NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070593

Metagenome / Metatranscriptome Family F070593

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070593
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 45 residues
Representative Sequence MEMAGLWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKPKKKP
Number of Associated Samples 102
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.99 %
% of genes near scaffold ends (potentially truncated) 18.70 %
% of genes from short scaffolds (< 2000 bps) 60.98 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds
(7.317 % of family members)
Environment Ontology (ENVO) Unclassified
(18.699 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(19.512 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 37.14%    β-sheet: 0.00%    Coil/Unstructured: 62.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF030614HBT 40.65
PF14317YcxB 13.01
PF09670Cas_Cas02710 6.50
PF10263SprT-like 1.63
PF13408Zn_ribbon_recom 0.81
PF0563523S_rRNA_IVP 0.81
PF01035DNA_binding_1 0.81
PF13580SIS_2 0.81
PF03457HA 0.81
PF02801Ketoacyl-synt_C 0.81
PF13624SurA_N_3 0.81
PF13701DDE_Tnp_1_4 0.81
PF10947DUF2628 0.81
PF07110EthD 0.81
PF01957NfeD 0.81
PF06769YoeB_toxin 0.81
PF08241Methyltransf_11 0.81
PF02643DUF192 0.81
PF00202Aminotran_3 0.81
PF01206TusA 0.81
PF13419HAD_2 0.81
PF09195Endonuc-BglII 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 0.81
COG0425Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.81
COG1430Uncharacterized conserved membrane protein, UPF0127 familyFunction unknown [S] 0.81
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 0.81
COG4115Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB familyDefense mechanisms [V] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1286644All Organisms → cellular organisms → Bacteria3603Open in IMG/M
3300000891|JGI10214J12806_10839398All Organisms → cellular organisms → Bacteria → Nitrospirae1183Open in IMG/M
3300000956|JGI10216J12902_105769493All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300003310|D1draft_1000067All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii207666Open in IMG/M
3300003859|Ga0031653_10039594All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.1297Open in IMG/M
3300003861|Ga0031654_10001083All Organisms → cellular organisms → Bacteria7696Open in IMG/M
3300003861|Ga0031654_10034306All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae1447Open in IMG/M
3300004052|Ga0055490_10000587All Organisms → cellular organisms → Bacteria5024Open in IMG/M
3300004145|Ga0055489_10055368All Organisms → cellular organisms → Bacteria → Nitrospirae1071Open in IMG/M
3300004282|Ga0066599_100119867All Organisms → cellular organisms → Bacteria → Nitrospirae1288Open in IMG/M
3300004463|Ga0063356_100024945All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii5668Open in IMG/M
3300004643|Ga0062591_100001509All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii7090Open in IMG/M
3300004782|Ga0062382_10281346All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005205|Ga0068999_10059492All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300005330|Ga0070690_101301900All Organisms → cellular organisms → Bacteria → Nitrospirae582Open in IMG/M
3300005332|Ga0066388_100338653All Organisms → cellular organisms → Bacteria → Nitrospirae2150Open in IMG/M
3300005332|Ga0066388_102843897All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300005334|Ga0068869_101572495All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005341|Ga0070691_10858513All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005354|Ga0070675_102035365All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium529Open in IMG/M
3300005438|Ga0070701_10069921All Organisms → cellular organisms → Bacteria → Nitrospirae1874Open in IMG/M
3300005444|Ga0070694_100473272All Organisms → cellular organisms → Bacteria → Nitrospirae993Open in IMG/M
3300005444|Ga0070694_101447424All Organisms → cellular organisms → Bacteria → Nitrospirae581Open in IMG/M
3300005471|Ga0070698_100182667All Organisms → cellular organisms → Bacteria2035Open in IMG/M
3300005713|Ga0066905_100005545All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii5369Open in IMG/M
3300005829|Ga0074479_10331555All Organisms → cellular organisms → Bacteria → Nitrospirae5565Open in IMG/M
3300005830|Ga0074473_10176716All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005833|Ga0074472_10167151All Organisms → cellular organisms → Bacteria4639Open in IMG/M
3300005833|Ga0074472_10480745All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii5016Open in IMG/M
3300005833|Ga0074472_10576457All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii4316Open in IMG/M
3300005833|Ga0074472_10655421All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii4273Open in IMG/M
3300005833|Ga0074472_10788885All Organisms → cellular organisms → Bacteria → Nitrospirae1134Open in IMG/M
3300005833|Ga0074472_11318427All Organisms → cellular organisms → Bacteria → Nitrospirae802Open in IMG/M
3300005943|Ga0073926_10008750All Organisms → cellular organisms → Bacteria → Nitrospirae1783Open in IMG/M
3300005956|Ga0073920_1008583All Organisms → cellular organisms → Bacteria → Nitrospirae1287Open in IMG/M
3300005991|Ga0073923_1033927All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005992|Ga0073924_1016158All Organisms → cellular organisms → Bacteria → Nitrospirae1050Open in IMG/M
3300006041|Ga0075023_100009976All Organisms → cellular organisms → Bacteria2439Open in IMG/M
3300006041|Ga0075023_100023350All Organisms → cellular organisms → Bacteria1748Open in IMG/M
3300006041|Ga0075023_100088955All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300006041|Ga0075023_100162559All Organisms → cellular organisms → Bacteria → Nitrospirae832Open in IMG/M
3300006050|Ga0075028_100821018All Organisms → cellular organisms → Bacteria → Nitrospirae568Open in IMG/M
3300006057|Ga0075026_100024628All Organisms → cellular organisms → Bacteria2704Open in IMG/M
3300006163|Ga0070715_10714679All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300006853|Ga0075420_100054321All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii3561Open in IMG/M
3300006854|Ga0075425_100160457All Organisms → cellular organisms → Bacteria2579Open in IMG/M
3300007004|Ga0079218_10014520All Organisms → cellular organisms → Bacteria4052Open in IMG/M
3300007521|Ga0105044_10142434All Organisms → cellular organisms → Bacteria → Nitrospirae2558Open in IMG/M
3300009038|Ga0099829_10697093All Organisms → cellular organisms → Bacteria → Nitrospirae844Open in IMG/M
3300009078|Ga0105106_10029821All Organisms → cellular organisms → Bacteria4031Open in IMG/M
3300009084|Ga0105046_10363709All Organisms → cellular organisms → Bacteria → Nitrospirae1489Open in IMG/M
3300009091|Ga0102851_10043898All Organisms → cellular organisms → Bacteria3536Open in IMG/M
3300009100|Ga0075418_11360733All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300009777|Ga0105164_10005795All Organisms → cellular organisms → Bacteria7332Open in IMG/M
3300010047|Ga0126382_12417246All Organisms → cellular organisms → Bacteria → Nitrospirae510Open in IMG/M
3300010360|Ga0126372_10570022All Organisms → cellular organisms → Bacteria → Nitrospirae1079Open in IMG/M
3300010360|Ga0126372_12902096All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010391|Ga0136847_10242308All Organisms → cellular organisms → Bacteria4704Open in IMG/M
3300011406|Ga0137454_1072448All Organisms → cellular organisms → Bacteria → Nitrospirae579Open in IMG/M
3300011421|Ga0137462_1000109All Organisms → cellular organisms → Bacteria9946Open in IMG/M
3300012096|Ga0137389_10729496All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300012152|Ga0137347_1094740All Organisms → cellular organisms → Bacteria → Nitrospirae534Open in IMG/M
3300012212|Ga0150985_112494228All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.587Open in IMG/M
3300012226|Ga0137447_1007630All Organisms → cellular organisms → Bacteria → Nitrospirae1390Open in IMG/M
3300012226|Ga0137447_1104074All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.565Open in IMG/M
3300012668|Ga0157216_10053216All Organisms → cellular organisms → Bacteria → Nitrospirae2013Open in IMG/M
3300012931|Ga0153915_12143898All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012948|Ga0126375_10018775All Organisms → cellular organisms → Bacteria3170Open in IMG/M
3300012960|Ga0164301_11866146All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium507Open in IMG/M
3300015254|Ga0180089_1070399All Organisms → cellular organisms → Bacteria → Nitrospirae709Open in IMG/M
3300015360|Ga0163144_10060228All Organisms → cellular organisms → Bacteria6571Open in IMG/M
3300015360|Ga0163144_10962494All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.824Open in IMG/M
3300015374|Ga0132255_105066330All Organisms → cellular organisms → Bacteria → Nitrospirae558Open in IMG/M
3300017695|Ga0180121_10036281All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira1738Open in IMG/M
3300018028|Ga0184608_10037578All Organisms → cellular organisms → Bacteria1854Open in IMG/M
3300018071|Ga0184618_10480711All Organisms → cellular organisms → Bacteria → Nitrospirae521Open in IMG/M
3300018077|Ga0184633_10056050All Organisms → cellular organisms → Bacteria2009Open in IMG/M
3300018469|Ga0190270_10081903All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira2398Open in IMG/M
3300019360|Ga0187894_10000034All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira191794Open in IMG/M
3300019360|Ga0187894_10000814All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira42058Open in IMG/M
3300019377|Ga0190264_10003777All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira3797Open in IMG/M
3300019377|Ga0190264_10024311All Organisms → cellular organisms → Bacteria → Nitrospirae2097Open in IMG/M
3300019458|Ga0187892_10000018All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira328536Open in IMG/M
3300020057|Ga0163151_10002933All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira25356Open in IMG/M
3300020167|Ga0194035_1000032All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira85777Open in IMG/M
3300020596|Ga0163149_10150704All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300021272|Ga0213899_100592All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300021333|Ga0210324_1121985All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300022549|Ga0212091_10195944All Organisms → cellular organisms → Bacteria → Nitrospirae812Open in IMG/M
3300025905|Ga0207685_10533292All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300025926|Ga0207659_11732762All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium532Open in IMG/M
3300025959|Ga0210116_1056469All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300025971|Ga0210102_1028520All Organisms → cellular organisms → Bacteria → Nitrospirae1205Open in IMG/M
3300026902|Ga0209851_1029250All Organisms → cellular organisms → Bacteria → Nitrospirae548Open in IMG/M
3300027393|Ga0209867_1016423All Organisms → cellular organisms → Bacteria → Nitrospirae1049Open in IMG/M
3300027665|Ga0209983_1136890All Organisms → cellular organisms → Bacteria → Nitrospirae560Open in IMG/M
3300027731|Ga0209592_1115726All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300027846|Ga0209180_10213317All Organisms → cellular organisms → Bacteria → Nitrospirae1112Open in IMG/M
3300027850|Ga0209591_10719137All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300027886|Ga0209486_10736379All Organisms → cellular organisms → Bacteria → Nitrospirae639Open in IMG/M
3300027894|Ga0209068_10008850All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira4757Open in IMG/M
3300027900|Ga0209253_10162474All Organisms → cellular organisms → Bacteria → Nitrospirae1802Open in IMG/M
3300027900|Ga0209253_10407070All Organisms → cellular organisms → Bacteria → Nitrospirae1032Open in IMG/M
3300027902|Ga0209048_10014315All Organisms → cellular organisms → Bacteria → Nitrospirae7021Open in IMG/M
3300027902|Ga0209048_10029057All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira4703Open in IMG/M
3300027910|Ga0209583_10021742All Organisms → cellular organisms → Bacteria2040Open in IMG/M
3300027910|Ga0209583_10614527All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.555Open in IMG/M
3300027979|Ga0209705_10051079All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira2281Open in IMG/M
3300031455|Ga0307505_10060619All Organisms → cellular organisms → Bacteria → Nitrospirae1680Open in IMG/M
3300031538|Ga0310888_10028203All Organisms → cellular organisms → Bacteria → Nitrospirae2445Open in IMG/M
3300031547|Ga0310887_10276953All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300031562|Ga0310886_10016299All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae2869Open in IMG/M
3300031576|Ga0247727_10010954All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira15942Open in IMG/M
3300031576|Ga0247727_10596682All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300031854|Ga0310904_10901377All Organisms → cellular organisms → Bacteria → Nitrospirae625Open in IMG/M
3300032211|Ga0310896_10162372All Organisms → cellular organisms → Bacteria → Nitrospirae1069Open in IMG/M
3300032256|Ga0315271_10047076All Organisms → cellular organisms → Bacteria3103Open in IMG/M
3300032256|Ga0315271_10332412All Organisms → cellular organisms → Bacteria → Nitrospirae1258Open in IMG/M
3300032275|Ga0315270_10075574All Organisms → cellular organisms → Bacteria → Nitrospirae1932Open in IMG/M
3300032456|Ga0335394_10503369All Organisms → cellular organisms → Bacteria → Nitrospirae988Open in IMG/M
3300033433|Ga0326726_10024017All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira5300Open in IMG/M
3300033513|Ga0316628_103261003All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium590Open in IMG/M
3300034155|Ga0370498_006580All Organisms → cellular organisms → Bacteria → Nitrospirae2419Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds7.32%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)6.50%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment5.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.69%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.88%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand4.88%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.06%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat3.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater3.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.25%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.44%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.44%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.44%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.63%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks1.63%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm1.63%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.63%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.81%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.81%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.81%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.81%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater0.81%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.81%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.81%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.81%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.81%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.81%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.81%
Down-Flow Hanging Sponge ReactorEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003310Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - L1-648F-DHSEngineeredOpen in IMG/M
3300003859Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BREnvironmentalOpen in IMG/M
3300003861Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CREnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004145Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005205Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005943Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14EnvironmentalOpen in IMG/M
3300005956Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_23-Sept-14EnvironmentalOpen in IMG/M
3300005991Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_10-June-14EnvironmentalOpen in IMG/M
3300005992Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009084Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly)EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012152Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300020057Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2EnvironmentalOpen in IMG/M
3300020167Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20mEnvironmentalOpen in IMG/M
3300020596Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1EnvironmentalOpen in IMG/M
3300021272Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hamp_Shaw_2EnvironmentalOpen in IMG/M
3300021333Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022549Cold Creek_combined assemblyEnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025959Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025971Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026902Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027393Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027731Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027850Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032456Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly)EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_128664433300000881SoilMEVAGFWSWVIMAAWTIGLFVLAWWFYMPNPMTKDRKDKKKP*
JGI10214J12806_1083939823300000891SoilMEMAGLWSWVIMAGWTIVLGILAWWFYMPNPMAKDSKRPKKKP*
JGI10216J12902_10576949333300000956SoilMEMAGLWSWVIMAGWTIVIGILAWWFYMPNPMAKDGKK
D1draft_100006743300003310Down-Flow Hanging Sponge ReactorMETGWESFSMAGIWSWVIMAGWTIGLFVLAWWFYMPNPMDREKKHKKKS*
Ga0031653_1003959433300003859Freshwater Lake SedimentMEWVSFGMAGLWSWVIMAGWTIGLAVLAWWFFMPNPMDRDKKLKKKP*
Ga0031654_1000108383300003861Freshwater Lake SedimentMEMASLGSWIIMAGWTIGLAILAWWFFMPNPMAKDKKPKKKL*
Ga0031654_1003430613300003861Freshwater Lake SedimentMEMASLGSWLIMAGWTIGLAIIAWWFFMPNPMAKDRKPKKKP*
Ga0055490_1000058723300004052Natural And Restored WetlandsMEMAPLGGWLIMAGWTIGLAVLAWWFFMPNPMDRDKKNKKKKP*
Ga0055489_1005536823300004145Natural And Restored WetlandsMETGWESFSMAGIWSWVIMAGWTIGLAILAWWFYMPNPMDREKKHKKKS*
Ga0066599_10011986733300004282FreshwaterMEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKP*
Ga0063356_10002494553300004463Arabidopsis Thaliana RhizosphereMEMASLGSWLIMAGWTIGLAILAWWFYMPNPMAKDSKKGKKESKKQS*
Ga0062591_10000150993300004643SoilMETGWENFSMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS*
Ga0062382_1028134623300004782Wetland SedimentMEMAPLGSWLIMAGWTIGLALLAWWFFMPNPMAKGGKKDKKKP*
Ga0068999_1005949213300005205Natural And Restored WetlandsMEWSGFGMAGIWSWLIMIGWTVGLAILAWWFFMPNPMDRDKKSKKRL*
Ga0070690_10130190033300005330Switchgrass RhizosphereGLGSWLIMAGWTIGLALLAWWFYMPNPMAKDGKKDKKKS*
Ga0066388_10033865323300005332Tropical Forest SoilMETGWDSFGIAGIWSWVIMVGWTIGLFALAWWFYMPNPMDRDKKPKKKS*
Ga0066388_10284389733300005332Tropical Forest SoilMETGWDTFAMAGIWSWVIMAVWTIGIFILGWWFFMPNPMDRDRK
Ga0068869_10157249513300005334Miscanthus RhizosphereMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS*
Ga0070691_1085851323300005341Corn, Switchgrass And Miscanthus RhizosphereMEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKK
Ga0070675_10203536513300005354Miscanthus RhizosphereMETEWVSFGMPGLGSWLIMAGWTIGLALLAWWFYMPNPMAKDGKKDKKKS*
Ga0070701_1006992143300005438Corn, Switchgrass And Miscanthus RhizosphereMETGWENFSMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDKKHKKKS*
Ga0070694_10047327223300005444Corn, Switchgrass And Miscanthus RhizosphereMETEWVSFGMAGLWSWVIMAGWTIGLALLAWWFFMPNPMDRDRKPKKKS*
Ga0070694_10144742413300005444Corn, Switchgrass And Miscanthus RhizosphereMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDKKHKKKS*
Ga0070698_10018266743300005471Corn, Switchgrass And Miscanthus RhizosphereMETEWVSFGMAGLGSWLIMAGWTIGLALLAWWFYMPNPMAKDGKKDKKKS*
Ga0066905_10000554563300005713Tropical Forest SoilMETGMDTGWASFGMAGIWSWVIMALWTIGVFVLGWWFFMPNPMDRDRKHKKKP*
Ga0074479_1033155533300005829Sediment (Intertidal)METGWESFGMAGLGSWLIMAGWTIGLAILAWWFYMPNPMDRDKKGKKKP*
Ga0074473_1017671623300005830Sediment (Intertidal)MEMAGLWSWVIMAGWTIGLGILAWWFFMPNPMDRDKKHKKKP*
Ga0074472_1016715163300005833Sediment (Intertidal)METGWESFSIAGIWSWVIMAVWTIGLFVLAWWFFMPNPMDRDRKHKKKP*
Ga0074472_1048074553300005833Sediment (Intertidal)MEMASLGSWLIMAGWTIGLGILGWWFFMPNPMAKDKKDKKKKP*
Ga0074472_1057645713300005833Sediment (Intertidal)MMDAGWETFGMAGLGSWLIIAAWTIGIGFLAWWFFMPNPMDRDRK
Ga0074472_1065542153300005833Sediment (Intertidal)MEMAPLGSWLIMAGWTIGLAILAWWFFMPNPMAKGGKKDKKKP*
Ga0074472_1078888513300005833Sediment (Intertidal)METEWVSFGWAGIGSWLMIVGWTIGLAILAWWFFMPNPMDRDRKSKKKS*
Ga0074472_1131842723300005833Sediment (Intertidal)MEMAGLWSWVIMAGWTIGLGFLAWWFFMPNPMDRDKKPKKKA*
Ga0073926_1000875033300005943SandMETGWENFSMAGLWSWVIMAGWTIGIGVLAWWFFIPNPMDRDRKHNKKP*
Ga0073920_100858313300005956SandSWVIMAVWTIVLGVLAWWFFMPNPMDRDKKHKKKP*
Ga0073923_103392713300005991SandMETGWESFGMAGLGSWLIMAGWTIGLAILAWWFYMPNPMDR
Ga0073924_101615833300005992SandPIGSCGMETGWENFSMAGLWSWVIMAGWTIGIGVLAWWFFIPNPMDRDRKHNKKP*
Ga0075023_10000997643300006041WatershedsMDMAPLGSWIIMAGWTIGLVVLGWWFFMPNPMAKDKKNKKKP*
Ga0075023_10002335013300006041WatershedsMMESGWISFGMAGLGSWLIIAAWTIGIGVLAWWFFMPNPMDRDGKPKKKP*
Ga0075023_10008895533300006041WatershedsMEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKS*
Ga0075023_10016255923300006041WatershedsMEMAGLWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDKKKP*
Ga0075028_10082101813300006050WatershedsMETEWVGFGWAGIGSWVIMAGWTIGLAILAWWFYMPSPMAKDGKRNKKKS*
Ga0075026_10002462813300006057WatershedsEMEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKS*
Ga0070715_1071467923300006163Corn, Switchgrass And Miscanthus RhizosphereMEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDKKKP*
Ga0075420_10005432123300006853Populus RhizosphereMEVAGFWSWVIMAAWTIGLFILGWWFFMPNPMDRDRKSKKKP*
Ga0075425_10016045733300006854Populus RhizosphereMETGWNSFGMAGIWSWVIMIGWTIGLFALAWWFYMPNPMDRDKKSKKKS*
Ga0079218_1001452033300007004Agricultural SoilMEMASLGSWLIMAGWTIGLAILAWWFYMPNPMAKDGKKGKKESKKQS*
Ga0105044_1014243443300007521FreshwaterMETDWVSFGMAGIWSWVIMIAWTIGIAVLAWWFFMPNPMDRDRKPKKKP*
Ga0099829_1069709323300009038Vadose Zone SoilMEMIQIGSWLIMAGMAIGVFVLGWWFFLENPMAKDKKNKENKKRP*
Ga0105106_1002982143300009078Freshwater SedimentMETGWESFSMAGIWSWLIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS*
Ga0105046_1036370923300009084FreshwaterMEMAGLWSWVIMAGWTIGIAILAWWFYMPNPMGKDRKPKKKP*
Ga0102851_1004389853300009091Freshwater WetlandsMEMAGLWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKPKKKP*
Ga0075418_1136073323300009100Populus RhizosphereMEMAGFWSWVIMAAWTIGLFVLAWWFYMPNPMDRDKKSKKKS*
Ga0105164_1000579583300009777WastewaterMEMAPLGSWIIMAGWTIGLIVLGWWFFMPNPMAKDKKDKKKP*
Ga0126382_1241724623300010047Tropical Forest SoilWESFGIAGIWSWFIMVGWTIGLFELAWWFYMPNPMDRDKKSKKKS*
Ga0126372_1057002223300010360Tropical Forest SoilMETGWDTFAMAGIWSWVIMAVWTIGIFILGWWFFMPNPMDRDRKPKKKP*
Ga0126372_1290209613300010360Tropical Forest SoilMETGWDSFGIAGIWSWVIMVGWTIGLFALAWWFYMPNPMDRDKKPKK
Ga0136847_1024230843300010391Freshwater SedimentMEMVQIGSWLIMAGMAIGVFVLGWWFFMPNPMAKDRKDRNKKP*
Ga0137454_107244823300011406SoilMEMAPLGSWIIMAGWTIGLFVLGWWFFMPNPMDRDRKNKKKP*
Ga0137462_100010953300011421SoilMPSLGSWLMIAGWTIGIAVLGWWFYMPNPMAKDRKNKKKP*
Ga0137389_1072949623300012096Vadose Zone SoilMEMAPLGSWIIIAVMTIGVFVLGWWFFMENPMAKDKKNKKNKEKP*
Ga0137347_109474023300012152SoilMETEWVGFGIAGLGSWLMIAGWTIGLAILAWWFYMPNPMDRDRKNKKKP*
Ga0150985_11249422823300012212Avena Fatua RhizosphereMEMAGLWSWVIMAGWTIVIGILAWWFYMPNPMAKDGKKPKKKP*
Ga0137447_100763043300012226SoilGMAGIWSWLIMIGWTVGLAILAWWFFMPNPMDRDRKPKKKP*
Ga0137447_110407413300012226SoilMEMAGLWSWVIMAGWTIGLGVLAWWFFMPNPMDRDKKPKKKA*
Ga0157216_1005321633300012668Glacier Forefield SoilMEMASLGSWLIMAGWSIGLAILAWWFFMPNPMDRDRKHKKKR*
Ga0153915_1214389813300012931Freshwater WetlandsMETGWQSFSIAGIWSWVIMAVWTIGIFVLAWWFFMPNPMDRDRKHKKKS*
Ga0126375_1001877553300012948Tropical Forest SoilMETGWESFGIAGIWSWVIMVGWTIGLFALAWWFYMPNPMDRDKKSKKKS*
Ga0164301_1186614623300012960SoilMEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKERKDRTKKP*
Ga0180089_107039923300015254SoilGSWLIMAGMAIGVFVLGWWFFIPNPMAKDRKDRNKKP*
Ga0163144_1006022863300015360Freshwater Microbial MatMEMASIGSWLIMGGWTIGLAILAWWFFMPNPMAKDRKPKKKP*
Ga0163144_1096249423300015360Freshwater Microbial MatMETDWVSFGMAGLWSWAIMIGWTIGLAVLAWWFFMPNPMAKDRKPKKKP*
Ga0132255_10506633023300015374Arabidopsis RhizosphereMETGWASFGMAGIWSWVIMVGWTIGLFALAWWFYMPNPMDRDKKSKKKS
Ga0180121_1003628143300017695Polar Desert SandMEMAGLWSWVIMAGWTIGIAILAWWFYMPNPMGKDRKTKKKP
Ga0184608_1003757823300018028Groundwater SedimentMEMVQIGSWLIMAGMAIGVFVLGWWFFLENPMAKDKKNKKKP
Ga0184618_1048071113300018071Groundwater SedimentWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNENP
Ga0184633_1005605023300018077Groundwater SedimentASLGSWLIMAGMAIGVFILGWWFFMPNTMAKDRKDRNKKP
Ga0190270_1008190323300018469SoilMEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKP
Ga0187894_10000034123300019360Microbial Mat On RocksMEMAGIWSWVIMAGWTIGLGILAWWFFMPNPMDRDKKHKKKS
Ga0187894_10000814183300019360Microbial Mat On RocksMEVAGFWSWVIMAAWTIGLFVLAWWFYMPNPMTKDRKDKKKQ
Ga0190264_1000377743300019377SoilMEMASLGSWLIMAGWSIGLAILAWWFFMPNPMDRDRKHKKKR
Ga0190264_1002431133300019377SoilMEMAGLWSWVIMAGWTIVIAILAWWFYMPNPMAKDSKRPKKKP
Ga0187892_10000018283300019458Bio-OozeMEMASLGSWIIMAVWTIGLFILGWWFFMPNPMDRDRKSKKKPPPPPA
Ga0163151_10002933243300020057Freshwater Microbial MatMEMASIGSWLIMGGWTIGLAILAWWFFMPNPMAKDRKPKKKP
Ga0194035_1000032243300020167Anoxic Zone FreshwaterMEMAGLWSWVIMAGWTIGLGVLAWWFFMPNPMDRDKKPKKKA
Ga0163149_1015070443300020596Freshwater Microbial MatMEMASIGSWLIMGGWTIGLAILAWWFFMPNPMAKDRKPK
Ga0213899_10059223300021272SoilMEMASLGSWLIMAGWTIGLAILAWWFYMPNPMAKDSKKGKKENKKQP
Ga0210324_112198523300021333EstuarineMEWSGFGMAGIWSWLIMIGWTVGLAILAWWFFMPNPMDRDKKSKKRL
Ga0212091_1019594423300022549GroundwaterMEMVQIGSWLIMAGWTIGLAILAWWFYMPNPMDRDKKGKKKP
Ga0207685_1053329213300025905Corn, Switchgrass And Miscanthus RhizosphereMEMAGLWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDKKKP
Ga0207659_1173276213300025926Miscanthus RhizosphereMETEWVSFGMPGLGSWLIMAGWTIGLALLAWWFYMPNPMAKDGKKDKKKS
Ga0210116_105646913300025959Natural And Restored WetlandsMETGWESFSMAGIWSWVIMAGWTIGLAILAWWFYMPNPMDREKKHKKKS
Ga0210102_102852033300025971Natural And Restored WetlandsMEMAPLGGWLIMAGWTIGLAVLAWWFFMPNPMDRDKKNKKKKP
Ga0209851_102925013300026902SandPIGSCGMETGWENFSMAGLWSWVIMAGWTIGIGVLAWWFFIPNPMDRDRKHNKKP
Ga0209867_101642323300027393SandMEMAGLWSWVIMAVWTIVLGVLAWWFFMPNPMDRDKKHKKKP
Ga0209983_113689023300027665Arabidopsis Thaliana RhizosphereMETGWENFSMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS
Ga0209592_111572623300027731Freshwater SedimentMETGWESFSIAGIWSWVIMAVWTIGLFVLAWWFFMPNPMDRDRKHKKKP
Ga0209180_1021331723300027846Vadose Zone SoilMEMIQIGSWLIMAGMAIGVFVLGWWFFLENPMAKDKKNKENKKRP
Ga0209591_1071913723300027850FreshwaterMETDWVSFGMAGIWSWVIMIAWTIGIAVLAWWFFMPNPM
Ga0209486_1073637923300027886Agricultural SoilMEMASLGSWLIMAGWTIGLAILAWWFYMPNPMAKDGKKGKKESKKQS
Ga0209068_1000885033300027894WatershedsMDMAPLGSWIIMAGWTIGLVVLGWWFFMPNPMAKDKKNKKKP
Ga0209253_1016247433300027900Freshwater Lake SedimentMEWVSFGMAGLWSWVIMAGWTIGLAVLAWWFFMPNPMDRDKKLKKKP
Ga0209253_1040707023300027900Freshwater Lake SedimentMEMASLGSWLIMAGWTIGLAILAWWFFMPNPMAKDKKPKKKL
Ga0209048_1001431563300027902Freshwater Lake SedimentMEMASLGSWIIMAGWTIGLAILAWWFFMPNPMAKDKKPKKKL
Ga0209048_1002905763300027902Freshwater Lake SedimentMEMASLGSWLIMAGWTIGLAIIAWWFFMPNPMAKDRKPKKKP
Ga0209583_1002174233300027910WatershedsMEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKS
Ga0209583_1061452723300027910WatershedsMETEWVSFGMAGLGSWLIIVAWTIGIGVLAWWFYMPNPMDRDRKPKKKP
Ga0209705_1005107943300027979Freshwater SedimentMIVTNRESRMETGWESFSMAGIWSWLIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS
Ga0307505_1006061923300031455SoilMEMAGFWSWVIMAVWTIAIFVLGWWFYMPNPMAKDGKPKKKP
Ga0310888_1002820323300031538SoilMETGWENFSMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDKKHKKKS
Ga0310887_1027695323300031547SoilMEMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDKKHKKKS
Ga0310886_1001629913300031562SoilMEMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS
Ga0247727_1001095463300031576BiofilmMDMAPLGSWIIMAGMAIGVFVLGWWFFLENPMAKDRKNKENKKKP
Ga0247727_1059668213300031576BiofilmMEMVQIGSWLIMAGMAIGVFILGWWFFLENPMAKDKKNKKKP
Ga0310904_1090137723300031854SoilGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKP
Ga0310896_1016237213300032211SoilIGSHEMETGWENFSMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDKKHKKKS
Ga0315271_1004707653300032256SedimentMEMAGLWSWVIMAGWTIGLGFLAWWFFMPNPMDRDKKPKKKA
Ga0315271_1033241233300032256SedimentMETEWVSFGWAGIGSWLMIVGWTIGLAILAWWFFMPNPMDRDRKSKKKS
Ga0315270_1007557443300032275SedimentMEMAGLWSWVIMAGWSIVLAILAWWFFMPNPMDRDRKPKKKP
Ga0335394_1050336913300032456FreshwaterMEMAGLWSWVIMAGWTIGIAILAWWFYMPNPMGKDRKPKKKP
Ga0326726_1002401743300033433Peat SoilMMESGWISFGMAGLGSWLIIAAWTIGIGFLAWWFFMPNPMDRDKRPKKKL
Ga0316628_10326100323300033513SoilMETGWQSFSIAGIWSWVIMGVWTIGIFVLAWWFFMPNPMDRDRKHKKKP
Ga0370498_006580_695_8233300034155Untreated Peat SoilMEMAGLWSWVIMAGWTIGLGVLAWWFFMPNPMDRDRKPKKKQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.