


| Basic Information | |
|---|---|
| Family ID | F070934 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LPLEVGPLNPARGLGERCKLPSGVWGGAPAEIEFGAF |
| Number of Associated Samples | 61 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 76.23 % |
| % of genes from short scaffolds (< 2000 bps) | 67.21 % |
| Associated GOLD sequencing projects | 48 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (90.984 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont (46.721 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut (100.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00619 | CARD | 0.82 |
| PF05699 | Dimer_Tnp_hAT | 0.82 |
| PF00089 | Trypsin | 0.82 |
| PF01773 | Nucleos_tra2_N | 0.82 |
| PF00069 | Pkinase | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.28 |
| COG1972 | Nucleoside permease NupC | Nucleotide transport and metabolism [F] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 90.98 % |
| All Organisms | root | All Organisms | 9.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Gutless Worms Symbiont | Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont | 46.72% |
| Marine Gutless Worms Symbiont | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont | 29.51% |
| Marine Gutless Worms | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms | 23.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001741 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 | Host-Associated | Open in IMG/M |
| 3300001744 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 | Host-Associated | Open in IMG/M |
| 3300001746 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2 | Host-Associated | Open in IMG/M |
| 3300002181 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 | Host-Associated | Open in IMG/M |
| 3300003769 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.2 | Host-Associated | Open in IMG/M |
| 3300003772 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.2 | Host-Associated | Open in IMG/M |
| 3300003777 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius filocauda PIANOSA.2 | Host-Associated | Open in IMG/M |
| 3300003853 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BELIZE.1 | Host-Associated | Open in IMG/M |
| 3300003855 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.2 | Host-Associated | Open in IMG/M |
| 3300004087 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BELIZE.1 (version 2) | Host-Associated | Open in IMG/M |
| 3300004098 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (version 2) | Host-Associated | Open in IMG/M |
| 3300004122 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (version 2) | Host-Associated | Open in IMG/M |
| 3300004632 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae PIANOSA.1 | Host-Associated | Open in IMG/M |
| 3300005170 | Worm MetaG Olavius vacuus BAHAMAS.1 (version 1) | Host-Associated | Open in IMG/M |
| 3300005648 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.1 | Host-Associated | Open in IMG/M |
| 3300005649 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.2 | Host-Associated | Open in IMG/M |
| 3300005871 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND | Host-Associated | Open in IMG/M |
| 3300005968 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2 | Host-Associated | Open in IMG/M |
| 3300005978 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 | Host-Associated | Open in IMG/M |
| 3300005979 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.2 | Host-Associated | Open in IMG/M |
| 3300005999 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1a BELIZE.2 | Host-Associated | Open in IMG/M |
| 3300006912 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1 | Host-Associated | Open in IMG/M |
| 3300006913 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.1 | Host-Associated | Open in IMG/M |
| 3300007817 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BAHAMAS.1 | Host-Associated | Open in IMG/M |
| 3300008215 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1 BERMUDA.1 | Host-Associated | Open in IMG/M |
| 3300010290 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-54 metaG | Host-Associated | Open in IMG/M |
| 3300010292 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaG | Host-Associated | Open in IMG/M |
| 3300010294 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-42 metaG | Host-Associated | Open in IMG/M |
| 3300010295 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG | Host-Associated | Open in IMG/M |
| 3300010298 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG | Host-Associated | Open in IMG/M |
| 3300010314 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-98 metaG | Host-Associated | Open in IMG/M |
| 3300010315 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG | Host-Associated | Open in IMG/M |
| 3300010377 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-13 metaG | Host-Associated | Open in IMG/M |
| 3300011190 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-30 metaG | Host-Associated | Open in IMG/M |
| 3300012273 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG | Host-Associated | Open in IMG/M |
| 3300012887 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Olavius sp. 1 OAHU.JWI-45 metaG | Host-Associated | Open in IMG/M |
| 3300027012 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 5 HERON ISLAND (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027318 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius imperfectus BELIZE.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027331 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BAHAMAS.1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027338 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027341 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027372 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius imperfectus BELIZE.1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027389 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027392 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027404 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027495 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027500 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius filocauda PIANOSA.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027519 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027520 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027540 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027544 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027551 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027556 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027557 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027584 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027585 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027599 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae ELBA.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027602 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027615 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae ELBA.1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027624 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027632 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24671J20093_101848051 | 3300001741 | Marine Gutless Worms Symbiont | PSPPLEVGPSNPARGLEERCKLPSGVWGGAPAEIEFGAF* |
| JGI24669J20092_100700711 | 3300001744 | Marine Gutless Worms Symbiont | EVGPSNQARAWAMMGERCQLPSGVWGGAPAEIEFGAF* |
| JGI24672J20091_101425282 | 3300001746 | Marine Gutless Worms Symbiont | PSLPSLPLSLEVRPPNPARGLGESCKLPSGVWGGAPPEIEFGAF* |
| JGI24670J26820_113069591 | 3300002181 | Marine Gutless Worms Symbiont | YLPLSSLPLEVGPLNPARGSGEHCKLPSAVWGETPAEIEFGAF* |
| Ga0049118_102153912 | 3300003769 | Marine Gutless Worms Symbiont | PLEVGPLNPARGSGGQLGLVSSPSGVWDGALAEIEFGAFSALKCE* |
| Ga0049094_102566442 | 3300003772 | Marine Gutless Worms Symbiont | FVSYRNVLVVDSINPVRRSGERCKLPSGVWGETPAEIELGAF* |
| Ga0049110_100905941 | 3300003777 | Marine Gutless Worms Symbiont | LSSTCIPLEVGPLNPARGLGERCKLPQQGLERDDIEFGAFWT* |
| Ga0049113_101061912 | 3300003853 | Marine Gutless Worms Symbiont | PTSSPPLEVGPLNPARSSGEHCKLPSGVWGRAPAETDLGSF* |
| Ga0049112_10080841 | 3300003855 | Marine Gutless Worms Symbiont | PSLLSPPFLLSSLPLEVGPLNPAGSLGERCIKASSGVWDGAPAEIEFDAL* |
| Ga0066190_103643131 | 3300004087 | Marine Gutless Worms Symbiont | LEVGPLNPARGSGERCKLPSWVWDGAPAETPAEIEFDAF* |
| Ga0065184_101889151 | 3300004098 | Marine Gutless Worms Symbiont | PPLPSPSPYLPLPSLPLQVGPLNPARGLGSGVRGGAAAEIEFGAF* |
| Ga0065185_103373631 | 3300004122 | Marine Gutless Worms Symbiont | PLPPLLFLPLEVGPLNPAGSGERCKKSSPSAPAEIEFGAF* |
| Ga0049107_105832611 | 3300004632 | Marine Gutless Worms Symbiont | SSPSPPLPLEVGPLNPARGSGGALLVTPAGAPAKIEFGAF* |
| Ga0071327_10664951 | 3300005170 | Marine Gutless Worms Symbiont | FLSLPLEVGPLNPARGRGSTVSSPGEVWGRVPAKIEFVVF* |
| Ga0056131_10659352 | 3300005648 | Marine Gutless Worms Symbiont | PLPLEVGPLNPARGSGVWLPSGVWGGAPAEIEFVHFCLKI* |
| Ga0056131_13047411 | 3300005648 | Marine Gutless Worms Symbiont | LPLEVGPLNTATGPRERCKLSSGVWGGAPAEMEFDAF* |
| Ga0056131_13366332 | 3300005648 | Marine Gutless Worms Symbiont | LLFEVGPLNPARESLGERCKLPSGVWGRAPAEIEFGAFLH* |
| Ga0056116_11356093 | 3300005649 | Marine Gutless Worms Symbiont | PFSLPLEVGPLKPARGLGSAISSPSGVRGGTPAEIEFGAL* |
| Ga0056124_10521161 | 3300005871 | Marine Gutless Worms Symbiont | VPPSSLPIEVGPLNTTGSLGERCYLPSGVWGEASAEIEFGVF* |
| Ga0056124_10794264 | 3300005871 | Marine Gutless Worms Symbiont | SLPLEVGPRNPAKRPGSAASSTSMVWGRAPAEIELGAC* |
| Ga0056130_12897632 | 3300005968 | Marine Gutless Worms Symbiont | SLPLEVGPLNPAIGSGERCISSPSGVWGEAPVDMEIGAF* |
| Ga0056129_11048152 | 3300005978 | Marine Gutless Worms Symbiont | LPLEVGPLNPARGLGERSKLPQWGLGKAPAEMKFGAF* |
| Ga0056132_10910471 | 3300005979 | Marine Gutless Worms Symbiont | PSLPLEVGPLNPARGSGRVSSPSGVWGSAEIKFDAF* |
| Ga0056132_12170172 | 3300005979 | Marine Gutless Worms Symbiont | SSLPLEVGPLNPAIGDLGERCKLPQWGLAEIEFGAF* |
| Ga0056136_10337521 | 3300005999 | Marine Gutless Worms Symbiont | PLPLEVGPLNPARESGVRCKFPRGLGRRGGAPADM* |
| Ga0056114_10451275 | 3300006912 | Marine Gutless Worms Symbiont | STFPSLPLEVGPLNPARGMGLPRGVWGEAPAEMKFGAF* |
| Ga0056114_11794361 | 3300006912 | Marine Gutless Worms Symbiont | SNPLLSPPLPLEVGPLNPARGPGERCKLPQWVWGGALADVEFDAS* |
| Ga0056114_12178291 | 3300006912 | Marine Gutless Worms Symbiont | PSLPLEVGPSNPARGLGERCKLPSGVWGNAPAKIEFGAF* |
| Ga0056114_12329853 | 3300006912 | Marine Gutless Worms Symbiont | PLPLEVGPLNPAMGSGEPVSSPSGVWGKAPDEIEFAAFQP* |
| Ga0056114_12502871 | 3300006912 | Marine Gutless Worms Symbiont | LPLEVGPLNPARGLGERCKLPSGVWGGAPAEIEFGAF* |
| Ga0056114_12631502 | 3300006912 | Marine Gutless Worms Symbiont | LNTARGSGERYKLSPSPPHGVWGGAPAEIVFGTF* |
| Ga0056115_11360604 | 3300006913 | Marine Gutless Worms Symbiont | LNVGPLKPALGSGERCKLPSGAQGGAPAENEFGAL* |
| Ga0056115_12658062 | 3300006913 | Marine Gutless Worms Symbiont | PSPLKAGLLKPARGSGERCKLPSGVRGGAPAETEFGAL* |
| Ga0056119_10285512 | 3300007817 | Marine Gutless Worms Symbiont | LEVGPLNPARGYGERCKLPSWVWNEALAEIEFCAF* |
| Ga0056119_11268481 | 3300007817 | Marine Gutless Worms Symbiont | PLEVGPLNPSRGSGQRCKLSSGFWDGASAEIEFDAF* |
| Ga0056119_11658601 | 3300007817 | Marine Gutless Worms Symbiont | PYPYLPLEICPLNTATETGERCKLPSGAWGEASAEIEFGAF* |
| Ga0056119_11729061 | 3300007817 | Marine Gutless Worms Symbiont | PLEVGPLNPSRGSGQRCKLSSEFWGRAPAEIKFGAL* |
| Ga0056108_13835592 | 3300008215 | Marine Gutless Worms Symbiont | PSSLPLEVGPLNPARGTGERCKLPSGVWGRAPAEIEFGAFYP* |
| Ga0056108_14311291 | 3300008215 | Marine Gutless Worms Symbiont | LEVGPLNPGRESGERCKLPSGVWGGAPAEIESGAF* |
| Ga0126333_11027663 | 3300010290 | Marine Gutless Worms | HFPSLPLEVGPLNTSIGNLGERCKLPQWGLVRSQSEVEFIAF* |
| Ga0126333_11844101 | 3300010290 | Marine Gutless Worms | SLPFPLEVGPLNPATVSGGRRCKLPSGVWGGAPAEIEFGAF* |
| Ga0126333_12009171 | 3300010290 | Marine Gutless Worms | LEVGSLNPARGLGERCKLIQCVLGAAPARIEFGAFYLKI* |
| Ga0126333_13693391 | 3300010290 | Marine Gutless Worms | PLEVGLLSPARGSGERCKLPSGVRCGAPDEIELDAF* |
| Ga0126326_10010831 | 3300010292 | Marine Gutless Worms | PSFLSSLPLEVGPLNPARGSGGALQALSLQVWGGALAEIEFGEFYL* |
| Ga0126326_11741091 | 3300010292 | Marine Gutless Worms | LEVGPLNTAKGSGERCKLPSGVWGRTPAEIEFGAF* |
| Ga0126326_13506311 | 3300010292 | Marine Gutless Worms | LPLLSFPLEVGPLNPAIEELGERCKLPSWVWGGAPAEIEFGAFYL* |
| Ga0126326_13513831 | 3300010292 | Marine Gutless Worms | LPSLEVGPLKQRCKLPSGVWGGAPAEIELVQFGLKI* |
| Ga0126332_100253141 | 3300010294 | Marine Gutless Worms | SNLFSLPSPPLSPLEVGPLNPARGSGGALLAPPAGSGAEPPAEIEFGAF* |
| Ga0126334_102834521 | 3300010295 | Marine Gutless Worms | SSFPLEVGPLNPARGFAGRAASFHSGVWGGAPAEIELGAF* |
| Ga0126325_100570933 | 3300010298 | Marine Gutless Worms | ALPLEVGPLNTAKGPVERCKLPSGVWGGALAEIEFCAF* |
| Ga0126325_103781321 | 3300010298 | Marine Gutless Worms | FPLEVGPLNPAMGLREHFKLSNGVWAGAPAEVEFGAF* |
| Ga0126331_11366541 | 3300010314 | Marine Gutless Worms | FPLEVGPLNPARGFAGRAVSFHSGVWGGAPAEIELGAF* |
| Ga0126331_12969361 | 3300010314 | Marine Gutless Worms | PLEVGPLNTAKGPVEHCKLPSGVWGGALAEIEFCAF* |
| Ga0136654_11408751 | 3300010315 | Marine Gutless Worms | PLEVGPLKSSYIGGLGKRCKLPSGVWGRAPAEISF* |
| Ga0136654_12676123 | 3300010315 | Marine Gutless Worms | PLLTLEIGPLNTARGYGERCKLPSGVWDKALANKRFGAY* |
| Ga0126328_101957261 | 3300010377 | Marine Gutless Worms | FSLPLEVGPLNPAMASGERCKPPSGVWGGTPVEIEFGAF* |
| Ga0126328_103133681 | 3300010377 | Marine Gutless Worms | SLSFSIPFEVGPLNPARGLGERCKLPSGVWGGAPAQIEFCAF* |
| Ga0126328_103707272 | 3300010377 | Marine Gutless Worms | SLFPALPLEVGPLNAARGSGSVLSFPSGVWGRAPAEIEFGVF* |
| Ga0126327_100834812 | 3300011190 | Marine Gutless Worms | EVGSPHKPAKGSGERCKLPSGVLGGALAENEFGAL* |
| Ga0126327_101810032 | 3300011190 | Marine Gutless Worms | PLEVGPLKPARGLGERCKLPSGVWGGAAEEIEFGAV* |
| Ga0126327_101922061 | 3300011190 | Marine Gutless Worms | SFPLEVGPLNPARGFAGRAASFHSGVWGGAPAEIELGAF* |
| Ga0126327_102170782 | 3300011190 | Marine Gutless Worms | LEVGPLNTARGSGDAESSPPSGVWGRSLAEIEFGAFKP* |
| Ga0126329_100268321 | 3300012273 | Marine Gutless Worms | SLPSQVGPLKYSWGLGERCKLPSGVWGGAAAEIEFAAF* |
| Ga0126329_101693673 | 3300012273 | Marine Gutless Worms | EVGPLKPARGLGERCKLPSGVWGGAAEEIEFGAV* |
| Ga0126329_102372851 | 3300012273 | Marine Gutless Worms | LEVGPLISDMSLGESCKLPTGVWGRAPAEIEFGAF* |
| Ga0126329_102857843 | 3300012273 | Marine Gutless Worms | PLPFFPLEVGPLNPDRKLGERCKLPSGVWGRAPDEIEFGAF* |
| Ga0126329_103128471 | 3300012273 | Marine Gutless Worms | FPALPLEVGPLNTAKGPVERCKLPSGVWGGALAEIEFCAF* |
| Ga0126335_12038521 | 3300012887 | Marine Gutless Worms | PLPLEVGPLNPARGYGGMGSAVSSPSEVRGGAPAEIEFGAFWF* |
| Ga0209457_10161441 | 3300027012 | Marine Gutless Worms Symbiont | LKVGPLKYSYSVWGERCKLPSGVWGGTPAEIKFAAL |
| Ga0209365_10949201 | 3300027318 | Marine Gutless Worms Symbiont | HPFPCLPLEVGPLNPARGSGERCKLPSGVWGGAPAEIEFSAF |
| Ga0209365_11470872 | 3300027318 | Marine Gutless Worms Symbiont | SFPLEVGPLNPAKKSGGVRKLSSGVWARAPAEIKFGEF |
| Ga0209365_12497341 | 3300027318 | Marine Gutless Worms Symbiont | LSSSFLPRPSLPLEVGPLNPARRSGERCKLPIGVWGRAPAEIEFDAFWP |
| Ga0209569_10790551 | 3300027331 | Marine Gutless Worms Symbiont | TLPSFPLEVGPLNPSRGSGQRCKLSSGFWDGASAEIEFDAF |
| Ga0209569_11062271 | 3300027331 | Marine Gutless Worms Symbiont | LYLPFPYPYLPLEICPLNTATETGERCKLPSGAWGEASAEIEFGAF |
| Ga0209052_10370371 | 3300027338 | Marine Gutless Worms Symbiont | PLPLDVEPLNPARGSGERCKLPSGVWGGAPAEIEFGAF |
| Ga0209052_11387062 | 3300027338 | Marine Gutless Worms Symbiont | VVPPSSLPIEVGPLNTTGSLGERCYLPSGVWGEASAEIEFGVF |
| Ga0209052_11646221 | 3300027338 | Marine Gutless Worms Symbiont | SELLPLEVGPLKPARGSGERCKLPSGVRGGAPAENEFGAL |
| Ga0209453_10843671 | 3300027341 | Marine Gutless Worms Symbiont | SLPLEVGPLNPAGSLGERCIKASSGVWDGAPAEIEFDAL |
| Ga0209452_12290101 | 3300027372 | Marine Gutless Worms Symbiont | PIPSLPLPSFPLEVGPLNAAKGCEECCKLPSGVWGGDPARIKFVAF |
| Ga0209780_10746323 | 3300027389 | Marine Gutless Worms Symbiont | FPSLPLEVGPLNPARGSGERRKLPQWVWGEAAADKRFGAY |
| Ga0209680_11285891 | 3300027392 | Marine Gutless Worms Symbiont | PSSLPFPFPLPLEVGPVKSIGGLGERCKLPSGVWGGAPAEIEFGAF |
| Ga0209680_11741661 | 3300027392 | Marine Gutless Worms Symbiont | LTLEVGSLNPARGSGERCELPSGVWGGAPAEIEFGAF |
| Ga0209680_11883491 | 3300027392 | Marine Gutless Worms Symbiont | HFPPSPPLPLEVGPLNPARGSGERCKQLPCEVWDGAPAEIEFGTF |
| Ga0209680_12001351 | 3300027392 | Marine Gutless Worms Symbiont | LEVGPLNPARGLGERSKLPQWGLGKAPAEMKFGAF |
| Ga0209049_10061981 | 3300027404 | Marine Gutless Worms Symbiont | PFLLSSLPLEVGPLNPAGSLGERCIKASSGVWDGAPAEIEFDAL |
| Ga0209788_11301961 | 3300027495 | Marine Gutless Worms Symbiont | PSPFPSLPSPLPLEVGPLNPARGSGGAPPAPAEIEFCVFSLKI |
| Ga0209788_11902392 | 3300027495 | Marine Gutless Worms Symbiont | PLEVVPHIQLEGLGERCKLPSGVWGRAPAEIEFDAC |
| Ga0209145_10034576 | 3300027500 | Marine Gutless Worms Symbiont | LPLEVGPRNPARGSGERCKLPSGVWGGAPAEIVFGAF |
| Ga0209145_10169852 | 3300027500 | Marine Gutless Worms Symbiont | PTPLSPLPLEVGPLNPASGSTVSSPSGVWGRAPAEIEFGAF |
| Ga0209145_10900991 | 3300027500 | Marine Gutless Worms Symbiont | PSLHLEVGPLNPARGSGERCKLPSGVWGRAPAVIEFGAF |
| Ga0209562_12626701 | 3300027519 | Marine Gutless Worms Symbiont | PLEVGPLNPARGFGSAVSSPSVVWGRAPAEIDFGAF |
| Ga0209681_10968751 | 3300027520 | Marine Gutless Worms Symbiont | PIPSPSLLFEVGPLNPARESLGERCKLPSGVWGRAPAEIEFGAFLH |
| Ga0209791_11611582 | 3300027540 | Marine Gutless Worms Symbiont | PVRSRPVNPARGLGERYKLPNLVWGEAPAANDFGAFLG |
| Ga0209568_10732052 | 3300027544 | Marine Gutless Worms Symbiont | LYPLLPLEVGPLNPAGESGERCKLPSGVWGRATAEVESGVF |
| Ga0209568_10792571 | 3300027544 | Marine Gutless Worms Symbiont | PLEVEPIKQIEGLGERCKLPSGVRGRAPAENEFGAL |
| Ga0209568_11369801 | 3300027544 | Marine Gutless Worms Symbiont | PLNVGPLKPALGSGERCKLPSGAQGGAPAENEFGAL |
| Ga0209568_11520971 | 3300027544 | Marine Gutless Worms Symbiont | FLPLPLEACPLNPARRSGERCKLPSGVWGGAPAEIEFVAF |
| Ga0209568_11975021 | 3300027544 | Marine Gutless Worms Symbiont | LPPLPLEVGPVKSSWGSGERCELPRPSGVWGGAPAGIEIGAF |
| Ga0209568_12150411 | 3300027544 | Marine Gutless Worms Symbiont | PLPFAPPLPLEVVPLNPARGPGERCKLPSGVWGRAQAEVEFGAF |
| Ga0209568_12728601 | 3300027544 | Marine Gutless Worms Symbiont | PFAPRLPLETGPLNPVRESEERCKLPSGVWGRVPAEVEFGAF |
| Ga0209568_12865432 | 3300027544 | Marine Gutless Worms Symbiont | LKAGLLKPARGSGERCKLPSGVRGGAPAETEFGAL |
| Ga0209338_11808221 | 3300027551 | Marine Gutless Worms Symbiont | SPPIRFEVGPLNPARGLGERCKLPSGVWGGAPAEIEFGTF |
| Ga0209743_13085761 | 3300027556 | Marine Gutless Worms Symbiont | PPLPLEVGPPNPARGSGERCKLPSGVWGGAPAEIEFDAF |
| Ga0209743_14197911 | 3300027556 | Marine Gutless Worms Symbiont | SPFPLPLEVGPLNTARGSGERCKLPSGVWGGAPAEIEFSAF |
| Ga0209679_10413734 | 3300027557 | Marine Gutless Worms Symbiont | LPLKVGPLNTARGSGERCKLPSWVWGGAPAEIEFDAF |
| Ga0209679_10735542 | 3300027557 | Marine Gutless Worms Symbiont | MPCPPLPLEIGSLNPARRSGGALGLSGVWGRAPAEIEFGAF |
| Ga0209679_11174921 | 3300027557 | Marine Gutless Worms Symbiont | PLIPSLPLEVGPLNPARGSVSSASGVWGGAPAEIEFGTC |
| Ga0209637_12346863 | 3300027584 | Marine Gutless Worms Symbiont | LEVGLLNPARGLGERCKLPSGVWGEAPAANDFGAFSG |
| Ga0209637_14105551 | 3300027584 | Marine Gutless Worms Symbiont | PYLSSLYLPLSSLPLEVGPLNPARGSGEHCKLPSAVWGETPAEIEFGAF |
| Ga0209150_11991692 | 3300027585 | Marine Gutless Worms Symbiont | EVGPLNPARGFWGSAVSFPSVVWGEAPAANDFGAFSG |
| Ga0209150_13704141 | 3300027585 | Marine Gutless Worms Symbiont | IPFPSLPSLPLSLEVRPPNPARGLGESCKLPSGVWGGAPPEIEFGAF |
| Ga0209786_10567571 | 3300027599 | Marine Gutless Worms Symbiont | PLEVGPLNPARESGVGKRCKLPSGVWGRAIAAVEFDAFQP |
| Ga0209786_10684181 | 3300027599 | Marine Gutless Worms Symbiont | QPLPLPRSGPPNPVRESGERCKLPSGIWGGAPAEIEFGAF |
| Ga0209786_11535223 | 3300027599 | Marine Gutless Worms Symbiont | APLEVGPLNPARGSVERCKLPSGVWGGAPAEIEFGAF |
| Ga0209786_11747762 | 3300027599 | Marine Gutless Worms Symbiont | SVSPSLLLPSLALEVGTLNPVRGSGEHCNLPSGVWGGAPAEIEFGAF |
| Ga0209781_10527931 | 3300027602 | Marine Gutless Worms Symbiont | PLEVGPLNTARGLGERVSSPSGVWGRAPAEIDFGAF |
| Ga0209781_12946422 | 3300027602 | Marine Gutless Worms Symbiont | LEVGPLNTARGSGGACKLPSGVWGRAPAEIDFGAF |
| Ga0209678_11639892 | 3300027615 | Marine Gutless Worms Symbiont | SLLLEVGPLNPARGLGEHCKLPSVVWDGAPAEIEFGAF |
| Ga0209678_13338701 | 3300027615 | Marine Gutless Worms Symbiont | LEIGPQIQLRGLGERCKLPSGVWGGAPAEIEFDAF |
| Ga0209678_14548981 | 3300027615 | Marine Gutless Worms Symbiont | PLEVGPLNPARGSEGRCKLPSGIWGEAPAKIEFTAF |
| Ga0209789_103254821 | 3300027624 | Marine Gutless Worms Symbiont | SLPLEVGPLNPARGSGERYKLPQRGLGRSPAEIEFGALHP |
| Ga0209339_11020442 | 3300027632 | Marine Gutless Worms Symbiont | LPLPSLPAFPPLPSPLLLLPLEIGPPNPARGLEERCKLPSGVWGAAPAEIEFGAF |
| ⦗Top⦘ |