NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070792

Metagenome / Metatranscriptome Family F070792

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070792
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 175 residues
Representative Sequence VKLATVLKGGASAATVVLLVWATVEAQGTPDTNSPQMAVLHATVTITGGLAFTGSYDNRLSVRTCADVARGGTCESGGTGGAAFDVPIPPPDPGGNPGSVGGGHTFSTDAAAWPYHGPGTYTGSGLTATQMDVDTPPGSQDTHIFAFPTGVGTLIVKPDASGSFQFNGLQDPGSVTISGQVIWTCS
Number of Associated Samples 86
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 51.28 %
% of genes near scaffold ends (potentially truncated) 43.44 %
% of genes from short scaffolds (< 2000 bps) 61.48 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.74

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.803 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(24.590 % of family members)
Environment Ontology (ENVO) Unclassified
(64.754 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(50.820 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 4.67%    β-sheet: 31.31%    Coil/Unstructured: 64.02%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.74
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
f.4.4.0: automated matchesd2x55a12x550.58183
f.4.1.1: Outer membrane proteind1p4ta_1p4t0.56445
f.4.1.3: GNA1870 immunodominant domain-liked3hola23hol0.55075
f.4.1.0: automated matchesd3qraa_3qra0.54853
f.4.1.2: Outer membrane enzyme PagPd3gp6a13gp60.52555


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF00155Aminotran_1_2 9.84
PF11746DUF3303 3.28
PF03544TonB_C 3.28
PF02604PhdYeFM_antitox 2.46
PF03976PPK2 1.64
PF00162PGK 1.64
PF13376OmdA 1.64
PF00156Pribosyltran 1.64
PF04368DUF507 1.64
PF13304AAA_21 1.64
PF01872RibD_C 1.64
PF13473Cupredoxin_1 1.64
PF00579tRNA-synt_1b 0.82
PF01292Ni_hydr_CYTB 0.82
PF12344UvrB 0.82
PF08818DUF1801 0.82
PF13360PQQ_2 0.82
PF13385Laminin_G_3 0.82
PF13744HTH_37 0.82
PF00005ABC_tran 0.82
PF13855LRR_8 0.82
PF00215OMPdecase 0.82
PF05988DUF899 0.82
PF01381HTH_3 0.82
PF01261AP_endonuc_2 0.82
PF01757Acyl_transf_3 0.82
PF13181TPR_8 0.82
PF07676PD40 0.82
PF02800Gp_dh_C 0.82
PF00265TK 0.82
PF07638Sigma70_ECF 0.82
PF02786CPSase_L_D2 0.82
PF01509TruB_N 0.82
PF13290CHB_HEX_C_1 0.82
PF00753Lactamase_B 0.82
PF05973Gp49 0.82
PF00116COX2 0.82
PF13442Cytochrome_CBB3 0.82
PF08447PAS_3 0.82
PF11369DUF3160 0.82
PF00141peroxidase 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 3.28
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 2.46
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 2.46
COG01263-phosphoglycerate kinaseCarbohydrate transport and metabolism [G] 1.64
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 1.64
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 1.64
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 1.64
COG0057Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenaseCarbohydrate transport and metabolism [G] 0.82
COG0130tRNA U55 pseudouridine synthase TruB, may also work on U342 of tmRNATranslation, ribosomal structure and biogenesis [J] 0.82
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.82
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.82
COG0376Catalase (peroxidase I)Inorganic ion transport and metabolism [P] 0.82
COG1435Thymidine kinaseNucleotide transport and metabolism [F] 0.82
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.82
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 0.82
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 0.82
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 0.82
COG3038Cytochrome b561Energy production and conversion [C] 0.82
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.82
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 0.82
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 0.82
COG4263Nitrous oxide reductaseInorganic ion transport and metabolism [P] 0.82
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.82
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.82
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.82
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.82
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.80 %
UnclassifiedrootN/A8.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10018964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii4307Open in IMG/M
3300004082|Ga0062384_101297960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis533Open in IMG/M
3300005994|Ga0066789_10326664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii641Open in IMG/M
3300009518|Ga0116128_1070084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1072Open in IMG/M
3300009522|Ga0116218_1479276All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii555Open in IMG/M
3300009617|Ga0116123_1201117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii502Open in IMG/M
3300009630|Ga0116114_1054915All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1115Open in IMG/M
3300009634|Ga0116124_1138560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii681Open in IMG/M
3300009644|Ga0116121_1203634All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii630Open in IMG/M
3300009665|Ga0116135_1009279Not Available3566Open in IMG/M
3300010343|Ga0074044_10149120All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1565Open in IMG/M
3300014156|Ga0181518_10059668All Organisms → cellular organisms → Bacteria2248Open in IMG/M
3300014160|Ga0181517_10027774All Organisms → cellular organisms → Bacteria → Proteobacteria3752Open in IMG/M
3300014160|Ga0181517_10056369All Organisms → cellular organisms → Bacteria → Proteobacteria2398Open in IMG/M
3300014160|Ga0181517_10164319All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1237Open in IMG/M
3300014161|Ga0181529_10022118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus5198Open in IMG/M
3300014162|Ga0181538_10271556All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii928Open in IMG/M
3300014162|Ga0181538_10678985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii534Open in IMG/M
3300014164|Ga0181532_10036926All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3330Open in IMG/M
3300014167|Ga0181528_10185939Not Available1122Open in IMG/M
3300014168|Ga0181534_10994487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii506Open in IMG/M
3300014169|Ga0181531_10032442All Organisms → cellular organisms → Bacteria3017Open in IMG/M
3300014199|Ga0181535_10000302All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae75942Open in IMG/M
3300014199|Ga0181535_10074618All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2240Open in IMG/M
3300014200|Ga0181526_10082144All Organisms → cellular organisms → Bacteria2054Open in IMG/M
3300014200|Ga0181526_10443445All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii823Open in IMG/M
3300014200|Ga0181526_10446751All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii820Open in IMG/M
3300014200|Ga0181526_10976073All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii532Open in IMG/M
3300014201|Ga0181537_10060599All Organisms → cellular organisms → Bacteria → Acidobacteria2565Open in IMG/M
3300014201|Ga0181537_10323608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1059Open in IMG/M
3300014495|Ga0182015_10022495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5091Open in IMG/M
3300014495|Ga0182015_10201079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1332Open in IMG/M
3300014496|Ga0182011_10169245All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300014499|Ga0182012_10937782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii545Open in IMG/M
3300014501|Ga0182024_10025640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE006810396Open in IMG/M
3300014655|Ga0181516_10039589All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2398Open in IMG/M
3300014655|Ga0181516_10084364All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1602Open in IMG/M
3300014658|Ga0181519_10094244All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1941Open in IMG/M
3300014838|Ga0182030_10138331All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3151Open in IMG/M
3300014838|Ga0182030_10631376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1024Open in IMG/M
3300014838|Ga0182030_10715960All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii935Open in IMG/M
3300016700|Ga0181513_1372590All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii653Open in IMG/M
3300017931|Ga0187877_1025548All Organisms → cellular organisms → Bacteria3066Open in IMG/M
3300017946|Ga0187879_10568999All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii629Open in IMG/M
3300017946|Ga0187879_10830698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii516Open in IMG/M
3300017948|Ga0187847_10028463All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3346Open in IMG/M
3300017948|Ga0187847_10057865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2191Open in IMG/M
3300017975|Ga0187782_10294987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1223Open in IMG/M
3300017988|Ga0181520_10011763All Organisms → cellular organisms → Bacteria11415Open in IMG/M
3300017988|Ga0181520_10048144All Organisms → cellular organisms → Bacteria4099Open in IMG/M
3300017988|Ga0181520_10072868All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis3084Open in IMG/M
3300017988|Ga0181520_10104628Not Available2414Open in IMG/M
3300017988|Ga0181520_10249111All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300017988|Ga0181520_10254238All Organisms → cellular organisms → Bacteria1341Open in IMG/M
3300017996|Ga0187891_1034091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2258Open in IMG/M
3300018009|Ga0187884_10470969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii505Open in IMG/M
3300018012|Ga0187810_10385018All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii588Open in IMG/M
3300018013|Ga0187873_1031003All Organisms → cellular organisms → Bacteria2526Open in IMG/M
3300018022|Ga0187864_10161444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1097Open in IMG/M
3300018030|Ga0187869_10535995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii555Open in IMG/M
3300018033|Ga0187867_10150043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1341Open in IMG/M
3300018033|Ga0187867_10158816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1298Open in IMG/M
3300018034|Ga0187863_10059018All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2181Open in IMG/M
3300018034|Ga0187863_10235889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1017Open in IMG/M
3300018038|Ga0187855_10276171All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii984Open in IMG/M
3300018040|Ga0187862_10700333All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii592Open in IMG/M
3300018043|Ga0187887_10188616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1228Open in IMG/M
3300018044|Ga0187890_10804618All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii532Open in IMG/M
3300018046|Ga0187851_10029665All Organisms → cellular organisms → Bacteria → Acidobacteria3737Open in IMG/M
3300018046|Ga0187851_10417767All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii766Open in IMG/M
3300018047|Ga0187859_10454701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii708Open in IMG/M
3300018047|Ga0187859_10598657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii621Open in IMG/M
3300023068|Ga0224554_1016555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2356Open in IMG/M
3300024295|Ga0224556_1080442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii798Open in IMG/M
3300025612|Ga0208691_1006572Not Available3202Open in IMG/M
3300027570|Ga0208043_1090616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii836Open in IMG/M
3300027662|Ga0208565_1026311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2024Open in IMG/M
3300027879|Ga0209169_10074538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1754Open in IMG/M
3300028565|Ga0302145_10155560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii770Open in IMG/M
3300028748|Ga0302156_10029012All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00683162Open in IMG/M
3300028748|Ga0302156_10038004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2683Open in IMG/M
3300028762|Ga0302202_10205534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1005Open in IMG/M
3300028780|Ga0302225_10198451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii965Open in IMG/M
3300028789|Ga0302232_10374256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii701Open in IMG/M
3300028866|Ga0302278_10181509All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1064Open in IMG/M
3300029914|Ga0311359_10040587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis5111Open in IMG/M
3300029914|Ga0311359_10750563All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii692Open in IMG/M
3300029945|Ga0311330_10050703All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00684497Open in IMG/M
3300029951|Ga0311371_11880638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii642Open in IMG/M
3300029994|Ga0302283_1296366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii563Open in IMG/M
3300029999|Ga0311339_11289314All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii663Open in IMG/M
3300030041|Ga0302274_10168132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1110Open in IMG/M
3300030399|Ga0311353_11706992All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii506Open in IMG/M
3300030739|Ga0302311_10744245All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii643Open in IMG/M
3300030743|Ga0265461_10038941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1676Open in IMG/M
3300031234|Ga0302325_10000124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae223740Open in IMG/M
3300031234|Ga0302325_10982176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1157Open in IMG/M
3300031234|Ga0302325_13000515All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii546Open in IMG/M
3300031236|Ga0302324_100101853All Organisms → cellular organisms → Bacteria4866Open in IMG/M
3300031236|Ga0302324_101956715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii738Open in IMG/M
3300031258|Ga0302318_10184881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii995Open in IMG/M
3300031259|Ga0302187_10079975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681922Open in IMG/M
3300031708|Ga0310686_109222616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1341Open in IMG/M
3300031708|Ga0310686_111161384All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii5344Open in IMG/M
3300031708|Ga0310686_113423028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii531Open in IMG/M
3300031708|Ga0310686_113848017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1428Open in IMG/M
3300032515|Ga0348332_10335272All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii806Open in IMG/M
3300033402|Ga0326728_10003774All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae46150Open in IMG/M
3300033402|Ga0326728_10031468All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00688917Open in IMG/M
3300033402|Ga0326728_10044865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia6706Open in IMG/M
3300033402|Ga0326728_10076526Not Available4360Open in IMG/M
3300033405|Ga0326727_10413546All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1228Open in IMG/M
3300033755|Ga0371489_0165958All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1183Open in IMG/M
3300033983|Ga0371488_0072438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2011Open in IMG/M
3300034091|Ga0326724_0636851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii525Open in IMG/M
3300034124|Ga0370483_0039195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1466Open in IMG/M
3300034163|Ga0370515_0076598All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1453Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog24.59%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland18.85%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog9.84%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa9.02%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland7.38%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil6.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.28%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.28%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog3.28%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.64%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.64%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.64%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.82%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.82%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.82%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.82%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.82%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.82%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.82%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016700Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025477Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029994Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1001896433300000567Peatlands SoilVDLAKILAGAASAAVVILFLPATVPARGTQDTNVPKMAVLHATITITGGLTFTGAYDDRLTVGTCADIAKGGTHGPDSDGDAMFYVPVPLDNTGGDGGPVGGGHTFTTDVAASPYHGPGTYTGSGLTATQMDVDTPPGSQDTHIFAFPTSVGTMIVNPDASGSFKFEGLQDPGSVTISGQVSWTCS*
Ga0062384_10129796013300004082Bog Forest SoilVSATVPAQVTPNTNLPKMAVLHATVTIAGGLAFTGSYDDRLVVPTCADVAKGGTSAPGSSGGATFAVPVPPYNAGGSPGSVGGGHTFATDVAAWPYHGPGTYTGSGLTATQMDVDTLPGDQETHIFALPTGVGTLIVKPDASGSFQFNGLQDPGSVRISGRIIWTCS*
Ga0066789_1032666413300005994SoilEGVGVEFAIVRRVLQGGAGAAMVVLLGVAAVPALVAQPKTVVLHATVTISGGLTFTGSYVTRLLGQSCADIAKGGTNPPSGLNRAAFYVPVPPYQGGNSGSVGGGHTFSTDAEAYPYHGPGTYTGHELTATQLDADKPPSSEVVHIFAFPTDIGTLIVKPDASGSFEFNGLQDPGSMKISGKVVWTCSN*
Ga0116128_107008423300009518PeatlandMAVLHATITITGGLTLTGTYDDRLTLATCADVAKSGTSADGRGVRMFYVPIPPLNPDGNPGPVGGGHTFSTDAAASPYHGPGTYTGSGLNATQMDVDTPPGSQDTHIFAFPAIVGTLIVKPDASGSFQFDGLQDPGSVTISGQVTWTCS*
Ga0116218_147927613300009522Peatlands SoilLAGAASAAVVILFLPATVPARGTQDTNVPKMAVLHATITITGGLTFTGAYDDRLTVGTCADIAKGGTHGPDSDGDAMFYVPVPLDNTGGDGGPVGGGHTFTTDVAASPYHGPGTYTGSGLTATQMDVDTPPGSQDTHIFAFPTSVGTMIVNPDASGSFKFEGLQDPGSVTISGQVSWTCS
Ga0116123_120111713300009617PeatlandMAVLHATITITGGLTLTGTYDDRLTLATCADVAKSGTSADGRGVRMFYVPIPPLNPDGNPGPVGGGHTFSTDAAASPYHGPGTYTGSGLNATQMDVDTPPGSQDTHIFAFPAIVGTLIVKPDASGSFQFDGLQDPGSVTISGQVT
Ga0116114_105491513300009630PeatlandLTLTGTYDDRLTLATCADVAKSGTSADGRGVRMFYVPIPPLNPDGNPGPVGGGHTFSTDAAASPYHGPGTYTGSGLNATQMDVDTPPGSQDTHIFAFPAIVGTLIVKPDASGSFQFDGLQDPGSVTISGQVTWTCS*
Ga0116124_113856023300009634PeatlandHHHNHRGLTLTGTYDDRLTLATCADVAKSGTSADGRGVRMFYVPIPPLNPDGNPGPVGGGHTFSTDAAASPYHGPGTYTGSGLNATQMDVDTPPGSQDTHIFAFPAIVGTLIVKPDASGSFQFDGLQDPGSVTISGQVTWTCS*
Ga0116121_120363413300009644PeatlandEADVDLAIVRKVLTGGASAAAAALLVSAAVPGQLTPNANSPKMAVLHATVTITGGLAFTGSYDDRLSVRTCADVARRGTGETGGTGGAMFYVPIPQPDPGGNPGQVGGGHTFSTDAVAWPYHGPGRYTGSGLTATQMDVDTPPGSQDTHIFAFPTGVGTLIVKPDASGSFQFNGLQDPGSVTISGQVIWTCS*
Ga0116135_100927943300009665PeatlandMNLANPRKVGPVAALAAAVVLIVFATAGAMGAPDNSQPKTAVLHATVSISGGVSFSGSYDVRLNVQTCAGVARGGTGQHDGLGKAMFYVPIPLESGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGSGLSATQMDADTPPGSEDTHIFAFPTGIGTMVINPDASGSFTFGPLQDPGGVLISGQVVWTCS*
Ga0074044_1014912023300010343Bog Forest SoilMDLAVVRKILAVGTWSAVLVLLMPATVSPQGTTGTDAPKTAALHATITITGGLSFTGSYDDRQTAVTCDDLAKSGTGTPGVSEVQTFYVPVPPLNPDGRPGPVGGGHAFATDDGAWPYNGPGTFTGSGLNATRMDVDTLPGDQETHIFAFPSGVGTLIVKPDASGSFQFEGLQDPGSVTISGQITWTCS*
Ga0181518_1005966813300014156BogKGAILHASVAISGGISFTGSFDDPLIVPTCADVAKGGTNLPGSSGGATFAVPIPPGSGGDPGPVGGHTFATDAAAFPYHGPGTYTGSGLNATEMEVDTRPGDQETHIFAFPTGIGTLIVNPDASGSFQFSNLEDPGSVRISGKVIWSCYNPSK*
Ga0181517_1002777443300014160BogMDLAILRKVGPAAVSAAAVVLVVFATAGAMGAPDNNQPKTAVLHATVSISGGVSFSGSYDVRLNVRTCADVAKSGTGQTDGVGHAMFYVPIPMQPPSGDPGPVGGGHNFSTDAAAEPYHGPGTYTGAALSATQMDADTPPGSQDTHIFAFPTGIGTMVVNPDASGSFTFGPLQDPGGVLISGKVVWTCS*
Ga0181517_1005636923300014160BogMNLANPRKVGPVAALAAAVVLIVFATAWAMGAPDNSQPKTAVLHATVSISGGVSFSGSYDVRLNVQTCAGVARGGTGQHDGLGKAMFYVPIPLESGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGSGLSATQMDADTPPGSEDTHIFAFPTGIGTMVINPDASGSFTFGPLQDPGGVLISGQVVWTCS*
Ga0181517_1016431923300014160BogTITGGVHFTGTYDQRLPVQTCAAVARGGTGQRDGLGKAMFYVPIPAQPPSGNPGPVGGGHNFSTDAAAEPYHGSGTYTGSGLSATQMDADTPPGSQETHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGGALISGRVVWTCS*
Ga0181517_1061380913300014160BogEPDVVWPEDHMMAQTEGSDCRGGINPSREEEAEVDLAIVRKVLTGGALTVVAALLVSATVPAQLAPNTNLPKTAVLHATVSITGGFAFTGSYDDRLPIRACADVAKGGTSLPGSSGVAMFNVPVPPFKPDGSAGPVSGGHTFSADAAASPYHGPGTYTGSGLSATQLDADTLPGDQETHI
Ga0181529_1002211823300014161BogMVVLLASGTVPAQGTPKLAVLHATVTITGGLTFTGSYDARLRLRTCADAARGGTGETDGTGGAMFYLPIPPQNPGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGQGISATELEADTRPDDQETHIFAFPTGIGTLIVNPDASGSFEFNGLEDPGSVHISGRVVWTCS*
Ga0181538_1027155623300014162BogVNLATVLKGGASAAAVVLLVWATVEAQGTPDTSSPNMAVLHATVTITGGLAFTGSYDDRLPVRTCADVARGGTGETGGTGGAMFNVPIPPDSGGNPGPVSGGHTFSTDAAAWSYHGPGTYTGSGLTATQMDVDTPPGSQDTHIFAFPTGVGTLIVKPDASGSFQFNGLQDPGSVTISGQVIWTCS*
Ga0181538_1067898513300014162BogLHASVAISGGISFTGSFDDPLIVPTCADVAKGGTNLPGSSGGATFAVPIPPGSGGDPGPVGGHTFATDAAAFPYHGPGTYTGSGLNATEMEVDTRPGDQETHIFAFPTGIGTLIVNPDASGSFQFSNLEDPGSVRISGKVIWSCYNPSK*
Ga0181532_1003692613300014164BogMPATVPAQGPPGTNAPMTAVLHATIKITGGLSFTGSYDDRQTAATCADLAKSGTGTPGVSEVQTFYVPVPPLNPDGSPGPVGGGHTFATDVAAWPYSGPSTYTGPGLNATQMDVDTLPGDEKTHIFEFPTGVGTLIVRPDASGSFQFEGLQDPGGVTISGQLTWTCS*
Ga0181528_1018593913300014167BogMVVLLASGTVPAQGTPKLAVLHATVTITGGLTFTGSYDARLRVRTCADAARGGTGETDGTGGAMFYLPIPPQNPGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGQGISATELEADTRPDDQETHIFAFPTGIGTLIVNPDASGSFEFNGLEDPGSVHISGRVVWTCS*
Ga0181534_1099448713300014168BogQGTPKLAVLHATVTITGGLAFTGSYDARLPVRTCADVAKGGTGQVDVVTGGASFYVPIPPPNPGGNPGSVGGGHNFSTDAAAWPYRGPGTYTGKGVNGTELEADMRPDDQETHVFAFPTGIGTLIVNSDASGSFEFSGLEDAGSVKISGRVIWTCS*
Ga0181531_1003244223300014169BogMNAPTNPPQTAVLHATVTITGGLSFTGSYDDRLPIRACADVAKGGTSLPGSSGVAMFNVPVPPFKPDGSAGPVSGGHTFSTDAAASPYHGPGTYTGSGLSATQLDADTLPGDQETHIFAFPTGIGVMIVNVDASGSFQFSGLEDPGSVKISGQVVWTCS*
Ga0181535_1000030273300014199BogMMAQTEGSDCRGGINPSREEEAEVDLAIVRKVLTVGAAAALVLLVSAVVPAQGTLGTSSPGTAVLHATVTITGGLSFTGSYDDRLSVRTCADVAKSGTGQTGGTGGAMFYVPIPPQDPGGNPGSVGAGHNFSTDAAAGPYHGPGTYTGSGLTATQLDADTPPGSQDTHIFAFPANIGTMIVKPDASGSFQFAGLQDPGSVIISGQVTWTCS*
Ga0181535_1007461823300014199BogMNLALVWKMLAVGTLSAVLVLLMPATAPAQGTPGANAPATAVLHATITITGGLSFTGSYDDRQTAATCADLAKNGTGTPGVSEVQTFYVPVPPLNPDGSPGPVGSGHNFATDVAAWPYNGPGTYTGSALNATQMDVDTLPGDQETHIFAFPTGVGTLVVNPDASGSFQFQGLQDPGSVTISGQVTWTCS*
Ga0181535_1056839313300014199BogDQRLPVQTCAAVARGGTGQRDGLGKAMFYVPIPAQPPSGNPGPVGGGHNFSTDAAAEPYHGSGTYTGSGLSATQMDADTPPGSQETHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGGALISGRVVWTCS*
Ga0181526_1008214423300014200BogMAWVFAKKVLKVWTSIAGGALLAPAILAAQQSAVLHATVTISGGITFTGSFDQRLPVRTCADAAKSGTMAPGSGGVAMFAVPIPSPNPGGNPGSVSGGHTFATDVAAAPYHGPGTYTGTRLNATELEVDTKPDDQETHIFAFPTEIGTLIIKSDASGSFQFNNLQDPRDVRISGQVVWTCS*
Ga0181526_1044344513300014200BogHATVTITGGLSFTGSYDDRLSVRTCADVAKSGTGQTGGTGGAMFYVPIPPQDPGGNPGSVGAGHNFSTDAAAGPYHGPGTYTGSGLTATQLDADTPPGSQDTHIFAFPANIGTMIVKPDASGSFQFAGLQDPGSVIISGQVTWTCS*
Ga0181526_1044675113300014200BogYRTRIGQSWQKEADMDLAIVRKVLTGGASAAAAALLVSAAVPGQLTPNANSPKMAVLHATVTITGGLAFTGSYDDRLSVRTCADVARRGTGETGGTGGAMFYVPIPQPDPGGNPGQVGGGHTFSTDVAAGPYHGPGTYTGSALNATQMDVDTPPGSEDIHIFAFPTSVGTMIVKPDASGSFQFSGLQDPGSVTISGEVVWTCS*
Ga0181526_1097607313300014200BogLAVLHATVTITGGVHFTGTYDQRLPVQTCAAVARGGTGQRDGLGKPMFYVPIPAQPPSGDPGPVGGGHNFSTDAAAGPYHGPGTYTGSGLVATQMDADTPPGSQETHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGSVLIS
Ga0181537_1006059923300014201BogMDLAIVRKVLTGGASKVAVVLLVSAAMSTQLTPNANSQKMTVLHATVTITGGVSFIGTYDQRLVAPSCADVAKNGTNPPSGPNKASFYVPIPMAPRGASYGPVGGGHTFSTDAAAYPYHGPGTYTGASLSATQLDADTPPASEAIHIFAFPTGIGTLIVKPDASGSFQFNGLQDPGSVTISGQVIWTCS*
Ga0181537_1032360823300014201BogKLAVLHATVTITGGVHFTGTYDQRLPVQTCAAVARGGTGQRDGLGKPMFYVPIPAQPPSGDPGPVGGGHNFSTDAAAEPYHGPGTYTGSGLSATQMDADTPPGSQETHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGSVMISGRVVWTCS*
Ga0182015_1002249563300014495PalsaMKEGWLSPSRQGEADMDLAIVRKVLMGGASKVIVVLLASAIIPGQLTPNANSQKTAVLHATVTITGGVAFTGSYDQRLAIPTCADVAKGGTNPPSGPNKASFYVPIPMPPAGASYGPVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPDSQETHIFAFPTGIGTMIVKPDASGSFQFNGLQDPGSVRISGTVVWTCS*
Ga0182015_1020107933300014495PalsaMAVLHATVTIAGGLAFTGSYDDRLVVPTCADVAKGGTSAPGSSGGATFAVPVPPYNAGGSPGSVGGGHTFATDVAAWPYHGPGTYTGSGLTATQMDVDTLPGDQETHLFALPTGVGTLIVKPDASGSFQFNGLQDPGSVRISGQIIWTCS*
Ga0182011_1016924523300014496FenVKLATVLKGGASAATVVLLVWATVEAQGTPDTNSPQMAVLHATVTITGGLAFTGSYDNRLSVRTCADVARGGTCESGGTGGAAFDVPIPPPDPGGNPGSVGGGHTFSTDAAAWPYHGTGTYTGSGLTATQMDVDTPPGSQDTHIFAFPTGVGTLIVKPDASGSFQFNGLQDPGSVTISGQVIWTCS*
Ga0182012_1093778223300014499BogATVTVSGGVTFTGSYDTRLLGQSCADIAKGGTNPPSGPNRASFYVPIPPPGPGGSYGSVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPNSEDIHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSVKISGQVVWTCSN*
Ga0182024_1002564073300014501PermafrostMDLAIVRKVLTGRASTVVMVLLVSAAMPVQLTPNANAQKMAVLHATVTITGGVTFTGSYDQRLPVPTCADVAKSGTRPPGGSAAAAFYVPIPPPPAGGSYGSVGGGHTFATDVTAYPYHGPGTYTGSSLTATQMDADTPPDSQETHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSVTISGQVVWTCS*
Ga0181516_1003958923300014655BogMNLAVLWKMLAVGTLSAVLVLLMPATAPAQGTPGANAPATAVLHATITITGGLSFTGSYDDRQTAATCADLAKNGTGTPGVSEVQTFYVPVPPLNPDGSPGPVGSGHNFATDVAAWPYNGPGTYTGSALNATQMDVDTLPGDQETHIFAFPTGVGTLVVNPDASGSFQFQGLQDPGSVTISGQVTWTCS*
Ga0181516_1008436423300014655BogMVLLVAAAVPGQGTSQGNAPKLAVLHATVTITGGVHFTGTYDQRLPVQTCAAVARGGTGQRDGLGKAMFYVPIPAQPPSGNPGPVGGGHNFSTDAAAEPYHGSGTYTGSGLSATQMDADTPPGSQETHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGGALISGRVVWTCS*
Ga0181519_1009424423300014658BogMVLLVAAAVPGQGTSQGNAPKLAVLHATVTITGGVHFTGTYDQRLPVQTCAAVARGGTGQRDGLGKAMFYVPIPAQPPSGNPGPVGGGHNFSTDAAAEPYHGPGTYTGSGLSATQMDADTPPGSQETHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGGALISGRVVWTCS*
Ga0182030_1013833123300014838BogMVVLLASGTVPAQGTPKLAVLHATVTITGGLTFTGSYDARLRVRTCADAARGGTGETDGTGGAMFYVPIPPQNPGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGQGISATELEADTRPDDQETHIFAFPTGIGTLIVNPDASGSFEFNGLEDPGSVHISGRVVWTCS*
Ga0182030_1063137613300014838BogVEAQGTPDTNSPQMAVLHATVTITGGLAFTGSYDNRLSVRTCADVARGGTCESGGTGGAAFDVPIPPPDPGGNPGSVGGGHTFSTDAAAWPYHGPGTYTGSGLTATQMDVDTPPGSQDTHIFAFPTGVGTLIVKPDASGSFQFNGLQDPGSVTISGQVIWTCS*
Ga0182030_1071596023300014838BogMGRHRPTLNEEADLNLTILRKVLTDGASAALAMLLGTATVPALIAQPRTVVLHATVTVSGGVTFTGSYDTRLLGQSCADIAKGGTNPPSGPNRASFYVPIPPPGPGGSYGSVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPNSEDIHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSVKISGQVVWTCSN*
Ga0181513_137259013300016700PeatlandAVLHATVSISGGVSFSGSYDVRLNVRTCADVARSGTGQTDGVGHAMFYVPIPPQDPGGNPGSVGAGHNFSTDAAAGPYHGPGTYTGSGLTATQLDADTPPGSQDTHIFAFPANIGTMIVKPDASGSFQFAGLQDPGSVIISGQVTWTCS
Ga0187877_102554843300017931PeatlandMDLAIVRTVLMGGISPVVVALLMCATVSPLGVPNANLPKMAVLHATITITGGLTLTGTYDDRLTLATCADVAKSGTSADGRGVRMFYVPIPPLNPDGNPGPVGGGHTFSTDAAASPYHGPGTYTGSGLNATQMDVDTPPGSQDTHIFAFPAIVGTLIVKPDASGSFQFDGLQDPGSVTISGQVTWTCS
Ga0187879_1056899913300017946PeatlandTVSISGGVSFSGSYDVRLNVQTCAGVARGGTGQHDGLGKAMFYVPIPLESGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGSGLSATQMDADTPPGSEDTHIFAFPTGIGTMVINPDASGSFTFGPLQDPGGVLISGQVVWTCS
Ga0187879_1083069813300017946PeatlandAAAVPGQGTSQGNAPKLAVLHATVTITGGVHFTGTYDQRLPVQTCAAVARGGTGQRDGLGKPMFYVPIPAQPPSGDPGPVGGGHNFSTDAAAGPYHGPGTYTGSGLVATQMDADTPPGSEDTHIFAFPTNVGTLIVKPDASGSFQFEGLQDPGSVTISGQVTWTCS
Ga0187847_1002846323300017948PeatlandMDLAIVRTVLMGGISPVVVALLMCATVSPLGVPNANLPKMAVLHATITITGGLTLTGTYDDRLTLATCADVAKSGTSADGRGVRMFYVPIPPLNPDGNPGPVGGGHTFSTDAAASPYHGPGTYTGSGLNATQMDVDTPPGSQDTHIFAFPAIVGTLIVKPDASGSFQFDGL
Ga0187847_1005786523300017948PeatlandMNLANPRKVGPVAALAAAVVLIVFATAWAMGAPDNSQPKTAVLHATVSISGGVSFSGSYDVRLNVQTCAGVARGGTGQHDGLGKAMFYVPIPLESGVNPGPVGGGHTFSTDAAAGPYHGPGTYTGSGLSATQMDADTPPGSEDTHIFAFPTGIGTMVINPDASGSFTFGPLQDPGGVLISGQVVWTCS
Ga0187782_1029498723300017975Tropical PeatlandMEIAVRGKRVIGGAGMVAGAALLWAMLPAPPNVEAARPAVLHGTVSISGGLTFTGSFDDRLNVATCADAAKTGTGKDGLGKPMFLVPSPAQTPDGNPGPVGGGHTFETDAAAEPYHGPGTYTGTGITATQLEADMPPGSQDKGIFAFPTGIGTLTINPDASGSFQFQGLQDPGSVTISGQVTWTCS
Ga0181520_1001176393300017988BogMMAQTEGSDCRGGINPSREEEAEVDLAIVRKVLTVGAAAALVLLVSAVVPAQGTLGTSSPGTAVLHATVTITGGLSFTGSYDDRLSVRTCADVAKSGTGQTGGTGGAMFYVPIPPQDPGGNPGSVGAGHNFSTDAAAGPYHGPGTYTGSGLTATQLDADTPPGSQDTHIFAFPANIGTMIVKPDASGSFQFAGLQDPGSVIISGQVTWTCS
Ga0181520_1004814423300017988BogMDLAILRKVGPAAVSAAAVVLVVFATAGAMGAPDNNQPKTAVLHATVSISGGVSFSGSYDVRLNVRTCADVAKSGTGQTDGVGHAMFYVPIPMQPPSGDPGPVGGGHNFSTDAAAEPYHGPGTYTGAALSATQMDADTPPGSQDTHIFAFPTGIGTMVVNPDASGSFTFGPLQDPGGVLISGKVVWTCS
Ga0181520_1007286843300017988BogMMPRQRKGLPGTGRASWQEEADVDLAIPRKVRPGAAWAAAMVLLVAAAVPGQGTSQGNAPKLAVLHATVTITGGVHFTGTYDQRLPVQTCAAVARGGTGQRDGLGKAMFYVPIPAQPPSGNPGPVGGGHNFSTDAAAEPYHGSGTYTGSGLSATQMDADTPPGSQETHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGGVLISGRVVWTCS
Ga0181520_1010462823300017988BogMNLANPRKVGPVAALAAAVVLIVFATAWAMGAPDNSQPKTAVLHATVSISGGVSFSGSYDVRLNVQTCAGVARGGTGQHDGLGKAMFYVPIPLESGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGSGLSATQMDADTPPGSEDTHIFAFPTGIGTMVINPDASGSFTFGPLQDPGGVLISGQVVWTCS
Ga0181520_1024911113300017988BogMAWVFAKKVLKVWTSIAGGALLAPAILAAQQSAVLHATVTISGGITFTGSFDQRLPVRTCADAAKSGTMAPGSGGVAMFAVPIPSPNPGGNPGSVSGGHTFATDVAAAPYHGPGTYTGTRLNATELEVDTKPDDQETHIFAFPTEIGTLIIKSDASGSFQFNNLQDPRDVRISGQVVWTC
Ga0181520_1025423823300017988BogMIRAIQRRTSPARASTAVGFLLLSASVPATGTPNMNAPTNPPQTAVLHATVTITGGLSFTGSYDDRLPIRACADVAKGGTSLPGSSGVAMFNVPVPPFKPDGSAGPVSGGHTFSTDAAASPYHGPGTYTGSGLSATQLDADTLPGDQETHIFAFPTGIGVMIVNVDASGSFQFSGLEDPGSVKISGQVVWTCS
Ga0187891_103409123300017996PeatlandVDLAFVRKVLAGGAGTVVVVLLVWATVQAQVTPNTNSPKMAILHATVTITGGLAFTGSYDDRLSVRTCADVARDGTGESGGTGGAAFDVPIPPPDPGGNPGPVGGGHTFSTDVAAWPYHGPGTYTGSGLTATQMDVDTPPGSQDTHIFAFPTGVGTLIVKPDASGSFQFTGLQDPGSVTISGQVIWTCS
Ga0187884_1047096913300018009PeatlandRQEEADVDLAIPRKVRPGAAWAAAMVLLVAAAVPGQGTSQGNAPKLAVLHATVTITGGVSFSGSYDQRLSVQTCAAVARGGAGQRDGLGKAMFYVPIPAQTPGGDPGPVGGGHNFSTDAAAGPYHGPGTYTGSGLSATQMDADTPPGSEDTHIFAFPTGIGTMVINP
Ga0187810_1038501813300018012Freshwater SedimentRSGAQGDGETGGCGVGLPVTARPVWARISRQGEADVDLAIVRKVMAGGASIAAVVLLMWATVQAQETPDTNAPKTAVLHATVTITGGLTFAGTYDDRLPVQTCADVAKGGTGQSGGTGGAMLYVPIPPPDPGGNPGSVGGGHTFSTDVAAWPYHGPDTYTGSGLTATQMDVDTPPGSQDTHIFAFPTGVGTLIVKP
Ga0187873_103100343300018013PeatlandMDLAIVRTVLMGGISPVVVALLMCATVSPLGVPNANLPKMAVLHATITITGGLTLTGTYDDRLTLATCADVAKSGTSADGRGVRMFYVPIPPLNPDGNPGPVGGGHTFSTDAAASPYHGPGTYTGSGLNATQMDVDTPPGSQDTHIFASPAIVGTLIVKPDASGSFQFDGLQDPGSVTISGQVTWTCS
Ga0187864_1016144413300018022PeatlandMDLAIVRTVLMGGISPVVVALLMCATVSPLGVPNANLPKMAVLHATITITGGLTLTGTYDDRLTLATCADDAKSGTSADGRGVRMFYVPIPPLNPDGNPGPVGGGHTFSTDAAASPYHGPGTYTGSGLNATQMDVDTPPGSQDTHIFAFPAIVGTLIVKPDASGSFQFDGLQDPGSVTISGQVTWTCS
Ga0187869_1053599523300018030PeatlandALHATVTITGGVSFSGSYDQRLSVQTCAAVAKSGTGQTDGLGHRMFYVPIPAQPPSGDPGPVGGGHNFSTDAAAGPYHGPGTYTGSGLVATQMDADTPPGSEDTHIFAFPTNIGTMTVNPDASGSFTFGPLQDPGGVLISGQVVWTCS
Ga0187867_1015004323300018033PeatlandMDLAIVRKVLTGGASAAAAALLVSAAVPGQLTPNANSPKMAVLHATVTITGGLAFTGSYDDRLSVRTCADVARRGTGETGGTGGAMFYVPIPQPDPGGNPGQVGGGHTFSTDVAAGPYHGPGTYTGSALNATQMDVDTPPGSEDIHIFAFPTSVGTMIVKPDASGSFQFSGLQDPGSVTISGEVVWTCS
Ga0187867_1015881623300018033PeatlandMDLAFVRRMLTTGTLSAVLLLLMPATVPAQGPPGTNAPMTAVLHATIKITGGLSFTGSYDDRQTAATCADLAKSGTGTPGVSEVQTFYVPVPPLNPDGSPGPVGGGHTFATDVAAWPYSGPSTYTGPGLNATQMDVDTLPGDEKTHIFAFPTGVGTLIVRPDASGSFQFEGLQDPGGVTISGQLTWTCS
Ga0187863_1005901813300018034PeatlandMNLANPRKVGPVAALAAAVVLIVFATAGAMGAPDNNQAKTAVLHATVSISGGVSFSGSYDVRLNVQTCAGVARGGTGQHDGLGKAMFYVPIPLESGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGSGLSATQMDADTPPGSEDTHIFAFPTGIGTMVINPDASGSFTFGPLQDPGGVLISGQVVWTCS
Ga0187863_1023588913300018034PeatlandMPRQRKGLPETARPSRQEEADVDLAIPRKVRPGAAWAAAMVLLVAAVPGQGTSQGNAPKLAVLHATVTITGGVHFTGTYDQRLPVQTCAAVARGGTGQRDGLGKPMFYVPIPAQPPSGDPGPVGGGHNFSTDAAAEPYHGPGTYTGSGLSATQMDADTPPGSQDTHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGSVMISGRVVWTCS
Ga0187855_1027617113300018038PeatlandMPRQRKGLPGTAGPSRQEEADVDLAIPRKVRPGAAWAAAVVLLVAAAVPGQGTSQGNAPKLAVLHATVTITGGVHFTGTYDQRLPVQTCAAVARGGTGQRDGLGKPMFYVPIPAQPPSGDPGPVGGGHNFSTDAAAEPYHGPGTYTGSGLVATQMDADTPPGSQETHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGSVMISGRVVWTCS
Ga0187862_1070033323300018040PeatlandVPGQGTSQGNAPKLAVLHATVTITGGVSFSGSYDQRLSVQTCAAVAKSGTGQTDGLGHRMFYVPIPAQPPSGDPGPVGGGHNFSTDAAAEPYHGQGTYTGSGLSATQMDADTPPGSQDTHIFAFPANIGTLIVNPDASGSFTFGPLQDTGSVMISGRVVWTCS
Ga0187887_1018861613300018043PeatlandMDLAIPRKVRPGAAWAAAVVLLVAAAVPGEGTSQGNAPKLAVLHATVTITGGVRFTGTYDQRLPVQTCAAVARGGTGQRDGLGHAMFYVPIPAQPPSGDPGPVGGGHNFSTDAAAGPYHGPGTYTGSGLVATQMDADTPPGSQETHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGSVLISGRVVWTCS
Ga0187890_1080461813300018044PeatlandTLSAVLVLLMPATAPAQGTPGANAPATAVLHATITITGGLSFTGSYDDRQTAATCADLAKNGTGTPGVSEVQTFYVPAPPLNPDGSPGSVGSGHNFATDVAAWPYNGPGTYTGSALNATQMDVDTLPGDQETHIFAFPTGVGTLVVNPDASGSFQFQGLQDPGSVTISGQVTWTCS
Ga0187851_1002966533300018046PeatlandMDLVLVRRGLTGGALVLMVVLLASGTVPAQGTPKLAVLHATVTITGGLTFTGSYDARLRLRTCADAARGGTGETDGTGGAMFYVPIPPQNPGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGQGISATELEADTRPDDQETHIFAFPTGIGTLIVNPDASGSFEFNGLEDPGSVHISGRVVWTCS
Ga0187851_1041776713300018046PeatlandMDLAIPRKVRPGAAWAAAVVLLVAAAVPGEGTSQGNAPKLAVLHATVTITGGVRFTGTYDQRLPVQTCAAVARGGTGQRDGLGHAMFYVPIPAQPPSGDPGPVGGGHNFSTDAAAGPYHGPGTYTGSGLSATQMDADTPPGSQETHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGSVMISGRVVWTCS
Ga0187859_1045470113300018047PeatlandITGGLAFTGSYDDRLSVRTCADVARRGTGETGGTGGAMFYVPIPQPDPGGNPGQVGGGHTFSTDVAAGPYHGPGTYTGSALNATQMDVDTPPGSEDIHIFAFPTSVGTMIVKPDASGSFQFSGLQDPGSVTISGEVVWTCS
Ga0187859_1059865713300018047PeatlandDLAIPSKVRPGAAWAAAMVLLVAAVPGQGTSQGNAPKLAVLHATVTITGGVHFTGTYDQRLPVQTCAAVAKSGTGQTDGLGHRMFYVPIPAQPPSGDPGPVGGGHNFSTDAAAEPYHGPGTYTGSGLSATQMDADTPPGSQETHIFAFPTNIGTLIVNPDASGSFTFGPLQDPGSVMISGRVVWTCS
Ga0224554_101655533300023068SoilVKLATVLKGGASAATVVLLVWATVEAQGTPDTNSPQMAVLHATVTITGGLAFTGSYDNRLSVRTCADVARGGTCESGGTGGAAFDVPIPPPDPGGNPGSVGGGHTFSTDAAAWPYHGPGTYTGSGLTATQMDVDTPPGSQDTHIFAFPTGVGTLIVKPDASGSFQFNGLQDPGSVTISGQVIWTCS
Ga0224556_108044213300024295SoilLSEVILQSCPERVGVYVKLATVLKGGASAATVVLLVWATVEAQGTPDTNSPQMAVLHATVTITGGLAFTGSYDNRLSVRTCADVARGGTCESGGTGGAAFDVPIPPPDPGGNPGSVGGGHTFSTDAAAWPYHGPGTYTGSGLTATQMDVDTPPGSQDTHIFAFPTGVG
Ga0208039_105266513300025454PeatlandDRLTLATCADVAKSGTSADGRGVRMFYVPIPPLNPDGNPGPVGGGHTFSTDAAASPYHGPGTYTGSGLNATQMDVDTPPGSQDTHIFAFPAIVGTLIVKPDASGSFQFDGLQDPGSVTISGQVTWTCS
Ga0208192_108936913300025477PeatlandDDRLTLATCADVAKSGTSADGRGVRMFYVPIPPLNPDGNPGPVGGGHTFSTDAAASPYHGPGTYTGSGLNATQMDVDTPPGSQDTHIFAFPAIVGTLIVKPDASGSFQFDGLQDPGSVTISGQVTWTCS
Ga0208691_100657213300025612PeatlandIVFATAWAMGAPDNSQPKTAVLHATVSISGGVSFSGSYDVRLNVQTCAGVARGGTGQHDGLGKAMFYVPIPLESGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGSGLSATQMDADTPPGSEDTHIFAFPTGIGTMVINPDASGSFTFGPLQDPGGVLISGQVVWTCS
Ga0208043_109061613300027570Peatlands SoilVDLAKILAGAASAAVVILFLPATVPARGTQDTNVPKMAVLHATITITGGLTFTGAYDDRLTVGTCADIAKGGTHGPDSDGDAMFYVPVPLDNTGGDGGPVGGGHTFTTDVAASPYHGPGTYTGSGLTATQMDVDTPPGSQDTHIFAFPTSVGTMIVNPDASGSFKFEGLQDPGSVTISGQVSWTCS
Ga0208565_102631113300027662Peatlands SoilVDLAKILAGAASAAVVILFLPATVPARGTQDTNVPKMAVLHATITITGGLTFTGAYDDRLTVGTCADIAKGGTHGPDSDGDAMFYVPVPLDNTGGDGGPVGGGHTFTTDVAASPYHGPGTYTGSGLTATQMDVDTPPGSQDTHIFAFPTSVGTMIVNPDASGSFKFEG
Ga0209169_1007453823300027879SoilMVVALLVSATMPAQLTPNTNLPKAAVLHATVTITGGLAFTGTYDDRLVVPTCADVAKSGTRPPGGAGGAAFSVPEPPNNTSGNGGPVGGGHTFSSDVAASPYHGPGTYTGSALTATQMDADTPPNSQETHIFAFPTGVGTLIVNPDASGSFQFNGLQDPGSVTISGKVTWTCS
Ga0302145_1015556013300028565BogPRTVVLHATVTVSGGVTFTGSYDTRLLGQSCANIAKGGTNPPSGPNRASFYVPIPPPGPGGSYGSVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPNSEDIHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSVKISGQVVWTCSN
Ga0302156_1002901243300028748BogMGRHRPTLNEEADLNLTILRKVLTDGASAALAMLLGTATVPALIAQPRTVVLHATVTVSGGVTFTGSYDTRLLGQSCADIAKGGTNPPSGPNRASFYVPIPPPGPGGSYGSVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPNSEDIHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSVKISGQVVWTCSN
Ga0302156_1003800453300028748BogMDLVLVRRGLTGGALVLMVVLLASGTVPAQGTPKLAVLHATVTITGGLTFTGSYDARLRVRTCADAARGGTGETDGTGGAMFYVPIPPQNPGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGQGISATELEADTRPDDQETHIFAFPTGIGTLIVNPDASGSFEFNGLEDPGSVHISGRVVWTCS
Ga0302202_1020553413300028762BogMGRHRPTLNEEADLNLTILRKVLTDGASAALAMLLGTATVPALIAQPRTVVLHATVTVSGGVTFTGSYDTRLLGQSCADIAKGGTNPPSGPNRASFYVPIPPPGPGGSYGSVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPNSEDIHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSVKISGQ
Ga0302225_1019845113300028780PalsaMDLAIVRKVLMGGASKVIVVLLASAIIPGQLTPNANSQKTAVLHATVTITGGVAFTGSYDQRLAIPTCADVAKGGTNPPSGPNKASFYVPIPMPPAGASYGPVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPDSQETHIFAFPTGIGTMIVKPDASGSFQFNGLQDPGSVRISGTVVWTCS
Ga0302232_1037425613300028789PalsaMDLAIVRKVLMGGASKVIVVLLASAIIPGQLTPNANSQKTAVLHATVTITGGVAFTGSYDQRLAIPTCADVAKGGTNPPSGPNKASFYVPIPMPPAGASYGPVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPDSQETHIFAFPTGIGTMI
Ga0302278_1018150913300028866BogMGRHRPTLNEEADLNLTILRKVLTDGASAALAMLLGTATVPALIAQPRTVVLHATVTVSGGVTFTGSYDTRLLGQSCADIAKGGTNPPSGPNRASFYVPIPPPGPGGSYGSVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPNSEDIHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSV
Ga0311359_1004058773300029914BogMVVLLASGTVPAQGTPKLAVLHATVTITGGLTFTGSYDARLRVRTCADAARGGTGETDGTGGAMFYVPIPPQNPGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGQGISATELEADTRPDDQETHIFAFPTGIGTLIVNPDASGSFEFNGLEDPGSVHISGRVVWTCS
Ga0311359_1075056323300029914BogTVTVSGGVTFTGSYDTRLLGQSCADIAKGGTNPPSGPNRASFYVPIPPPGPGGSYGSVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPNSEDIHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSVKISGQVVWTCSN
Ga0311358_1079323813300029915BogSGGVTFTGSYDTLLLGQSCADIAKGGTNPPSGPNRASFYVPIPPPGPGGSYGSVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPNSEDIHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSVKISGQVVWTCSN
Ga0311330_1005070313300029945BogYEETEGSSRKHAILEATQMGRHRPTLNEEADLNLTILRKVLTDGASAALAMLLGTATVPALIAQPRTVVLHATVTVSGGVTFTGSYDTRLLGQSCADIAKGGTNPPSGPNRASFYVPIPPPGPGGSYGSVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPNSEDIHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSVKISGQVVWTCSN
Ga0311371_1188063813300029951PalsaMDLAIVRKVWTGAASTVVVVSLLSAATAKGTSTTDFQKTAVLHATVTVTGGLSFTGSYDDRLPVSTCADVAKSGTSLPGRSGGGPTFAVPIPPNSPGGNPGPVGGGHTFSTDVAAWRYHGPGTYTASDLSATQMDADTRPNDQETHIFAFPTNVGTLIVKPDASGSFQFNGLQDPGSVKISGQVTW
Ga0302283_129636613300029994FenLVRRGLTGGALVLMVVLLASGTVPAQGTPKLAVLHATVTITGGLTFTGSYDARLRVRTCADAARGGTGETDGTGGAMFYVPIPPQNPGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGQGISATELEADTRPDDQETHIFAFPTGIGTLIVNPDASGSFEFNGLEDPGSVHISGRVVWTCS
Ga0311339_1128931413300029999PalsaLHATVTVTGGLSFTGSYDDRLPVSTCADVAKSGTSLPGRSGGGPTFAVPIPPNSPGGNPGPVGGGHTFSTDVAAWRYHGPGTYTASDLSATQMDADTRPNDQETHIFAFPTNVGTLIVKPDASGSFQFNGLQDPGSVKISGQVTWTCS
Ga0302274_1016813223300030041BogVLTDGASAALAMLLGTATVPALIAQPRTVVLHATVTVSGGVTFTGSYDTRLLGQSCADIAKGGTNPPSGPNRASFYVPIPPPGPGGSYGSVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPNSEDIHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSVKISGQVVWTCSN
Ga0311353_1170699213300030399PalsaRKILKAGALILIVLLLVVVPMRPQPNFSSAKTVVLHATVTITGGVSFTGSYDERLVAPSCADLAKSGTNPPKGPNRASFNVPIPAPPTGNSYGPVGGGHTFSTDVSAYPYTGPGTYTGSTLTATQLDADTPPDSQDTHIFAFPTGVGTMIVKPDASGSFQFDGLQDPG
Ga0302311_1074424513300030739PalsaMDLAIVRKVLMGGASKVIVVLLASAIIPGQLTPNANSQKTAVLHATVTITGGVAFTGSYDQRLAIPTCADVAKGGTNPPSGPNKASFYVPIPMPPAGASYGPVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPDSQETHIFAFPTGIGTMIVKPDASGSFQFNGLQDPGSVRI
Ga0265461_1003894123300030743SoilVDHAIPRKVLTGLALTGFMVMLLPAKAQAQGTHNPNMPKTVVLHATVTITGGVTFTGTYDQRLAISTCAEVAKNGTNPPSGPNHAAFYLPQTPNNTSGNGGPVGGGHTFSTDAAAYPYHGPGTYTGSALTATQLDADTPPDSQETHIFAFPTAIGTMIVNPDASGSFQFKGLQDPGSVTISGQVTWTCSEK
Ga0302325_10000124483300031234PalsaMHVATVGKVLTGAASTVAVVLLVSAIVPAQGPVKADLANLPKMAVLHATVTISGGLAFTGTYDDRLGVSTCAGVAKGGTNAPGNSGGATFAVPIPPYEAGGNPGPVGGGHTFSTDVAAWPYRGPGTYTGSGLTATQMDVDTVPGDQETHVFAFPTGVGTLIVKPDASGSFQFNGLQDPGSVKISGQVIWTCS
Ga0302325_1098217613300031234PalsaMDLAIVRKVWTGAASTVVVVSLLSAATAKGTSTTDFQKTAVLHATVTVTGGLSFTGSYDDRLMVSTCADVAKSGTSLPGRSGGGPTFAVPIPPNSPGGNPGPVGGGHTFSTDVAAWRYHGPGTYTASDLSATQMDADTRPNDQETHIFAFPTNVGTLIVKPDASGSFQFNGLQDPGSVKISGQVTWTCS
Ga0302325_1300051513300031234PalsaFRIEERGTARPVAAMEEDVDLAILRKGLMGGASKAALVLLVSATLPAQLTPSPGLPKMAVLHATVTITGGVAFTGTYDQRLTIPTCADVAKGGTNPPSGLNKASFDVPEPPNNTSGNGGPVGGGHTFSSDVAAYPYTGPGTYTGSSLSATQMDADTPPNSQETHIFAFPTGIGTLIVKPD
Ga0302324_10010185343300031236PalsaMAVLHATVTITGGLAFTGSYDDHVAFRTCADLAKGGTTPPTGLNKALFRVPEPPNNKTGLGGPVGGGHTFSSDVAAYPYHGPDTYTGAALSATQMDVDTPPDSQDTHIFAFPTGIGTLIVRPDASGSFQFNGLQDPGSVKISGQVTWTCS
Ga0302324_10195671513300031236PalsaSFTGSYDDRLMVSTCADVAKSGTSLPGRSGGGPTFAVPIPPNSPGGNPGPVGGGHTFSTDVAAWRYHGPGTYTASDLSATQMDADTRPNDQETHIFAFPTNVGTLIVKPDASGSFQFNGLQDPGSVKISGQVTWTCS
Ga0302318_1018488123300031258BogPKLAVLHATVTITGGLTFTGSYDARLRVRTCADAARGGTGETDGTGGAMFYVPIPPQNPGGNPGPVGGGHTFSTDAAAGPYHGPGTYTGQGISATELEADTRPDDQETHIFAFPTGIGTLIVNPDASGSFEFNGLEDPGSVHISGRVVWTCS
Ga0302187_1007997513300031259BogIHIQVVSAASHEETEGSSRKHAILEATQMGRHRPTLNEEADLNLTILRKVLTDGASAALAMLLGTATVPALIAQPRTVVLHATVTVSGGVTFTGSYDTRLLGQSCADIAKGGTNPPSGPNRASFYVPIPPPGPGGSYGSVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPNSEDIHIFAFPTGIGTMIVNPDASGSFQFNGLQDPGSVKISGQVVWTCSN
Ga0310686_10922261623300031708SoilVDFASVRKILTAGALIVVVLLLVVAPMRAQPNFGSPKMVVLHATFTITGGVSFTGSYDERLVALSCADLAKDGTNPPKGPNRASFYVPIPPPPAGSSYGLVGGGHTFSTDVAAYPYHGPGTYTGSDLSATQLDADTPPDSQETHIFAFPTGVGTLIVKPDASGSFQFNGLQDPGSVKISGQVVWTCS
Ga0310686_11116138423300031708SoilMDLAVARKMLTVGTLFAGLALLMPAIVSAQGTTGTNSPKTAVLHATITITGGLSFTGSYDDRQTVATCADLAKSGTGTPGVQEVETFYVPVPPLNPDGSPGPVSVGHTFATDVAAWPYNGPGTYTGPGLNATQMDVDTLPGDQETHIFAFPTGVGTLIVKPDASGSFQFTGLQDPGSVTISGQVTWTCS
Ga0310686_11342302813300031708SoilAILRKVGTGVALIGFVVMLLSAKVQAQGAHNPNMPKTAVLHTTVTITGGVTFTGTYDQRLAISTCADVAKNGTNPPNGQNHASFYVPQTPNNTSGNGGPVGGGHTFSTDAAAYPYHGPGTYTGSGLTATQLDADTPPDSQDTHIFAFPTGIGTLIVNPDASGSFQFNGLQDPGSVK
Ga0310686_11384801723300031708SoilMVVALLVSATMPAQLTPNTNLPKAAVLHATVTITGGLAFTGTYDDRLVVPTCADVAKSGTRPPGGAGGAAFSVPEPPNNTSGNGGPVGGGHTFSSDVAASPYHGPGTYTGSALTATQMDADTPPNSQETHIFAFPTGAGTLIVNPDASGSFQFNGLQDPGSVTISGKVTWTCS
Ga0348332_1033527213300032515Plant LitterVNHAILRKVGTGVALIGFVVMLLSAKVQAQGAHNPNMPKTAVLHTTVTITGGVTFTGTYDQRLAISTCAEVAKNGTNPPNGPNHTSFYVPQTPNNTSGNGGPVGGGHTFSTDAAAYPYHGAGTYTGSTLTATQLDADTPPDSQDTHIFAFPTAIGTLIVNPDASGSFQFNGLQDPGSVKISGQ
Ga0326728_10003774133300033402Peat SoilMDLAIVRKALTSGASAVAVFLLMSAAVPGQLTPNANSPKMAVLHATVTITGGLAFTGSYDDRLSVRTCADVARGGTGETGGTGGAMFYVPIPPQDPGGNPGSVGSGHTFSTDAAAGPYHGPGTYTGSALIATQMDVDTPPGSQDTHIFAFPTSVGTMIVKPDASGSFQFTGLQDPGSVTISGEVVWTCS
Ga0326728_1003146873300033402Peat SoilMDLAFVWRMLTAGTLSAVLLLLMPATVPAQGTPGTNAPKTAVLHATIKINGGLSFTGSYDDRQTVATCADLAKSGTGTPGVSEVQTFYVPVPPLNPDGSSGPVGGGHTFATDVAAWPYNGPGTYTGPGLNATQMDVDTLPGDQETHIFVFPTGVGTLIVRPDASGSFQFEGLQDPGGVTISGQVTWTCS
Ga0326728_1004486533300033402Peat SoilVDLAIVRKVLTGAASAVVVVLLVSATVPALGTPDTNLPKMAVLHATVTITGGLAFTGSFDDRLPVRTCADVAKGGTGVPGSYGGPTFNVPVPPPNPGGNPGSVGGGHTFSTDVAAWPYHGPGTYTGSGLTATQMDVDTRPDDQETHIFAFPTGVGTLIVNPDASGSFQFNGLQDPGSVRISGQVIWTCS
Ga0326728_1007652623300033402Peat SoilMPRQRKGLPGAARPSWQEEADVDLAIRRKVGPAATSAVAVVLLVAAAVPGQGTSQGNAPKLAVLHATVTITGGVRFTGTYDQRLPVQTCAAVARGGTGQHDGLGKAMFYVPIPAQTPSGDPGPVGGGHNFSTDAAAGPYHGPGTYTGSGLVATQMDADTPPGSQDTHIFAFPANIGTLIVNPDASGSFTFGPLQDPGSVLISGRVVWTCS
Ga0326727_1041354623300033405Peat SoilGLPGAARPSWQEEADVDLAIRRKVGPAAASAVAVVLLVAAAVPGQGTSQGNAPKLAVLHATVTITGGVNFTGTYDQRLPVQTCAAVARGGTGQHDGLGKAMFYVPIPAQTPSGDPGPVGGGHNFSTDAAAGPYHGPGTYTGSGLSATQMDADTPPGSQDTHIFAFPTNIGTLTVNPDASGSFTFGPLQDPGSILISGRVVWTCS
Ga0371489_0165958_489_10103300033755Peat SoilVAVVLLVAAAVPGQGTSQGNAPKLAVLHATVTITGGVRFTGTYDQRLPVQTCAAVARGGTGQHDGLGKAMFYVPIPAQTPSGDPGPVGGGHNFSTDAAAGPYHGPGTYTGSGLVATQMDADTPPGSQDTHIFAFPANIGTLIVNPDASGSFTFGPLQDPGSVLISGRVVWTCS
Ga0371488_0072438_1051_15723300033983Peat SoilVAVVLLVAAAVPGQGTSQGNAPKLAVLHATVTITGGVRFTGTYDQRLPVQTCAAVARGGTGQRDGLGKAMFYVPIPAQTPSGDPGPVGGGHNFSTDAAAGPYHGPGTYTGSGLVATQMDADTPPGSQDTHIFAFPTNIGTLTVNPDASGSFTFGPLQDPGSILISGRVVWTCS
Ga0326724_0636851_2_4483300034091Peat SoilVAVVLLVAAAVPGQGTSQGNAPKLAVLHATVTITGGVRFTGTYDQRLPVQTCAAVARGGTGQHDGLGKAMFYVPIPAQTPSGDPGPVGGGHNFSTDAAAGPYHGPGTYTGSGLVATQMDADTPPGSQDTHIFAFPANIGTLIVNPDASG
Ga0370483_0039195_203_6643300034124Untreated Peat SoilMQKMAVLHATVTIAGGLSFTGSYDDRLPVPTCADVAKGGTNPPGRYGGPTFNVPIPPNAPGGNPGSVGGGHTFSTDVAASPYHGPGTYTGSNLTATQMDADTRPDDQETHIFAFPTGIGTMIVKPDASGSFQFNGLQDPGSVKISGQVVWTCS
Ga0370515_0076598_447_10613300034163Untreated Peat SoilMKEGWLSPSRQGEADMDLAIVRKVLMGGASKVIVVLLASAIIPGQLTPNANSQKTAVLHATVTITGGVAFTGSYDQRLAIPTCADVAKGGTNPPSGPNKASFYVPIPMPPAGASYGPVGGGHTFSTDVTAYPYHGPGTYTGSSLTATQMDADTPPDSQETHIFAFPTGIGTMIVKPDASGSFQFNGLQDPGSVRISGTVVWTCS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.