Basic Information | |
---|---|
Family ID | F071514 |
Family Type | Metagenome |
Number of Sequences | 122 |
Average Sequence Length | 40 residues |
Representative Sequence | MRLDPNTHAYVVATAFMTSVTFAIFAMNLLALVLSHLLN |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 16.67 % |
% of genes near scaffold ends (potentially truncated) | 21.31 % |
% of genes from short scaffolds (< 2000 bps) | 79.51 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (63.934 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.492 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.246 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF07452 | CHRD | 9.02 |
PF13365 | Trypsin_2 | 5.74 |
PF01523 | PmbA_TldD | 4.92 |
PF00682 | HMGL-like | 4.10 |
PF03176 | MMPL | 4.10 |
PF00486 | Trans_reg_C | 3.28 |
PF00196 | GerE | 1.64 |
PF00583 | Acetyltransf_1 | 1.64 |
PF02397 | Bac_transf | 1.64 |
PF01471 | PG_binding_1 | 1.64 |
PF00180 | Iso_dh | 1.64 |
PF09413 | DUF2007 | 1.64 |
PF03706 | LPG_synthase_TM | 1.64 |
PF03704 | BTAD | 1.64 |
PF01613 | Flavin_Reduct | 1.64 |
PF08241 | Methyltransf_11 | 1.64 |
PF12229 | PG_binding_4 | 0.82 |
PF04199 | Cyclase | 0.82 |
PF01494 | FAD_binding_3 | 0.82 |
PF08502 | LeuA_dimer | 0.82 |
PF00848 | Ring_hydroxyl_A | 0.82 |
PF01909 | NTP_transf_2 | 0.82 |
PF02350 | Epimerase_2 | 0.82 |
PF04794 | YdjC | 0.82 |
PF00067 | p450 | 0.82 |
PF01174 | SNO | 0.82 |
PF03372 | Exo_endo_phos | 0.82 |
PF13468 | Glyoxalase_3 | 0.82 |
PF04964 | Flp_Fap | 0.82 |
PF04234 | CopC | 0.82 |
PF01904 | DUF72 | 0.82 |
PF01032 | FecCD | 0.82 |
PF00574 | CLP_protease | 0.82 |
PF13424 | TPR_12 | 0.82 |
PF01872 | RibD_C | 0.82 |
PF01709 | Transcrip_reg | 0.82 |
PF09594 | GT87 | 0.82 |
PF02643 | DUF192 | 0.82 |
PF13777 | Obsolete Pfam Family | 0.82 |
PF04545 | Sigma70_r4 | 0.82 |
PF04185 | Phosphoesterase | 0.82 |
PF13537 | GATase_7 | 0.82 |
PF00326 | Peptidase_S9 | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 4.92 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 4.10 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 4.10 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 1.64 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.64 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.64 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.64 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 1.64 |
COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 1.64 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 1.64 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 1.64 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.64 |
COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 0.82 |
COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 0.82 |
COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.82 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.82 |
COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 0.82 |
COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.82 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.82 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.82 |
COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
COG1430 | Uncharacterized conserved membrane protein, UPF0127 family | Function unknown [S] | 0.82 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.82 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.82 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.82 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.82 |
COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 0.82 |
COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.82 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.93 % |
Unclassified | root | N/A | 36.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918008|ConsensusfromContig315652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
2170459004|F62QY1Z01DYUOC | Not Available | 505 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c1481242 | Not Available | 659 | Open in IMG/M |
3300002069|JGIcombinedJ21912_10185186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 709 | Open in IMG/M |
3300002568|C688J35102_119392729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 686 | Open in IMG/M |
3300002568|C688J35102_120446863 | Not Available | 1076 | Open in IMG/M |
3300003267|soilL1_10072832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1523 | Open in IMG/M |
3300004081|Ga0063454_100458364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 879 | Open in IMG/M |
3300004153|Ga0063455_100411804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
3300004153|Ga0063455_101464810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
3300005445|Ga0070708_100855604 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300005454|Ga0066687_10778608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
3300005467|Ga0070706_100233310 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
3300005468|Ga0070707_100992653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 805 | Open in IMG/M |
3300005471|Ga0070698_101271356 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300005529|Ga0070741_10061936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4338 | Open in IMG/M |
3300005532|Ga0070739_10045937 | All Organisms → cellular organisms → Bacteria | 2908 | Open in IMG/M |
3300005532|Ga0070739_10369655 | Not Available | 672 | Open in IMG/M |
3300005552|Ga0066701_10399225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 851 | Open in IMG/M |
3300005559|Ga0066700_10476989 | Not Available | 873 | Open in IMG/M |
3300005566|Ga0066693_10223488 | Not Available | 740 | Open in IMG/M |
3300005985|Ga0081539_10002077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 29969 | Open in IMG/M |
3300006031|Ga0066651_10331449 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300006057|Ga0075026_100294442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina | 884 | Open in IMG/M |
3300006059|Ga0075017_100759808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 748 | Open in IMG/M |
3300006174|Ga0075014_100703863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
3300006797|Ga0066659_10894965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 741 | Open in IMG/M |
3300007740|Ga0104326_113831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1279 | Open in IMG/M |
3300007820|Ga0104324_132293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2823 | Open in IMG/M |
3300007821|Ga0104323_116272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1373 | Open in IMG/M |
3300009012|Ga0066710_100075690 | All Organisms → cellular organisms → Bacteria | 4351 | Open in IMG/M |
3300009038|Ga0099829_10390508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1149 | Open in IMG/M |
3300009038|Ga0099829_11337957 | Not Available | 592 | Open in IMG/M |
3300009088|Ga0099830_10123622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1961 | Open in IMG/M |
3300009088|Ga0099830_10483639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1008 | Open in IMG/M |
3300009088|Ga0099830_10999268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 693 | Open in IMG/M |
3300009088|Ga0099830_11314532 | Not Available | 601 | Open in IMG/M |
3300009088|Ga0099830_11647945 | Not Available | 535 | Open in IMG/M |
3300009089|Ga0099828_10036924 | All Organisms → cellular organisms → Bacteria | 3980 | Open in IMG/M |
3300009089|Ga0099828_11507403 | Not Available | 593 | Open in IMG/M |
3300009090|Ga0099827_10000146 | All Organisms → cellular organisms → Bacteria | 26123 | Open in IMG/M |
3300009090|Ga0099827_10413613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1153 | Open in IMG/M |
3300009090|Ga0099827_11273179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300009090|Ga0099827_11296340 | Not Available | 634 | Open in IMG/M |
3300009137|Ga0066709_100972300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1241 | Open in IMG/M |
3300009137|Ga0066709_101135962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1149 | Open in IMG/M |
3300009137|Ga0066709_102717328 | Not Available | 659 | Open in IMG/M |
3300009137|Ga0066709_102933024 | Not Available | 628 | Open in IMG/M |
3300010039|Ga0126309_11147295 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300010335|Ga0134063_10764837 | Not Available | 504 | Open in IMG/M |
3300010364|Ga0134066_10244036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
3300012011|Ga0120152_1008987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4411 | Open in IMG/M |
3300012096|Ga0137389_10204436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1645 | Open in IMG/M |
3300012189|Ga0137388_10860520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 839 | Open in IMG/M |
3300012206|Ga0137380_10643794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 924 | Open in IMG/M |
3300012211|Ga0137377_10379998 | Not Available | 1350 | Open in IMG/M |
3300012212|Ga0150985_118283106 | Not Available | 814 | Open in IMG/M |
3300012354|Ga0137366_10873748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
3300012355|Ga0137369_10229644 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
3300012360|Ga0137375_10508553 | Not Available | 1023 | Open in IMG/M |
3300012922|Ga0137394_10900804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
3300012929|Ga0137404_10863864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 824 | Open in IMG/M |
3300013105|Ga0157369_12696673 | Not Available | 500 | Open in IMG/M |
3300013763|Ga0120179_1006158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3308 | Open in IMG/M |
3300013772|Ga0120158_10127380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1459 | Open in IMG/M |
3300014326|Ga0157380_12328906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300014488|Ga0182001_10471567 | Not Available | 569 | Open in IMG/M |
3300015195|Ga0167658_1051263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1011 | Open in IMG/M |
3300015195|Ga0167658_1069503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 821 | Open in IMG/M |
3300015371|Ga0132258_13524092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
3300017656|Ga0134112_10379016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
3300017944|Ga0187786_10030314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1512 | Open in IMG/M |
3300017944|Ga0187786_10067610 | Not Available | 1124 | Open in IMG/M |
3300017947|Ga0187785_10015762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 2628 | Open in IMG/M |
3300017947|Ga0187785_10402210 | Not Available | 658 | Open in IMG/M |
3300017959|Ga0187779_10122622 | Not Available | 1583 | Open in IMG/M |
3300017966|Ga0187776_10447645 | Not Available | 873 | Open in IMG/M |
3300017966|Ga0187776_10615141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
3300017966|Ga0187776_11550216 | Not Available | 511 | Open in IMG/M |
3300018029|Ga0187787_10105459 | Not Available | 909 | Open in IMG/M |
3300018032|Ga0187788_10555778 | Not Available | 503 | Open in IMG/M |
3300018064|Ga0187773_10021257 | Not Available | 2784 | Open in IMG/M |
3300018064|Ga0187773_10161650 | Not Available | 1164 | Open in IMG/M |
3300018064|Ga0187773_11089929 | Not Available | 530 | Open in IMG/M |
3300018089|Ga0187774_10027972 | Not Available | 2306 | Open in IMG/M |
3300018433|Ga0066667_10123852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1772 | Open in IMG/M |
3300018433|Ga0066667_12301694 | Not Available | 504 | Open in IMG/M |
3300025664|Ga0208849_1000992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 22222 | Open in IMG/M |
3300025846|Ga0209538_1088424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1266 | Open in IMG/M |
3300025910|Ga0207684_10123179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2224 | Open in IMG/M |
3300025910|Ga0207684_10201670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1716 | Open in IMG/M |
3300025922|Ga0207646_10361405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1312 | Open in IMG/M |
3300025937|Ga0207669_11485310 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300026331|Ga0209267_1129452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1058 | Open in IMG/M |
3300026550|Ga0209474_10378182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 760 | Open in IMG/M |
3300027773|Ga0209810_1055502 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
3300027773|Ga0209810_1215730 | Not Available | 755 | Open in IMG/M |
3300027862|Ga0209701_10240558 | Not Available | 1063 | Open in IMG/M |
3300027862|Ga0209701_10333546 | Not Available | 863 | Open in IMG/M |
3300027882|Ga0209590_10000309 | All Organisms → cellular organisms → Bacteria | 15140 | Open in IMG/M |
3300028047|Ga0209526_10712013 | Not Available | 631 | Open in IMG/M |
3300028800|Ga0265338_10393260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 989 | Open in IMG/M |
3300028881|Ga0307277_10472385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
3300028884|Ga0307308_10337957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 721 | Open in IMG/M |
3300031226|Ga0307497_10005397 | Not Available | 3404 | Open in IMG/M |
3300032160|Ga0311301_11247178 | Not Available | 947 | Open in IMG/M |
3300032180|Ga0307471_102011070 | Not Available | 725 | Open in IMG/M |
3300032770|Ga0335085_10364157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1690 | Open in IMG/M |
3300032782|Ga0335082_10015470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 8272 | Open in IMG/M |
3300032782|Ga0335082_10139799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2356 | Open in IMG/M |
3300032783|Ga0335079_10555280 | Not Available | 1217 | Open in IMG/M |
3300032828|Ga0335080_10036819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5372 | Open in IMG/M |
3300032828|Ga0335080_11826414 | Not Available | 593 | Open in IMG/M |
3300032829|Ga0335070_10009581 | All Organisms → cellular organisms → Bacteria | 11335 | Open in IMG/M |
3300032829|Ga0335070_11247431 | Not Available | 681 | Open in IMG/M |
3300032893|Ga0335069_10009427 | Not Available | 13898 | Open in IMG/M |
3300033004|Ga0335084_10103352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2959 | Open in IMG/M |
3300033004|Ga0335084_10584771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1143 | Open in IMG/M |
3300033758|Ga0314868_005195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1206 | Open in IMG/M |
3300033810|Ga0314872_002901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 990 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.49% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 11.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.38% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.92% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.10% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.10% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.46% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.46% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.46% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.46% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.64% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.82% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.82% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.82% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.82% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.82% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300002069 | Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007740 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 Soapdenovo | Environmental | Open in IMG/M |
3300007820 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo | Environmental | Open in IMG/M |
3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
3300033810 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Bog_all_C_04284810 | 2140918008 | Soil | MQLDPNTHAFVLATAALTSLAFTIFALNLLALVLQHTLG |
E4B_01504410 | 2170459004 | Grass Soil | MQLDPNTHAYVAATAFLTSLTFAIFAMHVIALVLYYTVY |
ICChiseqgaiiDRAFT_14812421 | 3300000033 | Soil | MDPNTHAFVLSTAFMTSLAFAIFAMNVIAVVLQQVLG* |
JGIcombinedJ21912_101851861 | 3300002069 | Arctic Peat Soil | MRLDPNTHAIVVATAFLTSVSFAIFAMNVLAAVLYWLY* |
C688J35102_1193927292 | 3300002568 | Soil | MRIDPNTHAFVVATAFLTSAAFAIAVMNVLAFVLARFVL* |
C688J35102_1204468632 | 3300002568 | Soil | KGMRLDPNTHAFVLATAFITSVTFAIFACNLLALVLEHIYR* |
soilL1_100728323 | 3300003267 | Sugarcane Root And Bulk Soil | MRLDPNTHAFVLATAFMTSLTFAIFACNVIAVALGWLLG* |
Ga0063454_1004583642 | 3300004081 | Soil | VYKKGMRLDPNTHAFVLATAFITSVTFAIFACNLLALVLEHIYR* |
Ga0063455_1004118041 | 3300004153 | Soil | MRLDPNTHAFVAATAFLTSVAFAIAAMNVIAFVLARFWV* |
Ga0063455_1014648102 | 3300004153 | Soil | MRLDPTPARRSSTAVMTSISFAVFGMNLIALVLSHVLVTGSRS* |
Ga0070708_1008556042 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH* |
Ga0066687_107786081 | 3300005454 | Soil | MRLDPNTHAFVLATAFITSVTFAIFACNLLALVLEHIYR* |
Ga0070706_1002333102 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLDPNTHAYVVATAFMTSVTFAIFAMNLIALVLSHLLN* |
Ga0070707_1009926532 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLDPNTHAYVVATAFMTSVTFAIFAMNLIALILSHLLN* |
Ga0070707_1018446631 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | WSRRTASVTLRLMRLDPNTHAFVAATAFFTAGTFAIFVMNLLALVLQRLLGY* |
Ga0070698_1012713562 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMDPNTHAVVLWTAFLTSVSFAVFAMNLLGLILEHVLH* |
Ga0070741_100619364 | 3300005529 | Surface Soil | MRLDPNTHAFVLGTALLTSITFTIFALNLIALILQRVLY* |
Ga0070739_100459371 | 3300005532 | Surface Soil | PACGAGDCGMRLDPNTHAFVLGTALLTSVTFTIFALNLIALVLQHVLN* |
Ga0070739_103696552 | 3300005532 | Surface Soil | GDCGMRLDPNTHAFVLGTALLTSVTFTIFALNLIALVLQHVLN* |
Ga0066701_103992252 | 3300005552 | Soil | MRLDPNTHAFVLATAFLTSVTFAIFAMNLLALLLSHLVG* |
Ga0066700_104769891 | 3300005559 | Soil | MRLDPNTHAFVAATAFFTAGAFTIFVLNLLALVLQPVLF* |
Ga0066693_102234881 | 3300005566 | Soil | MRLDPNTHTLLLTTAFLTSVSFAVLAMNVLALVLSHLLA* |
Ga0081539_1000207726 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MDPNTHAFVLSTAFMTSLAFAIFAMNVIAVVLQHVLS* |
Ga0066651_103314491 | 3300006031 | Soil | HRMRLDPNTHTLLLTTAFLTSVSFAVLAMNVLALVLSHLLA* |
Ga0075026_1002944423 | 3300006057 | Watersheds | HCGMRLDQNTHALVLATAFLTSVSFAIFAMNLIALVLSHLLA* |
Ga0075017_1007598082 | 3300006059 | Watersheds | MRLDPNTHMYVVTTAFFTSLAFAIFAMNVIALVLYYTVH* |
Ga0075014_1007038632 | 3300006174 | Watersheds | MRLDPNTHMYVVTTAFFTSLAFAIFAMNIIALVLYYTVN* |
Ga0066659_108949651 | 3300006797 | Soil | RIDPNTHAFVLATAFLTSVTFAIFAMNLLALLLSHLVG* |
Ga0104326_1138312 | 3300007740 | Soil | MNPNTHSYVVATAFMTSLAFAIFAMNVIALCLYYYGS* |
Ga0104324_1322933 | 3300007820 | Soil | MHMNPNTHSYVVATAFMTSLAFAIFAMNVIALCLYYYGS* |
Ga0104323_1162723 | 3300007821 | Soil | MRMNPNTHSYVVATAFMTSLAFAIFAMNVIALCLYYYAN* |
Ga0066710_1000756905 | 3300009012 | Grasslands Soil | MRLDPNTHTLLLTTAFLASLAFAVLAMNVLALVLSHLLA |
Ga0066710_1004268391 | 3300009012 | Grasslands Soil | SVKLRLMRLDPNTHAFVAATAFFTAGAFTIFVLNLLALVLQRVLF |
Ga0099829_103905082 | 3300009038 | Vadose Zone Soil | MRMDPNTHAVVLWTAFLTSVSFAVFAMNLLGLVLEHVLH* |
Ga0099829_113379572 | 3300009038 | Vadose Zone Soil | MRLDPNTHAFVLATAFLTSVTFAIFAMNLLALVLSSLVG* |
Ga0099830_101236223 | 3300009088 | Vadose Zone Soil | MRLDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH* |
Ga0099830_104836392 | 3300009088 | Vadose Zone Soil | MDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH* |
Ga0099830_109992682 | 3300009088 | Vadose Zone Soil | GRCMGINPNTHAFVLATAFMTSLAFAILAMNVIAVCLYYYAS* |
Ga0099830_113145322 | 3300009088 | Vadose Zone Soil | ISIQRRMRLDRNTHTLVLATAFLTSVAFAVLAMNVLALVLSHVLA* |
Ga0099830_116479451 | 3300009088 | Vadose Zone Soil | MRLDPNTRAFVLATAFLTSVTFAIFAMNLFALVLNHLVG* |
Ga0099828_100369241 | 3300009089 | Vadose Zone Soil | MRLDPNTRAFVLATAFLTSVTFAIFAMNLFALVLSHLVG* |
Ga0099828_115074033 | 3300009089 | Vadose Zone Soil | MDPNTHAVVLWTAFLTSVSFAVFAMNLLGLVLEHVLH* |
Ga0099827_1000014620 | 3300009090 | Vadose Zone Soil | MRLDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHLLH* |
Ga0099827_104136134 | 3300009090 | Vadose Zone Soil | AAMRMDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVL* |
Ga0099827_112731791 | 3300009090 | Vadose Zone Soil | MRLDPNTHAFVAATAFLTAFYFAITVMLVIAFLLSQADA* |
Ga0099827_112963402 | 3300009090 | Vadose Zone Soil | MRIDPNTHAFVVATAFLTSVYFAVTVMQLLALVLERMLT* |
Ga0066709_1009723001 | 3300009137 | Grasslands Soil | GRFQFHHRMRLDPNTHTLLLTTAFLTSVSFAVLAMNVLALVLSHLLA* |
Ga0066709_1011359622 | 3300009137 | Grasslands Soil | MRLDPNTHAMVLWTAFLTSVAFAIFAMNLIALVLQHLFY* |
Ga0066709_1027173282 | 3300009137 | Grasslands Soil | MRLDPNTHGFVVATAFLTSVTFAIFAMNLLALFLSRLPG* |
Ga0066709_1029330241 | 3300009137 | Grasslands Soil | MRLDPNTHTLLLTTAFLASLPFAVLAMNVLALVLSHLLA* |
Ga0126309_111472952 | 3300010039 | Serpentine Soil | MKLDPNTMGFVYATAFLTSVTFAIFAMNLLALVLERVLG* |
Ga0134063_107648371 | 3300010335 | Grasslands Soil | LDPNTHAMVLWTAFLTSASFAIFAMNLLGLVLEHVLH* |
Ga0134066_102440362 | 3300010364 | Grasslands Soil | LNLDPNTHALVLGTAFLTSVTFAISVMNILAVVLSHVLR* |
Ga0120152_10089873 | 3300012011 | Permafrost | MGLDPNTHTLVMATAFLTSVAFAIFALNVIALVLQRVLA* |
Ga0137389_102044361 | 3300012096 | Vadose Zone Soil | QRHLGEGAMGINPHTRAFVLATAFMTSLAFAILAMNVIALCLYYYVS* |
Ga0137388_108605202 | 3300012189 | Vadose Zone Soil | MGINPNTRAFVLATAFMTSLAFAILAMNVIALCLYYYVS* |
Ga0137380_106437943 | 3300012206 | Vadose Zone Soil | MRLDPNTHAFVVATAFLTSVTFAIFAMNLLALFLSRLAG* |
Ga0137377_103799982 | 3300012211 | Vadose Zone Soil | MRLDPNTHTLLLTTAFLTSAAFAVLAMNVLALVLSHLLA* |
Ga0150985_1182831062 | 3300012212 | Avena Fatua Rhizosphere | VRIDPNTHAFVLSTAFFTSLAFTVFALNFVALVLE |
Ga0137366_108737482 | 3300012354 | Vadose Zone Soil | MRLDPNTHAYVVATAFFTSVAFTIFALNLLALVLQRILA* |
Ga0137369_102296442 | 3300012355 | Vadose Zone Soil | MRLDPNTHAYVVATAFFTSVAFAIFALNLLALVLQRILA* |
Ga0137375_105085531 | 3300012360 | Vadose Zone Soil | MDPNTHAFVLSTAFMTSLAFAIFAMNVIAVVLQQVLS* |
Ga0137394_109008042 | 3300012922 | Vadose Zone Soil | MRMNPNTHSYVVATAFMTSLAFAIFAMNVIALCLYYYGGYGS* |
Ga0137404_108638642 | 3300012929 | Vadose Zone Soil | MRLDPNTHALVVATAFLTSVAFAIAAMSVLAFVLSLFFG* |
Ga0157369_126966731 | 3300013105 | Corn Rhizosphere | DPNTHAYVAATAFLTSVAFAIAVMNVIAFVLGRFFT* |
Ga0120179_10061586 | 3300013763 | Permafrost | MNPNTHSYVAATAFMTSLAFAIFAMNVIALCLYYYAN* |
Ga0120158_101273802 | 3300013772 | Permafrost | MGLDPNTHSFVVATAFMTSVSFMILALNVIALLLERVYG* |
Ga0157380_123289062 | 3300014326 | Switchgrass Rhizosphere | MRMDPSTHALVVATALLTSVAFAILVLNVIALLLQQIYG* |
Ga0182001_104715672 | 3300014488 | Soil | LRLDPNTHALVYGWAFLTSLSFAIFAMHLIALILERVLA* |
Ga0167658_10512632 | 3300015195 | Glacier Forefield Soil | MQMNPNTHSYVVATAFMTSLAFAILAMNVIALCLYYYAN* |
Ga0167658_10695032 | 3300015195 | Glacier Forefield Soil | MRMNPNTHSYVAATAFMTSLAFAIFAMNVIALCLYYYAN* |
Ga0132258_135240921 | 3300015371 | Arabidopsis Rhizosphere | MAVTSAAMRLDPNTHACVLATAFMTSLTFAIFAMNVIAVVLQQVLG* |
Ga0134112_103790161 | 3300017656 | Grasslands Soil | MRLDPNTHAYVLATAFLTSVTFAIFAMNLLALALSHLVG |
Ga0187786_100303142 | 3300017944 | Tropical Peatland | MRLDPNTHAYVLATALMTSIAFAVFAMNLLALVLQYVLR |
Ga0187786_100676102 | 3300017944 | Tropical Peatland | MRIDPNTHAFVMATAFLVSASFAVLAMNVLAIVLSHLLA |
Ga0187785_100157623 | 3300017947 | Tropical Peatland | MRLDPNTHAYVLATAMMTSIAFAVFAMNLIALVLQYVLR |
Ga0187785_104022101 | 3300017947 | Tropical Peatland | MRLDPNTHAFVLATAFLTSVTFAIFAMNVIALFLYYATN |
Ga0187779_101226222 | 3300017959 | Tropical Peatland | MRLDPNTHAYVMATALMTSIAFAVFAMNLIALVLPYFLH |
Ga0187776_104476452 | 3300017966 | Tropical Peatland | MRLDPNTHAYVMATALMTSIAFAVFAMNLIALVLPYFLR |
Ga0187776_106151412 | 3300017966 | Tropical Peatland | MRLDPNTHAYVLATALMTSVAFAIFAMNLLALLLSYVTR |
Ga0187776_115502162 | 3300017966 | Tropical Peatland | MRLDPNTHAFVLATAGITSIAFAIFAMNLLAVVLAYTLG |
Ga0187787_101054592 | 3300018029 | Tropical Peatland | MRLDPNTHAYVMATALMTSIAFAVFAMNLLALVLQYVLR |
Ga0187788_105557782 | 3300018032 | Tropical Peatland | MRIDPNTHAFVMATAFLTSVSFAVLAMNVLALVLSHLLA |
Ga0187773_100212572 | 3300018064 | Tropical Peatland | MRLDPNTHAFVLATAFLTSFAFAVLAMNLLAGVLYYTVG |
Ga0187773_101616501 | 3300018064 | Tropical Peatland | MRLDPNTHAYVMATALMTSVAFAIFAMNVIALVLYYALN |
Ga0187773_110899291 | 3300018064 | Tropical Peatland | AAMRLDPNTHAYVMATALMTSIAFAVFAMNLIALVLPYFLR |
Ga0187774_100279723 | 3300018089 | Tropical Peatland | MRLDPNTHAYVMATALMTSIAFAIFAMNVIALVLYYALN |
Ga0066667_101238522 | 3300018433 | Grasslands Soil | MRLDPNTHAMVLWTAFLTSVAFAIFAMNLIALVLQHLFY |
Ga0066667_123016941 | 3300018433 | Grasslands Soil | MRLDPNTHAYVVATAFMTSVTFAIFAMNLLALVLSHLLN |
Ga0208849_100099217 | 3300025664 | Arctic Peat Soil | MQLDPNSNAFVLATAFLVSVTFAIFAMNVLAAILYYTYN |
Ga0209538_10884241 | 3300025846 | Arctic Peat Soil | MRLDPNTHAIVVATAFLTSVSFAIFAMNVLAAVLYWLY |
Ga0207684_101231792 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLDPNTHAYVVATAFMTSVTFAIFAMNLIALVLSHLLN |
Ga0207684_102016702 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH |
Ga0207646_103614052 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH |
Ga0207669_114853102 | 3300025937 | Miscanthus Rhizosphere | MRMDPSTHALVVATALLTSVAFAILVLNVIALLLQQLYG |
Ga0209267_11294521 | 3300026331 | Soil | THSYVVATAFMTSLAFAIFAMNLIALLLYYYGGYAS |
Ga0209474_103781821 | 3300026550 | Soil | RLDPHTHTLLLTTAFLTSVSFAVLAMNVLALVLSHLLA |
Ga0209810_10555022 | 3300027773 | Surface Soil | MLRPPACGAGDCGMRLDPNTHAFVLGTALLTSVTFTIFALNLIALVLQHVLN |
Ga0209810_12157301 | 3300027773 | Surface Soil | GDCGMRLDPNTHAFVLGTALLTSVTFTIFALNLIALVLQHVLN |
Ga0209701_102405582 | 3300027862 | Vadose Zone Soil | MRLDPNTHAFVLATAFLTSVTFAIFAMNLFALVLSH |
Ga0209701_103335462 | 3300027862 | Vadose Zone Soil | MRLDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH |
Ga0209590_100003098 | 3300027882 | Vadose Zone Soil | MRLDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHLLH |
Ga0209526_107120131 | 3300028047 | Forest Soil | MRPDPNTHTVVLVTAFLTSVSFAVLAMNVLALVLSHLLA |
Ga0265338_103932602 | 3300028800 | Rhizosphere | MRLDPNTHAFVLDTAALTSIALTIFALNLLALVLQRTLG |
Ga0307277_104723852 | 3300028881 | Soil | MRGYHPAAMRMNPNTHSYVLATAFMTSAAFAIFAMNVIALCLYYYGGYNS |
Ga0307308_103379572 | 3300028884 | Soil | NPNTRAFVLATAFMTSLSFAILAMNIIALCLYYYGS |
Ga0307497_100053972 | 3300031226 | Soil | MRLDPNTHYFVLATAFITSVAFAIAAMNVLAFVLSHFVLS |
Ga0311301_112471782 | 3300032160 | Peatlands Soil | MRLDPNTHMYVVTTAFFTSLAFAIFAMNVIALVLYYTVH |
Ga0307471_1020110702 | 3300032180 | Hardwood Forest Soil | LMRLDPNTHAFVAATAFFTAGAFTIFVLNLLVLVLQRVLGY |
Ga0335085_103641572 | 3300032770 | Soil | MRIDPNTHAFVMATAFLTSVSFAILAMNVLALVLSHLLA |
Ga0335082_100154704 | 3300032782 | Soil | MRIDPNTHAFVMATAFLTSVSFAILAMNVLALVLSHVLA |
Ga0335082_101397993 | 3300032782 | Soil | MRIDPNTHAFVMATAFLVSASFAVLAMNVLALVLSHLLA |
Ga0335079_105552802 | 3300032783 | Soil | MRLDPNTHAYVMATALMTSIAFAVFAMNLIALVLSYVLR |
Ga0335080_100368195 | 3300032828 | Soil | MRIDPNTHAFVMATAFLVSASFAILAMNVLALVLSHMLS |
Ga0335080_118264141 | 3300032828 | Soil | MRIDPNTHAFVMATAFLVSASFAILAMNVLALVLSHLLS |
Ga0335070_100095812 | 3300032829 | Soil | MRLDPNTHAFVLATAFLTSVTFAIFAMNVIALVLYYATR |
Ga0335070_112474312 | 3300032829 | Soil | VRLHQSAAMRLDPNTHAYVMATALMTSIAFAVFAMNLLALVLSYVLR |
Ga0335069_1000942716 | 3300032893 | Soil | MRLDPNTHAYVMATALMTSIAFAVFAMNLLALVLSYVLR |
Ga0335084_101033524 | 3300033004 | Soil | MRIDPNTHALVMATAFLTSVSFAILAMNVLALVLSHVLA |
Ga0335084_105847713 | 3300033004 | Soil | PPSTAAMRIDPNTHAFVMATAFLTSVSFAILAMNVLALVLSHLLA |
Ga0314868_005195_987_1106 | 3300033758 | Peatland | MRLDPNTHAYVLATALMTSIAFAVFAMNLIALVVQYVLR |
Ga0314872_002901_801_920 | 3300033810 | Peatland | MRLDPNTHAFVLATAFLTSVTFAIFAMNVIALCLYYATN |
⦗Top⦘ |