switchgrass Rhizosphere | MSALEILQLVGYSVGALLPLWMAFQLVSHRTTLSSTERLLACLALTMG |
Ga0207698_117556211 | 3300026142 | Corn Rhizosphere | MSPLDPLEILQVIGYTIGALLPLWMAVQLVRRRTKLTNIERMLAALALTMG |
Ga0207698_122087341 | 3300026142 | Corn Rhizosphere | LFISMSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERLLALLALTMG |
Ga0209215_10057371 | 3300027266 | Forest Soil | MPMFPLNPLEILQVIGYSVGALLPLWMAVQLVLHRSKLSSLERLLAALALTMGGWH |
Ga0209486_106361962 | 3300027886 | Agricultural Soil | MSPLDPHEILQVIGYSIGALLPLWMAVQLVRHRKKL |
Ga0209382_103620671 | 3300027909 | Populus Rhizosphere | MSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTSI |
Ga0268266_105473041 | 3300028379 | Switchgrass Rhizosphere | MFPLDPLEILQVVGYGVGALLPLWLAVQLVSHREKLSSLERVLALLAVTMGGWHTSNLLI |
Ga0307497_101784761 | 3300031226 | Soil | MSPLDPLQILQLVGYSVGALIPLWMAVQLVTHRNRL |
Ga0310887_104661892 | 3300031547 | Soil | VSPLEILQVVGYSIGAVLPLWMAFQLVTHRTKLTAHERLLAALALTMGG |
Ga0307413_100600251 | 3300031824 | Rhizosphere | MSPLEPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIER |
Ga0310902_110902071 | 3300032012 | Soil | MSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERLLALLALTMGGWHTS |
Ga0307507_105563562 | 3300033179 | Ectomycorrhiza | MSPLEPLEILQVIGYGIGALLPLWMLFQLVTHRSKLSNIERLLALLA |
⦗Top⦘ |