NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F070870

Metagenome Family F070870

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070870
Family Type Metagenome
Number of Sequences 122
Average Sequence Length 44 residues
Representative Sequence MKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEED
Number of Associated Samples 78
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 55.74 %
% of genes near scaffold ends (potentially truncated) 9.02 %
% of genes from short scaffolds (< 2000 bps) 64.75 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (65.574 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(39.344 % of family members)
Environment Ontology (ENVO) Unclassified
(75.410 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(73.770 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 40.58%    β-sheet: 0.00%    Coil/Unstructured: 59.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF02467Whib 19.67
PF07235DUF1427 10.66
PF09834DUF2061 8.20
PF04820Trp_halogenase 7.38
PF01583APS_kinase 2.46
PF01370Epimerase 1.64
PF08241Methyltransf_11 0.82
PF00011HSP20 0.82
PF00565SNase 0.82
PF04973NMN_transporter 0.82
PF00534Glycos_transf_1 0.82
PF13469Sulfotransfer_3 0.82
PF16861Carbam_trans_C 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG4317Xanthosine utilization system component, XapX domainNucleotide transport and metabolism [F] 10.66
COG0529Adenylylsulfate kinase or related kinaseInorganic ion transport and metabolism [P] 2.46
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.82
COG3201Nicotinamide riboside transporter PnuCCoenzyme transport and metabolism [H] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A65.57 %
All OrganismsrootAll Organisms34.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_109929335Not Available2993Open in IMG/M
3300002408|B570J29032_109938656Not Available3535Open in IMG/M
3300002408|B570J29032_109953110Not Available5988Open in IMG/M
3300002835|B570J40625_100016647All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12772Open in IMG/M
3300002835|B570J40625_100069175Not Available4710Open in IMG/M
3300002835|B570J40625_100083983Not Available4084Open in IMG/M
3300002835|B570J40625_100248962All Organisms → cellular organisms → Bacteria1855Open in IMG/M
3300002835|B570J40625_100439299Not Available1251Open in IMG/M
3300002835|B570J40625_101120615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300003277|JGI25908J49247_10011556All Organisms → cellular organisms → Bacteria2735Open in IMG/M
3300004369|Ga0065726_14778Not Available15884Open in IMG/M
3300005527|Ga0068876_10175748Not Available1250Open in IMG/M
3300005528|Ga0068872_10567521Not Available604Open in IMG/M
3300005581|Ga0049081_10033729All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1945Open in IMG/M
3300005582|Ga0049080_10087260Not Available1066Open in IMG/M
3300005582|Ga0049080_10263332Not Available560Open in IMG/M
3300005584|Ga0049082_10163704Not Available769Open in IMG/M
3300005585|Ga0049084_10030552All Organisms → cellular organisms → Bacteria2097Open in IMG/M
3300007974|Ga0105747_1181920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300008107|Ga0114340_1126828Not Available1668Open in IMG/M
3300008116|Ga0114350_1004811Not Available6765Open in IMG/M
3300008116|Ga0114350_1017714Not Available3012Open in IMG/M
3300008116|Ga0114350_1024676Not Available2448Open in IMG/M
3300008117|Ga0114351_1343099Not Available676Open in IMG/M
3300008120|Ga0114355_1132533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2288Open in IMG/M
3300008120|Ga0114355_1232667Not Available557Open in IMG/M
3300009160|Ga0114981_10409198Not Available730Open in IMG/M
3300009161|Ga0114966_10522263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage673Open in IMG/M
3300013004|Ga0164293_10577663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage732Open in IMG/M
3300013004|Ga0164293_10869573Not Available568Open in IMG/M
(restricted) 3300013126|Ga0172367_10089249All Organisms → cellular organisms → Bacteria2210Open in IMG/M
(restricted) 3300013126|Ga0172367_10586908Not Available600Open in IMG/M
(restricted) 3300013131|Ga0172373_10037275Not Available4493Open in IMG/M
(restricted) 3300013131|Ga0172373_10038203Not Available4411Open in IMG/M
(restricted) 3300013131|Ga0172373_10053898All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3428Open in IMG/M
(restricted) 3300013132|Ga0172372_10035124Not Available5230Open in IMG/M
(restricted) 3300013132|Ga0172372_10420479Not Available907Open in IMG/M
3300013372|Ga0177922_10438746All Organisms → cellular organisms → Bacteria1195Open in IMG/M
(restricted) 3300014720|Ga0172376_10208867Not Available1234Open in IMG/M
(restricted) 3300014720|Ga0172376_10713903Not Available541Open in IMG/M
3300014819|Ga0119954_1007195Not Available2734Open in IMG/M
3300017788|Ga0169931_10006544All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes17539Open in IMG/M
3300017788|Ga0169931_10140490All Organisms → cellular organisms → Bacteria2194Open in IMG/M
3300017788|Ga0169931_10895589All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300020151|Ga0211736_10230306Not Available3654Open in IMG/M
3300020151|Ga0211736_10270315Not Available972Open in IMG/M
3300020159|Ga0211734_10227574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage692Open in IMG/M
3300020159|Ga0211734_11364582Not Available814Open in IMG/M
3300020160|Ga0211733_10329155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
3300020160|Ga0211733_11234951Not Available775Open in IMG/M
3300020161|Ga0211726_10104144Not Available5125Open in IMG/M
3300020161|Ga0211726_10856158Not Available1172Open in IMG/M
3300020161|Ga0211726_11055961Not Available1254Open in IMG/M
3300020172|Ga0211729_10678665All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1571Open in IMG/M
3300020172|Ga0211729_10767868Not Available2754Open in IMG/M
3300020172|Ga0211729_11438225Not Available857Open in IMG/M
3300020513|Ga0208090_1010165Not Available1505Open in IMG/M
3300020514|Ga0208202_1007984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1446Open in IMG/M
3300020524|Ga0208858_1044296All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300020527|Ga0208232_1002354Not Available3358Open in IMG/M
3300020532|Ga0208601_1050181Not Available581Open in IMG/M
3300020533|Ga0208364_1030841Not Available728Open in IMG/M
3300020542|Ga0208857_1050433Not Available632Open in IMG/M
3300020543|Ga0208089_1010026All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4401540Open in IMG/M
3300020554|Ga0208599_1053592All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300020557|Ga0208231_1018826Not Available1200Open in IMG/M
3300020568|Ga0208598_1002659Not Available3908Open in IMG/M
3300021376|Ga0194130_10121567Not Available1659Open in IMG/M
3300027608|Ga0208974_1062198Not Available1050Open in IMG/M
3300027608|Ga0208974_1098563Not Available782Open in IMG/M
3300027608|Ga0208974_1149260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300027649|Ga0208960_1028996All Organisms → cellular organisms → Bacteria2015Open in IMG/M
3300027707|Ga0209443_1164600All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage799Open in IMG/M
(restricted) 3300027728|Ga0247836_1019829All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5079Open in IMG/M
(restricted) 3300027730|Ga0247833_1018776Not Available5287Open in IMG/M
(restricted) 3300027730|Ga0247833_1081150Not Available1525Open in IMG/M
(restricted) 3300027730|Ga0247833_1103807Not Available1250Open in IMG/M
3300027756|Ga0209444_10064068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1610Open in IMG/M
3300027770|Ga0209086_10312863All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300027797|Ga0209107_10348312Not Available685Open in IMG/M
3300027974|Ga0209299_1224768Not Available678Open in IMG/M
(restricted) 3300027977|Ga0247834_1009235Not Available9583Open in IMG/M
(restricted) 3300027977|Ga0247834_1117283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1145Open in IMG/M
(restricted) 3300027977|Ga0247834_1148102All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage953Open in IMG/M
(restricted) 3300028553|Ga0247839_1085579Not Available1562Open in IMG/M
(restricted) 3300028553|Ga0247839_1357717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
(restricted) 3300028557|Ga0247832_1045941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1022365Open in IMG/M
(restricted) 3300028559|Ga0247831_1080213Not Available1501Open in IMG/M
(restricted) 3300028569|Ga0247843_1009323Not Available10965Open in IMG/M
(restricted) 3300028569|Ga0247843_1093408Not Available1398Open in IMG/M
(restricted) 3300028571|Ga0247844_1006437Not Available14055Open in IMG/M
(restricted) 3300028581|Ga0247840_10536746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300031758|Ga0315907_10061832Not Available3263Open in IMG/M
3300031787|Ga0315900_11012781Not Available544Open in IMG/M
3300031857|Ga0315909_10003848All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage18070Open in IMG/M
3300031857|Ga0315909_10014659Not Available8092Open in IMG/M
3300031857|Ga0315909_10030867Not Available5203Open in IMG/M
3300031857|Ga0315909_10039822Not Available4459Open in IMG/M
3300031857|Ga0315909_10106181All Organisms → cellular organisms → Bacteria2408Open in IMG/M
3300031857|Ga0315909_10715516Not Available647Open in IMG/M
3300031951|Ga0315904_10429484Not Available1188Open in IMG/M
3300031951|Ga0315904_11423157All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300032116|Ga0315903_10299180Not Available1361Open in IMG/M
3300033816|Ga0334980_0001624Not Available10366Open in IMG/M
3300033816|Ga0334980_0258442All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300033981|Ga0334982_0356357Not Available675Open in IMG/M
3300034012|Ga0334986_0159317Not Available1295Open in IMG/M
3300034021|Ga0335004_0214291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1192Open in IMG/M
3300034062|Ga0334995_0054069Not Available3261Open in IMG/M
3300034062|Ga0334995_0361561Not Available924Open in IMG/M
3300034062|Ga0334995_0700885Not Available570Open in IMG/M
3300034064|Ga0335001_0365846Not Available779Open in IMG/M
3300034066|Ga0335019_0222819Not Available1211Open in IMG/M
3300034071|Ga0335028_0349563Not Available861Open in IMG/M
3300034071|Ga0335028_0430426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage746Open in IMG/M
3300034093|Ga0335012_0071521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021972Open in IMG/M
3300034101|Ga0335027_0270790Not Available1163Open in IMG/M
3300034103|Ga0335030_0185803Not Available1457Open in IMG/M
3300034116|Ga0335068_0047834All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2515Open in IMG/M
3300034118|Ga0335053_0630296Not Available613Open in IMG/M
3300034283|Ga0335007_0038339Not Available3743Open in IMG/M
3300034284|Ga0335013_0521747Not Available707Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater39.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater13.11%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater11.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater9.02%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic7.38%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton5.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.10%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.28%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.28%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.82%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.82%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.82%
SalineEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline0.82%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300004369Saline microbial communities from the South Caspian sea - cas-15EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300014819Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011AEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020514Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020524Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020527Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020532Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020533Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020542Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020543Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020554Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020557Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020568Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027649Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027707Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)EnvironmentalOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027977 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12mEnvironmentalOpen in IMG/M
3300028553 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16mEnvironmentalOpen in IMG/M
3300028557 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4mEnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10992933593300002408FreshwaterMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEEN*
B570J29032_10993865613300002408FreshwaterMKKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFDIEED*
B570J29032_10995311053300002408FreshwaterMKKKTKVLVLIILSFLTAISLWAASNFKKMSNLDIFNIEED*
B570J40625_100016647123300002835FreshwaterMKKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED*
B570J40625_100069175103300002835FreshwaterMKKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFNIEED*
B570J40625_10008398383300002835FreshwaterMKKKTKLLVLIVLSLLTAISLWAASNFKKMSDLDIFNIEED*
B570J40625_10024896213300002835FreshwaterMKKKTKILILIILSLLTAMTLWVASNLKKISELNIFDIEEN*
B570J40625_10043929933300002835FreshwaterMKKKTKILILITLSFLTAVTLWAASNLKKISDLDIFDVEED*
B570J40625_10112061533300002835FreshwaterMKKKTKILILISLSISTATTLWIASNLKKISDLDFFDIEKD*
JGI25908J49247_1001155653300003277Freshwater LakeMKKKTKIIILIVLSFLTAVSLWTAANFKKMSDLDIFDIEKD*
Ga0065726_14778273300004369SalineMKKKTKVLVLMVLSLLIAISLWAASNFKKIYDLDIFDVEED*
Ga0068876_1017574843300005527Freshwater LakeMWNNDNNMKKKTKILILIILSLLTAMTLWVASNLKKISELNIFDIEEN*
Ga0068872_1056752123300005528Freshwater LakeNNDNNMKKKTKILILIILSLLTAMTLWVASNLKKISELNIFDIEEN*
Ga0049081_1003372973300005581Freshwater LenticMKKNTKILILVILSFLTAVTLWAASNLKKISDLDIFDVEDD*
Ga0049080_1008726033300005582Freshwater LenticMFKMWSNNNKMKKKTKIIILIVLSFLTAVSLWTAANFKKISDSNIFNIEED*
Ga0049080_1026333223300005582Freshwater LenticMWSNDSNMKKNTKILILVILSFLTAVTLWAASNLKKISDLDIFDVEDD*
Ga0049082_1016370443300005584Freshwater LenticMSKMWSNNNKMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEED*
Ga0049084_1003055243300005585Freshwater LenticMKKKTKIVILIVLSFLTAVSLWTAANFKKISDLDIFDIEED*
Ga0105747_118192033300007974Estuary WaterMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEKD*
Ga0114340_112682823300008107Freshwater, PlanktonMWSNNNKMKKKTKVIVLIVLSFLTAVSLWAAANFKKMSDLNIFDIEED*
Ga0114350_1004811143300008116Freshwater, PlanktonMKKKTKLLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED*
Ga0114350_101771443300008116Freshwater, PlanktonMWNNNNKMKKKTKIIILMVLFFLTAVSLWVAANFKKISDLNIFDIEKD*
Ga0114350_102467663300008116Freshwater, PlanktonMKKKTKVLVLIVLSLLTAVSLWAASNFKKISDLDIFDIEED*
Ga0114351_134309913300008117Freshwater, PlanktonMYKMWSNDSNMKKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED*
Ga0114355_113253323300008120Freshwater, PlanktonMWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKKISDLDIFDVEED*
Ga0114355_123266723300008120Freshwater, PlanktonKKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFDIEED*
Ga0114981_1040919833300009160Freshwater LakeMKKKTKIIVLIILSFLTAVSLWAAANFKKMSDLNIFDVEDD*
Ga0114966_1052226323300009161Freshwater LakeMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLNIFDIEED*
Ga0164293_1057766313300013004FreshwaterMKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFDVEED*
Ga0164293_1086957333300013004FreshwaterMKKKTKIIILIVLFFLTAVSLWTAANFKKISDLNLFNIEED*
(restricted) Ga0172367_1008924963300013126FreshwaterMKKKTKILILVILSFLTALSLWVASNLKELSDLDIFDIDKE*
(restricted) Ga0172367_1058690813300013126FreshwaterKMWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFNVEED*
(restricted) Ga0172373_1003727553300013131FreshwaterMKKKTKILILIILSFLTALSLWIASNLKGLSDLDIFDIDEE*
(restricted) Ga0172373_1003820323300013131FreshwaterMKKKTKILILIALSFLTAVTLWAASNLKKISDLDIFNVEED*
(restricted) Ga0172373_1005389863300013131FreshwaterMKKNTKILVLLFLSFFIATALWVASNLKQLSDLDVFNIEED*
(restricted) Ga0172372_1003512473300013132FreshwaterMKKKTKILILVILSFLTALSLWIASNLKGLSDLDIFDIDEE*
(restricted) Ga0172372_1042047933300013132FreshwaterMWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFNVEED*
Ga0177922_1043874623300013372FreshwaterMWSNNNKMKNKIKITILIVLFFLTAVSLWTAANFKKMSDLDIFNIEED*
(restricted) Ga0172376_1020886733300014720FreshwaterMWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFNIEED*
(restricted) Ga0172376_1071390323300014720FreshwaterMKKKTKILILVALSFLTALTLWVASNLNKLSDLDIFDIDEE*
Ga0119954_100719533300014819FreshwaterMWSNDSNMKKKTKILTLVVLSFLTALSLWVASNLKGLSDLDIFDIDEE*
Ga0169931_10006544283300017788FreshwaterMKKTKILVLIVLSFLTAISLWAASNFKKISDLDIFDIEED
Ga0169931_1014049023300017788FreshwaterMKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFNIEED
Ga0169931_1089558933300017788FreshwaterMWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKKISDLDVFNIEE
Ga0211736_1023030623300020151FreshwaterMKKKTKIIILIFLSFLTAVSLWTAANFKKISDLDIFNIEED
Ga0211736_1027031523300020151FreshwaterMKKQTKILIVMVLSFLTASTLWAASNFKKMSDLDIFNIEED
Ga0211734_1022757423300020159FreshwaterMWSNDSNMKKKTKILILIILSFLTAVTLWVASNLKKISDLDVFNIEED
Ga0211734_1136458223300020159FreshwaterVWNNDSDMKKNTKILILITLSFLTAVTLWTASNLKKISDLDIFNVEED
Ga0211733_1032915543300020160FreshwaterMKKNTKILILVILSFLTAVTLWAASNLKKISDLDIFDVEED
Ga0211733_1123495123300020160FreshwaterMWSNNNKMKKKTKIIILIVLSFLTAISLWTAANFKKISDLDIFDIEED
Ga0211726_10104144123300020161FreshwaterMKKKTKIIILIVLSFLTAISLWTAANFKKISDLDIFDIEED
Ga0211726_1085615823300020161FreshwaterMKNKTKIIILIVLSFLTAVSLWTATNFKKISDLDIFDIEED
Ga0211726_1105596153300020161FreshwaterMKKNTKILILLILSFLTAVTLWAASNLKRISDLDIFDVEED
Ga0211729_1067866543300020172FreshwaterMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEED
Ga0211729_1076786833300020172FreshwaterMKKKTKIIILIFLSFLTAISLWTAANFKKISDLDIFNIEED
Ga0211729_1143822523300020172FreshwaterMSKMWSNNNKMKNKTKIIILIVLSFLTAVSLWTATNFKKISDLDIFDIEED
Ga0208090_101016533300020513FreshwaterMKKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED
Ga0208202_100798443300020514FreshwaterMKKKTKILILIILSLLTAMTLWVASNLKKISELNIFDIEEN
Ga0208858_104429613300020524FreshwaterMWSNDSNMKKKTKILILITLSFLTAVTLWTASNLKRISDLDIFDVEED
Ga0208232_100235423300020527FreshwaterMKKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFDIEED
Ga0208601_105018113300020532FreshwaterMWSNDSNMKKKTKVLVLIILSFLTAISLWAASNFKKMSNLDIFNIEED
Ga0208364_103084113300020533FreshwaterNMKKKTKLLVLIVLSLLTAISLWAASNFKKMSDLDIFNIEED
Ga0208857_105043333300020542FreshwaterMKKKTKILILITLSFLTAVTLWTASNLKRISDLDIFDVEED
Ga0208089_101002623300020543FreshwaterMWSNDSNMKKKTKLLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED
Ga0208599_105359223300020554FreshwaterMKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFDVEED
Ga0208231_101882623300020557FreshwaterMKKKTKLLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED
Ga0208598_100265963300020568FreshwaterMKKKTKLLVLIVLSLLTAISLWAASNFKKMSDLDIFNIEED
Ga0194130_1012156773300021376Freshwater LakeMKKKTKILILVILSFLTALSLWVASNLKELSDLDIFDIDKE
Ga0208974_106219843300027608Freshwater LenticMKTKIIILIVLSFLTAVSLWTAANFKKISDSNIFNIEED
Ga0208974_109856333300027608Freshwater LenticMKKNTKILILVILSFLTAVTLWAASNLKKISDLDIFDVEDD
Ga0208974_114926013300027608Freshwater LenticMFKMWSNNNKMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEED
Ga0208960_102899653300027649Freshwater LenticMKKKTKIVILIVLSFLTAVSLWTAANFKKISDLDIFDIEED
Ga0209443_116460033300027707Freshwater LakeMKKKTKIIILIVLSFLTAVSLWTAANFKKMSDLDIFDIEKD
(restricted) Ga0247836_101982963300027728FreshwaterMKKKTKITILIVLSFLTAVSLWTAANFKKISDLDIFDIEND
(restricted) Ga0247833_101877613300027730FreshwaterMKKKTKIIILIILSFLTAVTLWVAANFKKISDLDIFDIEDD
(restricted) Ga0247833_108115013300027730FreshwaterMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEND
(restricted) Ga0247833_110380723300027730FreshwaterMKKKTKILILITLSFLTAVTLWAAANLKRISDLDIFDVEED
Ga0209444_1006406823300027756Freshwater LakeMSKMWSNHNKMKKKTKIIILIVLSFLTAVSLWTAANFKKMSDLDIFDIEKD
Ga0209086_1031286333300027770Freshwater LakeMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLNIFDIEED
Ga0209107_1034831213300027797Freshwater And SedimentSNNNKMKTKIIILIVLSFLTAVSLWTAANFKKISDSNIFNIEED
Ga0209299_122476833300027974Freshwater LakeMKKKTKIIVLIILSFLTAVSLWAAANFKKMSDLNIFDVEDD
(restricted) Ga0247834_1009235243300027977FreshwaterMKKKTKILILITLSFLTAVTLWAASNLKKISDLDVFNIEED
(restricted) Ga0247834_111728333300027977FreshwaterMKKKTKITILIVLSFLTAVALWTAASFKKISDLDIFDIEND
(restricted) Ga0247834_114810233300027977FreshwaterMKKKTKIIILIILSFLTAVTLWVAANFKKIFDLDIFDIEDD
(restricted) Ga0247839_108557953300028553FreshwaterMWRNNNKMKKKTKITILIVLSFLTAVSLWTAANFKKISDLDIFDIEND
(restricted) Ga0247839_135771723300028553FreshwaterMWSNNSDMKKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED
(restricted) Ga0247832_104594123300028557FreshwaterMWSNDSNMKKKTKILILITLSFLTAVTLWAAANLKRISDLDIFDVEED
(restricted) Ga0247831_108021313300028559FreshwaterMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEN
(restricted) Ga0247843_1009323283300028569FreshwaterMWSNDSNMKKKTKIIILIILSFLTAVTLWVAANFKKISDLDIFDIEND
(restricted) Ga0247843_109340833300028569FreshwaterMWSNDSNMKKNTKILILLILSFLTAVTLWAASNLKRISDLDIFDVEED
(restricted) Ga0247844_100643793300028571FreshwaterMKKKTKIIILIILSFLTAVTLWVAANFKKISDLDIFDIEND
(restricted) Ga0247840_1053674613300028581FreshwaterMSKMWSNNNKMKKKTKITILIVLSFLTAVALWTAASFKKMSDLDIFDIEND
Ga0315907_1006183233300031758FreshwaterMWNNNNKMKKKTKIIILMVLFFLTAVSLWVAANFKKISDLNIFDIEKD
Ga0315900_1101278113300031787FreshwaterMWNNDNNMKKKTKILILIILSLLTAMTLWVASNLKKISELNIFDIEEN
Ga0315909_10003848373300031857FreshwaterMKKKTKILILITLSFLTAVTLWAASNLKKISDLDIFDVEED
Ga0315909_1001465983300031857FreshwaterMKKKTKIIILMVLFFLTAVSLWVAANFKKISDLNIFDIEKD
Ga0315909_1003086723300031857FreshwaterMKKKTKVLVLIVLSLLTAVSLWAASNFKKISDLDIFDIEED
Ga0315909_1003982233300031857FreshwaterMKKKTKILILVILSFLTTLSLWIASNLKELSDLDIFDIDEE
Ga0315909_1010618163300031857FreshwaterMKKKTKVIVLIVLSFLTAVSLWAAANFKKMSDLNIFDIEED
Ga0315909_1071551613300031857FreshwaterKKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED
Ga0315904_1042948443300031951FreshwaterMWSNNNKMKKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFDIEED
Ga0315904_1142315713300031951FreshwaterMWSNGDNMKKKTKILILMILSFLTALSLWIASNLKELSDLDIFDIDEE
Ga0315903_1029918023300032116FreshwaterMWSNNNKMKKKTKVIVLIVLSFLTAVSLWAAANFKKMSDLNIFDIEED
Ga0334980_0001624_6466_66123300033816FreshwaterMWSNDSNMKKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED
Ga0334980_0258442_346_5013300033816FreshwaterMLKMWSNNNKMKKKTKITILIVLSFLTAVSLWTAANFKKISDLDIFDIEED
Ga0334982_0356357_89_2353300033981FreshwaterMWSNDSNMKKKTKLLVLIVLSLLTAISLWAASNFKKMSDLDIFNIEED
Ga0334986_0159317_586_7263300034012FreshwaterMWSNDSNMKKKTKILILLSFLTAVTLWAASNLKRISDLDIFDVEED
Ga0335004_0214291_3_1373300034021FreshwaterMWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFDV
Ga0334995_0054069_2216_23623300034062FreshwaterMWSNNNKMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEEN
Ga0334995_0361561_739_8643300034062FreshwaterMKKKTKILILISLSISTATTLWIASNLKKISDLDFFDIEKD
Ga0334995_0700885_351_4973300034062FreshwaterMWSNDNNMKKKTKILILITLSFLTAVTLWAASNLKKISDLDIFDVEED
Ga0335001_0365846_640_7773300034064FreshwaterMWSNDSNMKKKTKILILIALSFLTAVTLWAASNLKRISDLDIFDVE
Ga0335019_0222819_572_7183300034066FreshwaterMWSNDSNMKKKTKILILIALSFLTAVTLWAASNLKRISDLDIFDVEED
Ga0335028_0349563_376_5013300034071FreshwaterMKKKTKIIILIVLSFLTAALLWTAANFKKISDLDIFDIEED
Ga0335028_0430426_509_6343300034071FreshwaterMKKKTKVLILIALSISTATTLWITYNLKKISNLDFFDIEKD
Ga0335012_0071521_633_7583300034093FreshwaterMKKKTKILILITLSFLTATTLWVAYNLKKISDLDIFDIEED
Ga0335027_0270790_789_9443300034101FreshwaterMSKMWSNNNKMKKKTKITILIVLSFLTAVSLWTAANFKKISDLDIFDIEED
Ga0335030_0185803_1023_11693300034103FreshwaterMWSNNNKMKKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFNIEED
Ga0335068_0047834_15_1613300034116FreshwaterMWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKKISDLDIFDVEED
Ga0335053_0630296_87_2333300034118FreshwaterMWSNDSNMKKKTKTLILITLSFLTAVTLWAASNLKRISDLDIFDVEED
Ga0335007_0038339_661_7863300034283FreshwaterMKKNTKIIIVVVLSFLTGLALWAASNLKTISDLDIFNIEED
Ga0335013_0521747_248_3943300034284FreshwaterMWSNNNKMKKKTKIIILIVLFFLTAVSLWTAANFKKISDLNLFNIEED


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.