NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F071624

Metagenome Family F071624

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071624
Family Type Metagenome
Number of Sequences 122
Average Sequence Length 48 residues
Representative Sequence MSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALT
Number of Associated Samples 98
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 31.15 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.62 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.672 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(12.295 % of family members)
Environment Ontology (ENVO) Unclassified
(54.918 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(73.770 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 51.95%    β-sheet: 0.00%    Coil/Unstructured: 48.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF00691OmpA 88.52
PF00486Trans_reg_C 1.64
PF14464Prok-JAB 0.82
PF13360PQQ_2 0.82
PF13533Biotin_lipoyl_2 0.82



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.67 %
UnclassifiedrootN/A30.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000787|JGI11643J11755_11314631All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300000953|JGI11615J12901_10228736Not Available549Open in IMG/M
3300003319|soilL2_10030933All Organisms → cellular organisms → Bacteria → Acidobacteria5960Open in IMG/M
3300003321|soilH1_10077770All Organisms → cellular organisms → Bacteria → Acidobacteria2000Open in IMG/M
3300003322|rootL2_10168308All Organisms → cellular organisms → Bacteria → Acidobacteria1428Open in IMG/M
3300003324|soilH2_10074444Not Available1099Open in IMG/M
3300004052|Ga0055490_10173391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300004479|Ga0062595_102017027All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300004480|Ga0062592_102653408All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300004643|Ga0062591_102942277Not Available505Open in IMG/M
3300005294|Ga0065705_10407481All Organisms → cellular organisms → Bacteria → Acidobacteria871Open in IMG/M
3300005332|Ga0066388_102589363All Organisms → cellular organisms → Bacteria → Acidobacteria924Open in IMG/M
3300005335|Ga0070666_11061896All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300005406|Ga0070703_10354323All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300005406|Ga0070703_10553427All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300005441|Ga0070700_100830350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300005441|Ga0070700_101930076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300005457|Ga0070662_101418222All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300005458|Ga0070681_11721295Not Available553Open in IMG/M
3300005467|Ga0070706_101083156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300005518|Ga0070699_100239552All Organisms → cellular organisms → Bacteria → Acidobacteria1619Open in IMG/M
3300005518|Ga0070699_100328470All Organisms → cellular organisms → Bacteria → Acidobacteria1375Open in IMG/M
3300005546|Ga0070696_100133008All Organisms → cellular organisms → Bacteria → Acidobacteria1812Open in IMG/M
3300005546|Ga0070696_101884752Not Available518Open in IMG/M
3300005547|Ga0070693_100323593Not Available1047Open in IMG/M
3300005548|Ga0070665_102493242All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300005577|Ga0068857_102054098Not Available561Open in IMG/M
3300005578|Ga0068854_102080789Not Available524Open in IMG/M
3300005615|Ga0070702_100069533All Organisms → cellular organisms → Bacteria → Acidobacteria2075Open in IMG/M
3300005615|Ga0070702_100784852All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300005617|Ga0068859_101120468All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300005617|Ga0068859_101351540Not Available785Open in IMG/M
3300005617|Ga0068859_102111238All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300005719|Ga0068861_102160874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300005842|Ga0068858_101075446All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium789Open in IMG/M
3300005842|Ga0068858_101109189All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300006169|Ga0082029_1137861All Organisms → cellular organisms → Bacteria → Acidobacteria1138Open in IMG/M
3300006755|Ga0079222_12471659All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300006852|Ga0075433_11173937All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium667Open in IMG/M
3300006854|Ga0075425_103086356All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300006871|Ga0075434_102475543Not Available520Open in IMG/M
3300006880|Ga0075429_100447470Not Available1132Open in IMG/M
3300006894|Ga0079215_11190333Not Available579Open in IMG/M
3300009093|Ga0105240_11837268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300009093|Ga0105240_12040171All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300009101|Ga0105247_10162128All Organisms → cellular organisms → Bacteria → Acidobacteria1481Open in IMG/M
3300009101|Ga0105247_11493306Not Available551Open in IMG/M
3300009148|Ga0105243_10407131All Organisms → cellular organisms → Bacteria → Acidobacteria1265Open in IMG/M
3300009148|Ga0105243_12114291All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300009177|Ga0105248_13308255Not Available512Open in IMG/M
3300009545|Ga0105237_12027909Not Available584Open in IMG/M
3300009553|Ga0105249_12283350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300009553|Ga0105249_12897069All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300010166|Ga0126306_10655100Not Available840Open in IMG/M
3300010166|Ga0126306_10713137Not Available805Open in IMG/M
3300010359|Ga0126376_12189451Not Available598Open in IMG/M
3300010397|Ga0134124_10269488All Organisms → cellular organisms → Bacteria → Acidobacteria1574Open in IMG/M
3300010397|Ga0134124_12619953All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300010400|Ga0134122_12325390Not Available582Open in IMG/M
3300010403|Ga0134123_11357369Not Available749Open in IMG/M
3300012212|Ga0150985_120868994All Organisms → cellular organisms → Bacteria → Acidobacteria1000Open in IMG/M
3300012960|Ga0164301_10739914Not Available745Open in IMG/M
3300013100|Ga0157373_10693260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium746Open in IMG/M
3300013102|Ga0157371_10198177All Organisms → cellular organisms → Bacteria → Acidobacteria1439Open in IMG/M
3300013296|Ga0157374_10233311All Organisms → cellular organisms → Bacteria → Acidobacteria1808Open in IMG/M
3300013297|Ga0157378_12452708All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300013306|Ga0163162_10010186All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes9131Open in IMG/M
3300013306|Ga0163162_11701294All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300013308|Ga0157375_13420597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300013308|Ga0157375_13811489All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300014268|Ga0075309_1114076All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300015372|Ga0132256_102067471Not Available675Open in IMG/M
3300015374|Ga0132255_105156917All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes553Open in IMG/M
3300018429|Ga0190272_11905647All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300018429|Ga0190272_13093312Not Available517Open in IMG/M
3300018476|Ga0190274_10592012All Organisms → cellular organisms → Bacteria → Acidobacteria1133Open in IMG/M
3300021184|Ga0196959_10044269All Organisms → cellular organisms → Bacteria → Acidobacteria907Open in IMG/M
3300024251|Ga0247679_1081327All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300024330|Ga0137417_1495815All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes3420Open in IMG/M
3300025885|Ga0207653_10197589All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium757Open in IMG/M
3300025900|Ga0207710_10366089Not Available736Open in IMG/M
3300025900|Ga0207710_10678158All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300025901|Ga0207688_10392499All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300025907|Ga0207645_10439105Not Available880Open in IMG/M
3300025911|Ga0207654_11391325Not Available512Open in IMG/M
3300025914|Ga0207671_10116401All Organisms → cellular organisms → Bacteria → Acidobacteria2039Open in IMG/M
3300025920|Ga0207649_11023603All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300025920|Ga0207649_11609058Not Available514Open in IMG/M
3300025922|Ga0207646_10885010All Organisms → cellular organisms → Bacteria → Acidobacteria793Open in IMG/M
3300025924|Ga0207694_11324293Not Available609Open in IMG/M
3300025933|Ga0207706_11129769All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300025935|Ga0207709_11079512Not Available659Open in IMG/M
3300025940|Ga0207691_10653252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium888Open in IMG/M
3300025941|Ga0207711_12051735All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300025944|Ga0207661_11658409All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300025945|Ga0207679_10660605All Organisms → cellular organisms → Bacteria → Acidobacteria946Open in IMG/M
3300025949|Ga0207667_11044217All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300025960|Ga0207651_11201211Not Available681Open in IMG/M
3300025961|Ga0207712_10034115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3446Open in IMG/M
3300025961|Ga0207712_11117618All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300025981|Ga0207640_11457853All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300026035|Ga0207703_11057833Not Available779Open in IMG/M
3300026035|Ga0207703_11070361Not Available774Open in IMG/M
3300026075|Ga0207708_11870494All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300026078|Ga0207702_11647907All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300026088|Ga0207641_10275705All Organisms → cellular organisms → Bacteria → Acidobacteria1580Open in IMG/M
3300026089|Ga0207648_10128729All Organisms → cellular organisms → Bacteria → Acidobacteria2228Open in IMG/M
3300026089|Ga0207648_11363703All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium666Open in IMG/M
3300026089|Ga0207648_12036603All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300026095|Ga0207676_10939853All Organisms → cellular organisms → Bacteria → Acidobacteria850Open in IMG/M
3300026118|Ga0207675_100891603Not Available905Open in IMG/M
3300026142|Ga0207698_11755621Not Available636Open in IMG/M
3300026142|Ga0207698_12208734Not Available563Open in IMG/M
3300027266|Ga0209215_1005737All Organisms → cellular organisms → Bacteria → Acidobacteria1437Open in IMG/M
3300027886|Ga0209486_10636196All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium681Open in IMG/M
3300027909|Ga0209382_10362067All Organisms → cellular organisms → Bacteria → Acidobacteria1622Open in IMG/M
3300028379|Ga0268266_10547304All Organisms → cellular organisms → Bacteria → Acidobacteria1109Open in IMG/M
3300031226|Ga0307497_10178476All Organisms → cellular organisms → Bacteria → Acidobacteria904Open in IMG/M
3300031547|Ga0310887_10466189All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300031824|Ga0307413_10060025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2339Open in IMG/M
3300032012|Ga0310902_11090207Not Available558Open in IMG/M
3300033179|Ga0307507_10556356Not Available603Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere12.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere9.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere8.20%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.10%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.10%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.28%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.46%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.46%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil2.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.46%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.64%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.64%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.82%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.82%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.82%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.82%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.82%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003322Sugarcane root Sample L2Host-AssociatedOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014268Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021184Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027266Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J11755_1131463113300000787SoilMFPLDPLEILQVVGYGVGALLPLWLAVQLVSHREKLSSLERLLALLAVTMGGWHT
JGI11615J12901_1022873623300000953SoilMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNI
soilL2_1003093373300003319Sugarcane Root And Bulk SoilMSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLTNIERLLAL
soilH1_1007777013300003321Sugarcane Root And Bulk SoilMSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLTNIERLLALL
rootL2_1016830823300003322Sugarcane Root And Bulk SoilLIAMSPLDPLEILQVIGYSIGAMLPLWMLFQLVTHRSKLTNIE
soilH2_1007444413300003324Sugarcane Root And Bulk SoilMSPLDPLEILQVIGYSIGAMLPLWMLFQLVTHRSKLTNIERLLALLALT
Ga0055490_1017339113300004052Natural And Restored WetlandsMSPLDPLQILQLVGYSIGALLPLWMAVQLVRNRSHLAPHERMLA
Ga0062595_10201702723300004479SoilMSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLALTMAGWHTSN
Ga0062592_10265340813300004480SoilMFPLDPLEILQVIGYSVGALLPLWMAVQLVLHRSKLSSLERLLAALALTMGGWHTS
Ga0062591_10294227713300004643SoilMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSNLSNIERILALLALT
Ga0065705_1040748113300005294Switchgrass RhizosphereMSPLDPLQILQLVGYSVGALLPLWMAIQLVSHRNRLTSLERMLALLALTMGG
Ga0066388_10258936313300005332Tropical Forest SoilMFPLDPLEILQVIGYSIGALLPLWMAVQLVRRRTKLTSLERLLAALAL
Ga0070666_1106189613300005335Switchgrass RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALTMGGWHT
Ga0070703_1035432313300005406Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRDKLTSIERILAALALTMGGWHT
Ga0070703_1055342723300005406Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLEILQVIGYSIGALLPLWLLFQLVTHRNKLTNIERILAALALTMGGWHTSNL
Ga0070700_10083035013300005441Corn, Switchgrass And Miscanthus RhizosphereMSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSKLSNIER
Ga0070700_10193007623300005441Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLEILQVIGYSIGALLPLWLLFQLVTHRNKLTNIERILAALAL
Ga0070662_10141822213300005457Corn RhizosphereMSPLEILQLVGYSVGALLPMWMAYQLVSNRNRLTSLERMLFALALTMGG
Ga0070681_1172129523300005458Corn RhizosphereLFPLDPLEILQVIGYSVGALLPLWMAVQLVLTRRKLSSLERLLAALALTMGGWH
Ga0070706_10108315623300005467Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLQILQLVGYSVGALLPLWMAVQLVTHRNRLTSLERMLA
Ga0070699_10023955223300005518Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLQILQLVGYSIGALLPLWMAVQLVSHRSKLTSLERMLALLALTMGG
Ga0070699_10032847023300005518Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERLLALLALTMGGWHT
Ga0070696_10013300813300005546Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLAITMGG
Ga0070696_10188475213300005546Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLQILQIVGYSIGALLPTWMAIQLVSNRAKLTSLERMLALLALTMGGWHTSNLV
Ga0070693_10032359313300005547Corn, Switchgrass And Miscanthus RhizosphereMFPLDPLEILQVIGYSVGALLPLWMAVQLVLTKRKLSSLERLLAALALTMGGWHTSNL
Ga0070665_10249324213300005548Switchgrass RhizosphereMFPLDPLEILQVVGYGVGALLPLWLAVQLVSHREKLSSLERL
Ga0068857_10205409823300005577Corn RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSSLTNIERLLALLALTMGGWHTSNLV
Ga0068854_10208078923300005578Corn RhizosphereMSPLDPLQILQIIGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLALTMGGWHT
Ga0070702_10006953333300005615Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLEILQVIGYSIGALLPLWLLFQLVTHRNKLTNIERIL
Ga0070702_10078485213300005615Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLEILQVIGYSVGALLPLWMAVQLVLTRRKLTTLERLLAALALTM
Ga0068859_10112046813300005617Switchgrass RhizosphereMSPLDPLEILQVIGYSVGALLPLWMAVQLVLHRSKLSPLERLLAALALTMGGWH
Ga0068859_10135154023300005617Switchgrass RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERLL
Ga0068859_10211123813300005617Switchgrass RhizosphereMSPLDPLEILQVIGYGIGASLPLWMLFQLITHRSKLTNIERIL
Ga0068861_10216087423300005719Switchgrass RhizosphereMSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSKL
Ga0068858_10107544613300005842Switchgrass RhizosphereMSPLDPLEILQLVGYSVGALLPVWMAIQLVAHRSKLTSLERMLALLALTMG
Ga0068858_10110918913300005842Switchgrass RhizosphereMSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSKLSNIERLLALL
Ga0082029_113786123300006169Termite NestMSPLHLLEILHVFGYSIGALLPLWMLFQLVTHRSKLSDIERLLALLAATMGGWH
Ga0079222_1247165923300006755Agricultural SoilMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLSSIER
Ga0075433_1117393723300006852Populus RhizosphereMSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLA
Ga0075425_10308635613300006854Populus RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLISHRSRLSNIERLLAAL
Ga0075434_10247554323300006871Populus RhizosphereMSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLAITMGGWHTSNLII
Ga0075429_10044747013300006880Populus RhizosphereMSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSK
Ga0079215_1119033323300006894Agricultural SoilMSPLDPHEILQVIGYSIGALLPLWMLFQLVTHRSKLTSI
Ga0105240_1183726813300009093Corn RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSDIERLLALLALTMGGWHTSNL
Ga0105240_1204017113300009093Corn RhizosphereMSPLEPLEILQVIGYSIGALLPLWMLSQLVTHRSKLSNIERLLALLA
Ga0105247_1016212823300009101Switchgrass RhizosphereMSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLA
Ga0105247_1149330613300009101Switchgrass RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALTMG
Ga0105243_1040713113300009148Miscanthus RhizosphereMSPLDPLQILQLVGYSVGALLPLWMAVQLVTHRNRLTSLERMLALLAL
Ga0105243_1211429123300009148Miscanthus RhizosphereMSPLDPLQILQIVGYSIGALLPTWMAIQLVTHRAKLT
Ga0105248_1330825523300009177Switchgrass RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALTMGGWHTSNLV
Ga0105237_1202790923300009545Corn RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIE
Ga0105249_1228335023300009553Switchgrass RhizosphereMSPLDPLQILQLVGYSVGALLPLWMAIQLVKHRAKLTSLERMLALLALTMGGWHT
Ga0105249_1289706923300009553Switchgrass RhizosphereMFPLDPLEILQVVGYSVGALLPLWLAVQLVSHRKTLSSLERLLALLAVTMGGWHTSN
Ga0126306_1065510023300010166Serpentine SoilMSPLDPLEILQVIGYSIGALLPLWMVFQLVSHRSKLTSIERLLAALALTMGGWHTSNLA
Ga0126306_1071313723300010166Serpentine SoilMSPLDPHEILQVIGYSIGALLPLWMLLQLVTHRNNLTSIERILALLALTMGGWH
Ga0126376_1218945123300010359Tropical Forest SoilMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLS
Ga0134124_1026948823300010397Terrestrial SoilMFPLDPLEILQVVGYGVGALLPLWLAVQLVSHREKLSSLERLLALLAVTMGGW
Ga0134124_1261995323300010397Terrestrial SoilMSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRARLTSLERMLALL
Ga0134122_1232539013300010400Terrestrial SoilMSPLEPLEILQVIGYSIGAMLPLWMLFQLVTHRSKLTDIERLLALL
Ga0134123_1135736913300010403Terrestrial SoilMSPLEILQLVGYSVGALLPLWMAFQLVSHRTTLTPTERLLACLALTMG
Ga0150985_12086899413300012212Avena Fatua RhizosphereMSPLDPLQILQLVGYSVGALLPLWMAIQLVNHRSKLPPLE
Ga0164301_1073991413300012960SoilMSPLDPLQILQIIGYSIGALLPTWMAIQLVRHRTNLTSLERMLALLALT
Ga0157373_1069326023300013100Corn RhizosphereLFPLDPLEILQVIGYSVGALLPLWMAVQLVLTRRKLSSLERLLAALALTMGGWHTSNLVI
Ga0157371_1019817713300013102Corn RhizosphereMFPLDPLEILQVVGYSVGALLPLWLAVQLVSHRKTLSSLERLLALLAVTMGGWHTSNL
Ga0157374_1023331123300013296Miscanthus RhizosphereMSPLDPLEILQLVGYSVGALLPLWMAIQLVSHRSKLTSLERMLALLAL
Ga0157378_1245270813300013297Miscanthus RhizosphereMFPLDPLEILQVVGYSVGALLPLWLAVQLVSHRKT
Ga0163162_10010186103300013306Switchgrass RhizosphereMFLASMSPLDPLQILQLVGYSVGAILPIFMAVQLVRNR
Ga0163162_1170129413300013306Switchgrass RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVRHRSKLTSIEQLLA
Ga0157375_1342059713300013308Miscanthus RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALT
Ga0157375_1381148913300013308Miscanthus RhizosphereMSPLDPLEILQVIGYSIGALLPLWMAVQLVRHRDKLTNVERILAALALT
Ga0075309_111407613300014268Natural And Restored WetlandsMSPLDPLEILQVIGYSIGALLPLWMLVQLVTHRSKLTNIE
Ga0132256_10206747113300015372Arabidopsis RhizosphereMSALEILQLVGYSVGALLPLWMAFQLVSHRTTLTPTERLLACLALTM
Ga0132255_10515691723300015374Arabidopsis RhizosphereMSPLEILQLVGYSVGALLPLWMAFQLVSHRTTLTPTERLLACLALTMGGWHM
Ga0190272_1190564713300018429SoilMSPLDPLEILQVIGYSVGALLPLWMAVQLVLHRSKLTTLERLLAALALTMAGWHTSNLA
Ga0190272_1309331213300018429SoilMSPLDPLEILQVIGYSIGAVLPLWMVVQLVTHRRKLTIIER
Ga0190274_1059201223300018476SoilMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTDIERLLALLA
Ga0196959_1004426923300021184SoilMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTSIERILAALALTMGGWHTSNL
Ga0247679_108132713300024251SoilMFPLEPLEILQVIGYSIGALLPLWLAVQLVLHRSRLSNLERLLAALALTMGGW
Ga0137417_149581513300024330Vadose Zone SoilMSPLDILQLVGYSIAALLPLWMAVQLVSHRARLTSLERMLFALALTM
Ga0207653_1019758913300025885Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRDKLTSIERILAALALTMG
Ga0207710_1036608923300025900Switchgrass RhizosphereMSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNI
Ga0207710_1067815823300025900Switchgrass RhizosphereMSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLAL
Ga0207688_1039249913300025901Corn, Switchgrass And Miscanthus RhizosphereMSPLDPLEILQVIGYTIGALLPLWMAVQLVRRRTKLTNIERMLAAL
Ga0207645_1043910513300025907Miscanthus RhizosphereMSPLDPLEILQVIGYSIGAVLPLWMLFQLVTHRSKLTNIERLLALLALT
Ga0207654_1139132523300025911Corn RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERL
Ga0207671_1011640133300025914Corn RhizosphereMSPLEPLEILQVIGYSIGALLPLWMLYQLVTHRSKL
Ga0207649_1102360323300025920Corn RhizosphereMSPLDPLQILQLVGYSVGALLPLWMAVQLVTHRNRLTSLERMLALLALT
Ga0207649_1160905813300025920Corn RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLAL
Ga0207646_1088501023300025922Corn, Switchgrass And Miscanthus RhizosphereMFPLDPLEILQVIGYSVGALLPLWMAVQLVLHRSKLSRLETLLAALALTMG
Ga0207694_1132429323300025924Corn RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERLLALLALTMGGW
Ga0207706_1112976913300025933Corn RhizosphereMSPLDPLEILQVIGYSIGATLPLWMLFQLITHRSKLTDIERLLALLALTMGGWHTS
Ga0207709_1107951213300025935Miscanthus RhizosphereMSALEILQLVGYSVGALLPLWMAFQLVSHRTTLSSTERLLACLA
Ga0207691_1065325223300025940Miscanthus RhizosphereMFLASMSPLDPLQILQLVGYSVGAILPIFMAVQLVRNRGRLTSLERMLALLAL
Ga0207711_1205173523300025941Switchgrass RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVRHRSKLSNIERLLAL
Ga0207661_1165840913300025944Corn RhizosphereMSPLDPLEILQLVGYSVGALLPLWMAIQLVSHRSKLTA
Ga0207679_1066060523300025945Corn RhizosphereMSPLDPLEILQVIGYSIGALLPLWMAVQLVRHRAKLTSVERLLAALA
Ga0207667_1104421723300025949Corn RhizosphereMSPLDPLQILQIVGYSIGALLPTWMAIQLVSHRAKLTSLERMLALLALTMAG
Ga0207651_1120121123300025960Switchgrass RhizosphereMSPLDPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALTMGGW
Ga0207712_1003411513300025961Switchgrass RhizosphereMSPLDPLQILQLVGYSVGALLPLWMAVQLVTHRNRLTSLERMLALLALTMGG
Ga0207712_1111761823300025961Switchgrass RhizosphereMSPLDPLEILQVIGYTIGALLPLWMAVQLVRRRTKLTNIERMLAALALTMGGWHTSN
Ga0207640_1145785323300025981Corn RhizosphereMSPLDPLEILQVIGYTIGALLPLWMLFQLVTHRSKLTSMERILALLALTMGGWHTSN
Ga0207703_1105783313300026035Switchgrass RhizosphereMSALEILQLVGYSVGALLPLWMAFQLVSHRTTLSSTERLLACLALTMGGW
Ga0207703_1107036123300026035Switchgrass RhizosphereMSPLDPLEILQVIGYSIGALLPLWMFFQLVTHRTKLTSIER
Ga0207708_1187049423300026075Corn, Switchgrass And Miscanthus RhizosphereMSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRDKLSNMERLLALLALTMGG
Ga0207702_1164790713300026078Corn RhizosphereMSPLDPLEILQVIGYSIGAVLPLWMLFQLVTHRSKLTNIERLLALLALTMGGWHTS
Ga0207641_1027570523300026088Switchgrass RhizosphereMSPLDPLEILQLVGYSVGALLPLWMAIQLVSHRSKLTALERMLALL
Ga0207648_1012872933300026089Miscanthus RhizosphereMSPLDPLEILQVIGYSIGAMLPLWMLFQLVTHRSKLTDIERLLALLALTMGG
Ga0207648_1136370313300026089Miscanthus RhizosphereMSPLDPLEILQLVGYSVGALLPLWMAIQLVSHRSKLTALERMLALLA
Ga0207648_1203660323300026089Miscanthus RhizosphereMSPLDPLEILQLVGYSVGALLPVWMAIQLVAHRSKLTSLERMLALLA
Ga0207676_1093985323300026095Switchgrass RhizosphereMSPLDPHEILQVIGYSIGALLPLWMLFQLVTHRSKLTNIERLLALLALTMGGWH
Ga0207675_10089160333300026118Switchgrass RhizosphereMSALEILQLVGYSVGALLPLWMAFQLVSHRTTLSSTERLLACLALTMG
Ga0207698_1175562113300026142Corn RhizosphereMSPLDPLEILQVIGYTIGALLPLWMAVQLVRRRTKLTNIERMLAALALTMG
Ga0207698_1220873413300026142Corn RhizosphereLFISMSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERLLALLALTMG
Ga0209215_100573713300027266Forest SoilMPMFPLNPLEILQVIGYSVGALLPLWMAVQLVLHRSKLSSLERLLAALALTMGGWH
Ga0209486_1063619623300027886Agricultural SoilMSPLDPHEILQVIGYSIGALLPLWMAVQLVRHRKKL
Ga0209382_1036206713300027909Populus RhizosphereMSPLEPLEILQVIGYSIGALLPLWMLFQLVTHRSKLTSI
Ga0268266_1054730413300028379Switchgrass RhizosphereMFPLDPLEILQVVGYGVGALLPLWLAVQLVSHREKLSSLERVLALLAVTMGGWHTSNLLI
Ga0307497_1017847613300031226SoilMSPLDPLQILQLVGYSVGALIPLWMAVQLVTHRNRL
Ga0310887_1046618923300031547SoilVSPLEILQVVGYSIGAVLPLWMAFQLVTHRTKLTAHERLLAALALTMGG
Ga0307413_1006002513300031824RhizosphereMSPLEPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIER
Ga0310902_1109020713300032012SoilMSPLDPLEILQVIGYSIGALLPLWMLFQLITHRSKLSNIERLLALLALTMGGWHTS
Ga0307507_1055635623300033179EctomycorrhizaMSPLEPLEILQVIGYGIGALLPLWMLFQLVTHRSKLSNIERLLALLA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.