NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070535

Metagenome / Metatranscriptome Family F070535

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070535
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 39 residues
Representative Sequence MYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSP
Number of Associated Samples 94
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.11 %
% of genes near scaffold ends (potentially truncated) 23.58 %
% of genes from short scaffolds (< 2000 bps) 71.54 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.732 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(19.512 % of family members)
Environment Ontology (ENVO) Unclassified
(39.024 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(70.732 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.54%    β-sheet: 0.00%    Coil/Unstructured: 78.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF00733Asn_synthase 25.20
PF13537GATase_7 4.88
PF00005ABC_tran 4.07
PF01061ABC2_membrane 3.25
PF08241Methyltransf_11 1.63
PF01381HTH_3 1.63
PF01510Amidase_2 1.63
PF01408GFO_IDH_MocA 0.81
PF00004AAA 0.81
PF00092VWA 0.81
PF13419HAD_2 0.81
PF14907NTP_transf_5 0.81
PF00884Sulfatase 0.81
PF01112Asparaginase_2 0.81
PF01370Epimerase 0.81
PF13472Lipase_GDSL_2 0.81
PF07638Sigma70_ECF 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG1446Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamilyAmino acid transport and metabolism [E] 0.81
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.73 %
UnclassifiedrootN/A29.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c0823807Not Available602Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0825360All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3420Open in IMG/M
3300000550|F24TB_12271435Not Available549Open in IMG/M
3300000550|F24TB_12271436All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium615Open in IMG/M
3300000956|JGI10216J12902_103146041Not Available611Open in IMG/M
3300003267|soilL1_10156401All Organisms → cellular organisms → Bacteria → Proteobacteria1469Open in IMG/M
3300003324|soilH2_10145962All Organisms → cellular organisms → Bacteria4164Open in IMG/M
3300004463|Ga0063356_104825311Not Available579Open in IMG/M
3300005329|Ga0070683_100634306Not Available1023Open in IMG/M
3300005340|Ga0070689_100121328All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2088Open in IMG/M
3300005366|Ga0070659_100762401Not Available840Open in IMG/M
3300005367|Ga0070667_100504089All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300005455|Ga0070663_101155118All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium679Open in IMG/M
3300005471|Ga0070698_100000004All Organisms → cellular organisms → Bacteria132184Open in IMG/M
3300005526|Ga0073909_10663601Not Available520Open in IMG/M
3300005543|Ga0070672_101568410All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium590Open in IMG/M
3300005548|Ga0070665_100020105All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes6703Open in IMG/M
3300005548|Ga0070665_100190229All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2053Open in IMG/M
3300005549|Ga0070704_101117544Not Available716Open in IMG/M
3300005564|Ga0070664_100011766All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes7103Open in IMG/M
3300005564|Ga0070664_100139131All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2137Open in IMG/M
3300005577|Ga0068857_100048910All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3751Open in IMG/M
3300005578|Ga0068854_100415084All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300005718|Ga0068866_10332265Not Available960Open in IMG/M
3300005718|Ga0068866_11304590Not Available527Open in IMG/M
3300005764|Ga0066903_102515880All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes997Open in IMG/M
3300005834|Ga0068851_10016455All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3539Open in IMG/M
3300005840|Ga0068870_10671994All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes712Open in IMG/M
3300006058|Ga0075432_10109239All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300006169|Ga0082029_1767191All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300006173|Ga0070716_100989416All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium664Open in IMG/M
3300006237|Ga0097621_102434998Not Available501Open in IMG/M
3300006844|Ga0075428_100024729All Organisms → cellular organisms → Bacteria6645Open in IMG/M
3300006844|Ga0075428_100054341All Organisms → cellular organisms → Bacteria4389Open in IMG/M
3300006844|Ga0075428_100209689All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2105Open in IMG/M
3300006845|Ga0075421_100001144All Organisms → cellular organisms → Bacteria30390Open in IMG/M
3300006845|Ga0075421_100066601All Organisms → cellular organisms → Bacteria4547Open in IMG/M
3300006845|Ga0075421_100947052All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300006846|Ga0075430_100313438All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300006846|Ga0075430_100647159All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes872Open in IMG/M
3300006852|Ga0075433_10060234All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3323Open in IMG/M
3300006852|Ga0075433_10148164All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium2087Open in IMG/M
3300006852|Ga0075433_10717925All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes875Open in IMG/M
3300006853|Ga0075420_100629009All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes926Open in IMG/M
3300006854|Ga0075425_100388332Not Available1608Open in IMG/M
3300006871|Ga0075434_102523107Not Available515Open in IMG/M
3300006904|Ga0075424_100025466All Organisms → cellular organisms → Bacteria6089Open in IMG/M
3300007004|Ga0079218_10859383All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium883Open in IMG/M
3300009094|Ga0111539_11125750All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300009147|Ga0114129_10305518All Organisms → cellular organisms → Bacteria → Proteobacteria2119Open in IMG/M
3300009147|Ga0114129_10725685All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1275Open in IMG/M
3300009156|Ga0111538_14133947Not Available501Open in IMG/M
3300009174|Ga0105241_11210500All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes716Open in IMG/M
3300010038|Ga0126315_10104972All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-221626Open in IMG/M
3300010166|Ga0126306_11288728Not Available602Open in IMG/M
3300010398|Ga0126383_11498707All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium764Open in IMG/M
3300010400|Ga0134122_11465959Not Available700Open in IMG/M
3300012212|Ga0150985_105804925All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium812Open in IMG/M
3300012212|Ga0150985_108102813All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1315Open in IMG/M
3300012212|Ga0150985_108325681All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300012212|Ga0150985_109117278Not Available519Open in IMG/M
3300012212|Ga0150985_115655518Not Available746Open in IMG/M
3300012212|Ga0150985_120590776All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes771Open in IMG/M
3300012469|Ga0150984_102712914All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes733Open in IMG/M
3300012469|Ga0150984_106572414All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae648Open in IMG/M
3300012469|Ga0150984_111576295Not Available616Open in IMG/M
3300012971|Ga0126369_11960601All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium674Open in IMG/M
3300013307|Ga0157372_10388190All Organisms → cellular organisms → Bacteria1627Open in IMG/M
3300013308|Ga0157375_10719614All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1151Open in IMG/M
3300015371|Ga0132258_10694294All Organisms → cellular organisms → Bacteria2562Open in IMG/M
3300015371|Ga0132258_11018537All Organisms → cellular organisms → Bacteria2093Open in IMG/M
3300015372|Ga0132256_100172194All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2192Open in IMG/M
3300015373|Ga0132257_100541018All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300015374|Ga0132255_100538420All Organisms → cellular organisms → Bacteria1720Open in IMG/M
3300015374|Ga0132255_102214402All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300018067|Ga0184611_1303761Not Available554Open in IMG/M
3300018083|Ga0184628_10611864Not Available550Open in IMG/M
3300018469|Ga0190270_10203936All Organisms → cellular organisms → Bacteria → Proteobacteria1674Open in IMG/M
3300021445|Ga0182009_10182016All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1014Open in IMG/M
3300022756|Ga0222622_10936741Not Available635Open in IMG/M
3300025315|Ga0207697_10264892Not Available761Open in IMG/M
3300025893|Ga0207682_10056813All Organisms → cellular organisms → Bacteria1630Open in IMG/M
3300025893|Ga0207682_10180697Not Available963Open in IMG/M
3300025899|Ga0207642_10875409Not Available574Open in IMG/M
3300025908|Ga0207643_10393980All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300025920|Ga0207649_10240789All Organisms → cellular organisms → Bacteria1298Open in IMG/M
3300025921|Ga0207652_10953071All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes756Open in IMG/M
3300025925|Ga0207650_10071899All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2603Open in IMG/M
3300025925|Ga0207650_10879625All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300025928|Ga0207700_11598338All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium577Open in IMG/M
3300025930|Ga0207701_10004012All Organisms → cellular organisms → Bacteria14995Open in IMG/M
3300025931|Ga0207644_10395127All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1129Open in IMG/M
3300025933|Ga0207706_10109703All Organisms → cellular organisms → Bacteria2428Open in IMG/M
3300025934|Ga0207686_10178552All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium1504Open in IMG/M
3300025934|Ga0207686_10346448Not Available1117Open in IMG/M
3300025944|Ga0207661_10360001All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1314Open in IMG/M
3300025944|Ga0207661_11761755Not Available565Open in IMG/M
3300025945|Ga0207679_11533729Not Available611Open in IMG/M
3300025960|Ga0207651_10869109All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes802Open in IMG/M
3300025981|Ga0207640_10616926Not Available920Open in IMG/M
3300026075|Ga0207708_10043460All Organisms → cellular organisms → Bacteria3424Open in IMG/M
3300027886|Ga0209486_11002163All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium561Open in IMG/M
3300027909|Ga0209382_10021138All Organisms → cellular organisms → Bacteria7899Open in IMG/M
3300027909|Ga0209382_10050474All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes4956Open in IMG/M
3300027909|Ga0209382_10130342All Organisms → cellular organisms → Bacteria2927Open in IMG/M
3300027909|Ga0209382_10265795All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium1943Open in IMG/M
3300028379|Ga0268266_10061354All Organisms → cellular organisms → Bacteria3243Open in IMG/M
3300028876|Ga0307286_10423101Not Available501Open in IMG/M
3300030993|Ga0308190_1132128Not Available578Open in IMG/M
3300031476|Ga0314827_112538Not Available669Open in IMG/M
3300031481|Ga0314816_1040291Not Available612Open in IMG/M
3300031548|Ga0307408_100002749All Organisms → cellular organisms → Bacteria12218Open in IMG/M
3300031716|Ga0310813_10101404All Organisms → cellular organisms → Bacteria2238Open in IMG/M
3300031731|Ga0307405_10189334All Organisms → cellular organisms → Bacteria1485Open in IMG/M
(restricted) 3300031825|Ga0255338_1000132All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae327979Open in IMG/M
3300031846|Ga0318512_10649952All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium539Open in IMG/M
3300031908|Ga0310900_10001380All Organisms → cellular organisms → Bacteria9611Open in IMG/M
3300031939|Ga0308174_10531160All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300031995|Ga0307409_102544392Not Available540Open in IMG/M
3300033412|Ga0310810_10000283All Organisms → cellular organisms → Bacteria52931Open in IMG/M
3300033475|Ga0310811_10841110Not Available845Open in IMG/M
3300033513|Ga0316628_101237973All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300034817|Ga0373948_0158096Not Available570Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere19.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere5.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.88%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere4.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.06%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.06%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.06%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.25%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.44%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.44%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.44%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.63%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.63%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.63%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.63%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.81%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.81%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.81%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031476Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031481Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031825 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_082380723300000033SoilMYQAPKLERLGTFREVTLAGGDFNPGDGXNPYXRYA
ICChiseqgaiiDRAFT_082536043300000033SoilMYQAPKLERLGTFREVTLAGGMVSQADATNPYHRYS*
F24TB_1227143523300000550SoilMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYA
F24TB_1227143613300000550SoilLSREGWMYQAPKLERLGTFREVTLSGGMVSQADATNPYHRYS*
JGI10216J12902_10314604123300000956SoilMYQAPKLERLGTFREVTLAGGQVSQADATNPYHRYS*
soilL1_1015640123300003267Sugarcane Root And Bulk SoilMYSAPKLERLGTFREVTLSGGAFLQADASNPYHRYDQLVS*
soilH2_1014596223300003324Sugarcane Root And Bulk SoilMYEAPKLERLGTFRDVTQAGGAFEPGDGSNAFHRYAPIIA*
Ga0063356_10482531113300004463Arabidopsis Thaliana RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSPLPS*
Ga0070683_10063430623300005329Corn RhizosphereMYEAPKLERLGTLRELTLAGGDFTPGDGANAFHRYAPLPG*
Ga0070689_10012132833300005340Switchgrass RhizosphereEGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA*
Ga0070659_10076240123300005366Corn RhizosphereLTQEGSMYEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA*
Ga0070667_10050408923300005367Switchgrass RhizosphereMYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSPNG*
Ga0070663_10115511823300005455Corn RhizosphereEGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA*
Ga0070698_100000004393300005471Corn, Switchgrass And Miscanthus RhizosphereMYEAPKLERLGTFREITLAGGDFNPGDGGNPYHRYAPLPS*
Ga0073909_1066360113300005526Surface SoilMYQAPKLERLGTFREVTLAGGAFEAGDGVNPYHRYSE*
Ga0070672_10156841023300005543Miscanthus RhizosphereMYQAPKLERLGSFREITQAGGDFSPGDGANAFHRYAP
Ga0070665_10002010533300005548Switchgrass RhizosphereMYQSPKLERLGTFREVTLNGGDVLASDAGNPYHRYS*
Ga0070665_10019022923300005548Switchgrass RhizosphereMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA*
Ga0070704_10111754413300005549Corn, Switchgrass And Miscanthus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYAPLPS*
Ga0070664_10001176643300005564Corn RhizosphereMYQAPKLERLGSFREVTLAGGDFNPGDGGNPFHRYAPLPS*
Ga0070664_10013913143300005564Corn RhizosphereMYEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA*
Ga0068857_10004891033300005577Corn RhizosphereMYQSPKLERLGTFREVTLAGGAVLAADASNPYHRYR*
Ga0068854_10041508413300005578Corn RhizosphereMYQAPKLERLGSFREVTLAGGDFNPGDGGNPYHRYAPL*
Ga0068866_1033226523300005718Miscanthus RhizosphereMYERPTLERLGTLRELTRAGGANTPGDGANPYHRYGP*
Ga0068866_1130459013300005718Miscanthus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPIG*
Ga0066903_10251588023300005764Tropical Forest SoilMYQAPKLERLGTFREVTLAGGDFNPGDGGNPFHRYAPA*
Ga0068851_1001645523300005834Corn RhizosphereMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA*
Ga0068870_1067199423300005840Miscanthus RhizosphereMYQTPKLERLGTFREVTLAGGAVLNSDASNPYHRYR*
Ga0075432_1010923923300006058Populus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYAPIG*
Ga0082029_176719113300006169Termite NestMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPA*
Ga0070716_10098941613300006173Corn, Switchgrass And Miscanthus RhizosphereHLSWEGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA*
Ga0097621_10243499813300006237Miscanthus RhizosphereQEGSMYEAPKLERLGTLRELTLGGGDFTPGDGANAFHRYSP*
Ga0075428_10002472943300006844Populus RhizosphereMYQAPKLERLGTFREVTLAGGEFNPGDGGNPYHRYAPIG*
Ga0075428_10005434143300006844Populus RhizosphereMYETPKLERLGTMRDLTLAGGDFATGDGGNPYHRYTP*
Ga0075428_10020968923300006844Populus RhizosphereVYVKPKLERLGTLRELTLAGGDFAPGDGANPYHRYSP*
Ga0075421_10000114443300006845Populus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYTALS*
Ga0075421_10006660153300006845Populus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYAPL*
Ga0075421_10094705223300006845Populus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLPS*
Ga0075430_10031343823300006846Populus RhizosphereMYQSPKLERLGTFREVTLNGGDVLAADASNPYHRYS*
Ga0075430_10064715913300006846Populus RhizosphereEGWMYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYSP*
Ga0075433_1006023423300006852Populus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYSQIG*
Ga0075433_1014816413300006852Populus RhizosphereMYETPKLERLGTLRELTQAGGDFAPGDGANPYHRYAP*
Ga0075433_1071792513300006852Populus RhizosphereQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYAPIG*
Ga0075420_10062900923300006853Populus RhizosphereQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSPLPS*
Ga0075425_10038833223300006854Populus RhizosphereMYETPKLERLGTVRELTLAGGANTPGDGANPYHRYGP*
Ga0075434_10252310723300006871Populus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLIG*
Ga0075424_10002546613300006904Populus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRY
Ga0079218_1085938323300007004Agricultural SoilMYQAPKLERLGSFREVTLAGGDFNPGDGANPYHRYSPLPS*
Ga0111539_1112575013300009094Populus RhizosphereMYQAPKLERLGSFREITLGGGDFNPGDGTNAFHRYSPNG*
Ga0114129_1030551833300009147Populus RhizosphereMYETPKLERLGTVRELTRAGGANTPGDGANPYHRYGP*
Ga0114129_1072568523300009147Populus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYGPIG*
Ga0111538_1413394723300009156Populus RhizosphereYEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA*
Ga0105241_1121050023300009174Corn RhizosphereMYQAPKLERLVTFLEVTLAGGMISAGDGVNPYHRYSQ*
Ga0126315_1010497223300010038Serpentine SoilMYQSPKLERLGTFREVTLNGGDVLAADAGNPYHRYS*
Ga0126306_1128872823300010166Serpentine SoilMYQSPKLERLGTFREVTLAGGEVLAADASNPYHRYS*
Ga0126383_1149870723300010398Tropical Forest SoilMYQAPKLERLGTFREVILAGGMVEAGDGANPYHRYA*
Ga0134122_1146595923300010400Terrestrial SoilMYQAPKLERLGTFREVTLAGGMIEAGDGANPYHRYSA*
Ga0150985_10580492513300012212Avena Fatua RhizospherePETVVTGGWMYEKPKLERLGSLRELTLAGGEFAPGDGANPYHRYAP*
Ga0150985_10810281333300012212Avena Fatua RhizosphereMYQAPKLERLGSFREVTLGGGEFNPGDGTNAFHRYAPTG*
Ga0150985_10832568123300012212Avena Fatua RhizosphereMKDVYTKPKLERLGTFREVTQSGGEFVCADAAGPYARYPMA*
Ga0150985_10911727813300012212Avena Fatua RhizosphereMYETPKFERLGTLRELTRAGGDFSPGDATNAFHRYAP*
Ga0150985_11565551823300012212Avena Fatua RhizosphereMYEAPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSAGG*
Ga0150985_12059077623300012212Avena Fatua RhizosphereMYQAPKLERLGSFREITLGGGDFNPGDGTNAFHRYAPLPS*
Ga0150984_10271291423300012469Avena Fatua RhizosphereMYQAPKLERLGSFREVTLGGGDFNPGDGTNAFHRYAPIG*
Ga0150984_10657241413300012469Avena Fatua RhizosphereMYQAPKLERLGSFREITQAGGDFSPGDGTNAFHRYTP*
Ga0150984_11157629523300012469Avena Fatua RhizosphereMYESPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSAGG*
Ga0126369_1196060113300012971Tropical Forest SoilREGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA*
Ga0157372_1038819023300013307Corn RhizosphereMYEAPKLERLGTLREITLAGGEFLAADGANPFHRYSAP*
Ga0157375_1071961413300013308Miscanthus RhizosphereMYEAPKLERLGTLRELTLAGGDFTPGDGANPFHRYSP*
Ga0132258_1069429443300015371Arabidopsis RhizosphereMYEAPKLERLGTLRELTLGGGDFTPGDGANPFHRYSP*
Ga0132258_1101853723300015371Arabidopsis RhizosphereMKDAYTKPKLERLGTFREVTQGGGEFICADGANPYARYPMA*
Ga0132256_10017219423300015372Arabidopsis RhizosphereMYQTPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPL*
Ga0132257_10054101813300015373Arabidopsis RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPL*
Ga0132255_10053842013300015374Arabidopsis RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLTG*
Ga0132255_10221440213300015374Arabidopsis RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPIS*
Ga0184611_130376113300018067Groundwater SedimentMYQSPKLERLGTFREVTLAGGDVLSADASNPYHRYS
Ga0184628_1061186423300018083Groundwater SedimentMYQSPKLERLGTFREVTLNGGDVLAADASNPYHRYS
Ga0190270_1020393623300018469SoilMYQSPKLERLGTFREVTLNGGDILAADASNPYHRYS
Ga0182009_1018201613300021445SoilYEAPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSQAG
Ga0222622_1093674113300022756Groundwater SedimentMYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSPNG
Ga0207697_1026489223300025315Corn, Switchgrass And Miscanthus RhizosphereMYQAPKLERLGTFREVTLAGGMVSQADATNPYHRYS
Ga0207682_1005681323300025893Miscanthus RhizosphereMYQTPKLERLGTFREVTLAGGAVLNSDASNPYHRYR
Ga0207682_1018069723300025893Miscanthus RhizosphereMYETPKIERLGTLRDLTRAGGDFSPGDGANPFHRYAP
Ga0207642_1087540913300025899Miscanthus RhizosphereMYERPTLERLGTLRELTRAGGANTPGDGANPYHRYGP
Ga0207643_1039398023300025908Miscanthus RhizosphereMYQAPKLERLGTFREVTLAGGMVEAGDGANPYLRYA
Ga0207649_1024078933300025920Corn RhizosphereMYEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA
Ga0207652_1095307113300025921Corn RhizosphereNHLSWEGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA
Ga0207650_1007189923300025925Switchgrass RhizosphereMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA
Ga0207650_1087962513300025925Switchgrass RhizosphereMYQAPKLERLGSFREVTLAGGDFNPGDGGNPFHRYAPLPS
Ga0207700_1159833823300025928Corn, Switchgrass And Miscanthus RhizosphereNHLSWEGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA
Ga0207701_1000401253300025930Corn, Switchgrass And Miscanthus RhizosphereMYQSPKLERLGTFREVTLAGGAVLNSDASNPYHRYR
Ga0207644_1039512723300025931Switchgrass RhizosphereHLSWEGWMYQAPKLERLGTFREVTLAGGAFEAGDGVNPYHRYSE
Ga0207706_1010970323300025933Corn RhizosphereMYQSPKLERLGTFREVTLAGGAVLAADASNPYHRYR
Ga0207686_1017855223300025934Miscanthus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPIG
Ga0207686_1034644813300025934Miscanthus RhizosphereMYQAPKLERLGTFREVTLAGGAFEAGDGVNPYHRYSE
Ga0207661_1036000113300025944Corn RhizosphereKKPLLGGFMYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSPNG
Ga0207661_1176175523300025944Corn RhizosphereWMYEAPKLERLGTLRELTLAGGDFTPGDGANAFHRYAPLPG
Ga0207679_1153372923300025945Corn RhizosphereMYQAPKLERLGTFREVTLAGGMVSAADGSNPYHRYA
Ga0207651_1086910923300025960Switchgrass RhizosphereHGGLMYQSPKLERLGTFREVTLAGGAVLAADASNPYHRYR
Ga0207640_1061692613300025981Corn RhizosphereMYQAPKLERLGSFREVTLAGGDFNPGDGGNPYHRYAPL
Ga0207708_1004346043300026075Corn, Switchgrass And Miscanthus RhizosphereMYQTPKLERLGTFREVTLAGGAVLAADASNPYHRYR
Ga0209486_1100216323300027886Agricultural SoilMYQAPKLERLGSFREVTLAGGDFNPGDGANPYHRYSPLPS
Ga0209382_1002113843300027909Populus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYTALS
Ga0209382_1005047433300027909Populus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYSQIG
Ga0209382_1013034223300027909Populus RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYAPL
Ga0209382_1026579513300027909Populus RhizosphereVYVKPKLERLGTLRELTLAGGDFAPGDGANPYHRYSP
Ga0268266_1006135413300028379Switchgrass RhizosphereMYQSPKLERLGTFREVTLNGGDVLASDAGNPYHRYS
Ga0307286_1042310113300028876SoilMYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSQNG
Ga0308190_113212813300030993SoilMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLP
Ga0314827_11253823300031476SoilMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLPS
Ga0314816_104029113300031481SoilMYQAPKLERLGTFREVTLAGGEYNPGDGGNPFHRYSPLVVS
Ga0307408_10000274983300031548RhizosphereMYQAPKLERLGTFREVTLSGGMVSQADATNPYHRYS
Ga0310813_1010140423300031716SoilMYEAPKLERLGTLREITLAGGDFNPGDGGNPFHRYSPIIG
Ga0307405_1018933413300031731RhizosphereMYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSP
(restricted) Ga0255338_10001321413300031825Sandy SoilMYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLPA
Ga0318512_1064995223300031846SoilWEGWMYQAPKLERLGTFREVTLSGGMVEAGDGANPYHRYA
Ga0310900_1000138093300031908SoilMYQSPKLERLGTFREVTLAGGVVLAADASNPYHRYR
Ga0308174_1053116023300031939SoilMYQAPKLERLGSFREVTLGGGEFNPGDGTNAFHRYAPTG
Ga0307409_10254439223300031995RhizosphereMYQAPKLERLGSFREVTLGGGDFNPGDGVNAFHRYAPLPS
Ga0310810_10000283233300033412SoilMYEAPKLERLGTLRELTLAGGDFTPGDGANAFHRYAPLPG
Ga0310811_1084111023300033475SoilPEVWMYEAPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSQAG
Ga0316628_10123797313300033513SoilMYQAPKLERLGTFREVTLAGGGFTPGDGANPYHRYAPL
Ga0373948_0158096_20_1333300034817Rhizosphere SoilMYQAPKLERLGTFREVTLAGGMIEAGDGATPYHRYSA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.