NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F070492

Metagenome Family F070492

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070492
Family Type Metagenome
Number of Sequences 123
Average Sequence Length 40 residues
Representative Sequence DVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF
Number of Associated Samples 107
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.82 %
% of genes near scaffold ends (potentially truncated) 98.37 %
% of genes from short scaffolds (< 2000 bps) 86.18 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.935 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(29.268 % of family members)
Environment Ontology (ENVO) Unclassified
(38.211 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.593 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.92%    β-sheet: 0.00%    Coil/Unstructured: 83.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF13462Thioredoxin_4 9.76
PF00156Pribosyltran 5.69
PF13537GATase_7 4.88
PF04674Phi_1 3.25
PF00903Glyoxalase 1.63
PF02661Fic 1.63
PF02934GatB_N 1.63
PF04326AlbA_2 1.63
PF13857Ank_5 0.81
PF11412DsbC 0.81
PF01636APH 0.81
PF12796Ank_2 0.81
PF06831H2TH 0.81
PF02631RecX 0.81
PF05050Methyltransf_21 0.81
PF00665rve 0.81
PF10094DUF2332 0.81
PF05163DinB 0.81
PF03668ATP_bind_2 0.81
PF01850PIN 0.81
PF03965Penicillinase_R 0.81
PF13181TPR_8 0.81
PF00210Ferritin 0.81
PF13531SBP_bac_11 0.81
PF13197DUF4013 0.81
PF00483NTP_transferase 0.81
PF02637GatB_Yqey 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG0064Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunitTranslation, ribosomal structure and biogenesis [J] 2.44
COG2511Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domainTranslation, ribosomal structure and biogenesis [J] 2.44
COG2865Predicted transcriptional regulator, contains HTH domainTranscription [K] 1.63
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.81
COG1610Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activityGeneral function prediction only [R] 0.81
COG1660RNase adaptor protein RapZ for GlmZ sRNA degradation, contains a P-loop ATPase domainSignal transduction mechanisms [T] 0.81
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.81
COG2137SOS response regulatory protein OraA/RecX, interacts with RecAPosttranslational modification, protein turnover, chaperones [O] 0.81
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.81
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.81
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.81
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.81
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 0.81
COG4584TransposaseMobilome: prophages, transposons [X] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.93 %
UnclassifiedrootN/A4.07 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0474751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium942Open in IMG/M
3300001545|JGI12630J15595_10098743All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005174|Ga0066680_10169944All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300005332|Ga0066388_104975130All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005529|Ga0070741_10406636All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300005556|Ga0066707_10427614All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300005559|Ga0066700_11004832All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300005566|Ga0066693_10169449All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300005574|Ga0066694_10091433All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300005575|Ga0066702_10003935All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter5713Open in IMG/M
3300005576|Ga0066708_10128596All Organisms → cellular organisms → Bacteria1536Open in IMG/M
3300005598|Ga0066706_10285835All Organisms → cellular organisms → Bacteria → Acidobacteria1294Open in IMG/M
3300005614|Ga0068856_102642836All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005618|Ga0068864_101353751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300006032|Ga0066696_10772617All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300006034|Ga0066656_10095272All Organisms → cellular organisms → Bacteria1799Open in IMG/M
3300006173|Ga0070716_100444787All Organisms → cellular organisms → Bacteria → Acidobacteria943Open in IMG/M
3300006755|Ga0079222_10578840All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300006755|Ga0079222_11884192All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300006791|Ga0066653_10060331All Organisms → cellular organisms → Bacteria1609Open in IMG/M
3300006800|Ga0066660_10344597All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300006800|Ga0066660_10694590All Organisms → cellular organisms → Bacteria → Acidobacteria837Open in IMG/M
3300006806|Ga0079220_11294800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300007265|Ga0099794_10206069All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300007265|Ga0099794_10396867All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300009012|Ga0066710_100526396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1786Open in IMG/M
3300009012|Ga0066710_102840765All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300009088|Ga0099830_11390832All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300009088|Ga0099830_11759738All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300009093|Ga0105240_12198282All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300009098|Ga0105245_10089410All Organisms → cellular organisms → Bacteria2831Open in IMG/M
3300009137|Ga0066709_100457833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1786Open in IMG/M
3300009137|Ga0066709_103156927All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300009137|Ga0066709_103739123All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300009162|Ga0075423_11561913Not Available709Open in IMG/M
3300009174|Ga0105241_10892426All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300010321|Ga0134067_10013311All Organisms → cellular organisms → Bacteria2381Open in IMG/M
3300010325|Ga0134064_10275589All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300010326|Ga0134065_10229201All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300010335|Ga0134063_10650680All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010336|Ga0134071_10517297All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300010358|Ga0126370_12518113Not Available513Open in IMG/M
3300010360|Ga0126372_10028243All Organisms → cellular organisms → Bacteria → Acidobacteria3463Open in IMG/M
3300010361|Ga0126378_11803567All Organisms → cellular organisms → Bacteria → Acidobacteria696Open in IMG/M
3300010364|Ga0134066_10234723All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300010375|Ga0105239_10578800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.1280Open in IMG/M
3300010396|Ga0134126_11591931All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300011269|Ga0137392_10776929All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300011269|Ga0137392_11482231All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300011271|Ga0137393_10171370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1822Open in IMG/M
3300012096|Ga0137389_11472661All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300012189|Ga0137388_10302835All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300012189|Ga0137388_11414391All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300012200|Ga0137382_10335378All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300012202|Ga0137363_10107296All Organisms → cellular organisms → Bacteria2133Open in IMG/M
3300012202|Ga0137363_10377340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1178Open in IMG/M
3300012203|Ga0137399_10287957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium1355Open in IMG/M
3300012211|Ga0137377_11641754All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300012349|Ga0137387_10866218All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012350|Ga0137372_10372187All Organisms → cellular organisms → Bacteria → Acidobacteria1088Open in IMG/M
3300012350|Ga0137372_10542411All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300012351|Ga0137386_10346387All Organisms → cellular organisms → Bacteria → Acidobacteria1069Open in IMG/M
3300012351|Ga0137386_10636901Not Available767Open in IMG/M
3300012361|Ga0137360_10364439Not Available1212Open in IMG/M
3300012362|Ga0137361_11922706All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012363|Ga0137390_10080938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3192Open in IMG/M
3300012582|Ga0137358_10426945All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300012683|Ga0137398_10932130All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300012918|Ga0137396_10322044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium1144Open in IMG/M
3300012918|Ga0137396_11217333All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300012923|Ga0137359_11782490All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300012927|Ga0137416_11303345All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300012929|Ga0137404_10309385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1373Open in IMG/M
3300012929|Ga0137404_10996836All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300012930|Ga0137407_10637865All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300012944|Ga0137410_11589315All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300012948|Ga0126375_11625332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae557Open in IMG/M
3300012960|Ga0164301_11579038All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300012961|Ga0164302_10035934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2327Open in IMG/M
3300012986|Ga0164304_11885859All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300013296|Ga0157374_11205605All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300014166|Ga0134079_10096763All Organisms → cellular organisms → Bacteria → Acidobacteria1121Open in IMG/M
3300015241|Ga0137418_11054046All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300015245|Ga0137409_10707846All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300015374|Ga0132255_101339543All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300018468|Ga0066662_10286921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1372Open in IMG/M
3300020018|Ga0193721_1045437All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300021080|Ga0210382_10177345All Organisms → cellular organisms → Bacteria → Acidobacteria921Open in IMG/M
3300025321|Ga0207656_10151258All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1099Open in IMG/M
3300025898|Ga0207692_10878343All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300025906|Ga0207699_10660808All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300025914|Ga0207671_10338021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1193Open in IMG/M
3300025927|Ga0207687_11927994All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300025928|Ga0207700_10635186All Organisms → cellular organisms → Bacteria → Acidobacteria951Open in IMG/M
3300025949|Ga0207667_10117484All Organisms → cellular organisms → Bacteria2741Open in IMG/M
3300026078|Ga0207702_12383141All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300026295|Ga0209234_1034239All Organisms → cellular organisms → Bacteria1933Open in IMG/M
3300026298|Ga0209236_1175628All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300026310|Ga0209239_1012362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4477Open in IMG/M
3300026314|Ga0209268_1003094All Organisms → cellular organisms → Bacteria → Acidobacteria7770Open in IMG/M
3300026325|Ga0209152_10023332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682116Open in IMG/M
3300026328|Ga0209802_1081331All Organisms → cellular organisms → Bacteria1502Open in IMG/M
3300026329|Ga0209375_1078034All Organisms → cellular organisms → Bacteria1544Open in IMG/M
3300026329|Ga0209375_1241592All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300026331|Ga0209267_1086392All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1349Open in IMG/M
3300026335|Ga0209804_1221440All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300026342|Ga0209057_1046335All Organisms → cellular organisms → Bacteria2094Open in IMG/M
3300026351|Ga0257170_1047189All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300026538|Ga0209056_10647164All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300026547|Ga0209156_10170385All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300027591|Ga0209733_1146453All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300027633|Ga0208988_1022340All Organisms → cellular organisms → Bacteria1627Open in IMG/M
3300027663|Ga0208990_1083334All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300027671|Ga0209588_1018737All Organisms → cellular organisms → Bacteria2156Open in IMG/M
3300028673|Ga0257175_1129327All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300028792|Ga0307504_10008820All Organisms → cellular organisms → Bacteria2215Open in IMG/M
3300028884|Ga0307308_10015919All Organisms → cellular organisms → Bacteria3408Open in IMG/M
3300031720|Ga0307469_10264716All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300031771|Ga0318546_10940558All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300031942|Ga0310916_11503800All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300031962|Ga0307479_10139074All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2378Open in IMG/M
3300032067|Ga0318524_10602524All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil29.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil18.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil7.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.06%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.25%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.25%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.25%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.25%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.44%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.63%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026351Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-BEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_047475123300000156Sugar Cane Bagasse Incubating BioreactorEFDVTNISDSRYKIAKESEEIPIQYAPSRTIGGSLKFHF*
JGI12630J15595_1009874313300001545Forest SoilFDITNVGNSIYQIAKESEEIPIQYAPSHTVGGSLKFHF*
Ga0066680_1016994423300005174SoilRRLDFEFDVTNVFDSIYQVAKESEEIPIQYAPSRTIGGSLKFHF*
Ga0066388_10497513013300005332Tropical Forest SoilLEFDITNVSNSIYQMAKESEEIPIQYAPSRTVGGSLKLHF*
Ga0070741_1040663613300005529Surface SoilGVEFDVTNVSNSIYEIAKESEEIPIQFAPSRTVGGALKFHF*
Ga0066707_1042761423300005556SoilNVANNIYQVAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0066700_1100483213300005559SoilKLDLEFDVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0066693_1016944913300005566SoilDVSNSIYQIAKESEEIPIEYAPSRTVGGSLKFHF*
Ga0066694_1009143323300005574SoilEFDVTNVSNSIYQIAKESEEIPIQYAPSRTIGGSLKFHF*
Ga0066702_1000393563300005575SoilNVSNSIYKIAKESEEIPIQYAPARTVGGSLKFHF*
Ga0066708_1012859613300005576SoilLELDITNISNSIYQIAKESEEIPIQYAPSRTVGGSLRL
Ga0066706_1028583513300005598SoilTNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF*
Ga0068856_10264283613300005614Corn RhizosphereTNVSDSRYQIAKESEEIPIQFAPSRTVGGSMKFHF*
Ga0068864_10135375123300005618Switchgrass RhizosphereALEFDVTNLSDSRYQIAKESEEIPIQYAPSRTIGGSLKFHF*
Ga0066696_1077261713300006032SoilPRWLELEFDVTNVSNSVYQIAKESDEIPIQYAPSRTAGGSLKFHF*
Ga0066656_1009527233300006034SoilNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF*
Ga0070716_10044478723300006173Corn, Switchgrass And Miscanthus RhizospherePRRLALEFDITNLSDSRYQIAKESEEIPIQYAPSRTIGGSLKFHF*
Ga0079222_1057884023300006755Agricultural SoilRLDMEFDVTNVSNSIYQIAKESDEIPIQYAPSRTVGGSLKFHF*
Ga0079222_1188419213300006755Agricultural SoilRLDLELDATNLTDNRYKVSKESEEIPVQFAPSRTLGGSLKFHF*
Ga0066653_1006033143300006791SoilTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0066660_1034459713300006800SoilLDLEFDITNVSNSIYRIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0066660_1069459013300006800SoilTNVGDNRYQIAKESEEIPIQFAPSRTIGGTLRVRF*
Ga0079220_1129480023300006806Agricultural SoilTNLSDSRYQIAKESEEIPIQYAPSRTIGGSLKFHF*
Ga0099794_1020606913300007265Vadose Zone SoilTNVGNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0099794_1039686723300007265Vadose Zone SoilLEFDITNVGNSIYQIAKESEEIPIQYAPSRTVGGSLKYHF*
Ga0066710_10052639613300009012Grasslands SoilVTNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF
Ga0066710_10284076523300009012Grasslands SoilRSFDLEFDITNVSNSIYKIAKESEEIPIQYAPSRTAGGSLKFHF
Ga0099830_1139083223300009088Vadose Zone SoilNVSNNVYKIAKESEEIPIQYAPSRTAGGSLKFHF*
Ga0099830_1175973823300009088Vadose Zone SoilDLEIDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF*
Ga0105240_1219828213300009093Corn RhizosphereNLSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0105245_1008941063300009098Miscanthus RhizosphereDLELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF*
Ga0066709_10045783313300009137Grasslands SoilVTNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF*
Ga0066709_10315692723300009137Grasslands SoilTNLSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0066709_10373912323300009137Grasslands SoilLEFDVTNVSNNIYQIAKESEEIPIQYAPSRTVGGALKFHF*
Ga0075423_1156191313300009162Populus RhizosphereFDVTNVSNSIYQIAKESEEIPIQYAPSRTAGGSLKFHF*
Ga0105241_1089242613300009174Corn RhizosphereNVSDSRYQIAKESEEIPIQFAPSRTVGGSMKFHF*
Ga0134067_1001331113300010321Grasslands SoilTNASDSRYQIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0134064_1027558913300010325Grasslands SoilFDVTNVSDNVYQIAKESEEIPIQYSPPRTVGGSLKLHF*
Ga0134065_1022920113300010326Grasslands SoilSFDLEFDVTNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0134063_1065068023300010335Grasslands SoilRHLDLEFNVTNVSNSIYQIAKESEEIPIQFAPSRTVGGSLKFHF*
Ga0134071_1051729713300010336Grasslands SoilRRLDFEFDVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0126370_1251811323300010358Tropical Forest SoilEFDVTNVSNSIYEIAKESEEIPIQYAPSRTIGGSVMFRF*
Ga0126372_1002824343300010360Tropical Forest SoilFDVTNVSNSIYQIAKESEEIPIQYAPARTVGGSLKFHF*
Ga0126372_1110235513300010360Tropical Forest SoilRVGVEFNATNVGNSVYKIAKESDEIPIQYAPWRTIGASLRFNF*
Ga0126378_1180356713300010361Tropical Forest SoilMTNVSDSRYRIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0134066_1023472313300010364Grasslands SoilRLDFEFDVTNVSDSIYPIAKESEEIPIQYAPSRTIGGSLKFHF*
Ga0105239_1057880033300010375Corn RhizosphereSRRLDLELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF*
Ga0134126_1159193113300010396Terrestrial SoilRLDFEFDITNVSNSVYQIAKESEEIPIQYAPSRTVGGALKFHF*
Ga0137392_1077692923300011269Vadose Zone SoilTNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0137392_1148223113300011269Vadose Zone SoilEPRHLDFEFNITNVSNSIYQIAKESEEIPIQYAPSRTVGGSLRLHF*
Ga0137393_1017137043300011271Vadose Zone SoilVTNVSNSIYQIAKESEEIPIQYAPSRTAGGSLKFHF*
Ga0137389_1147266123300012096Vadose Zone SoilDLELDATNLTDNRYKVSKESEEIPVQFAPSRTLGGSLKFHF*
Ga0137388_1030283523300012189Vadose Zone SoilDFEFNVTNASNSVYKIAKESEEIPIQYAPMRTAGGSLKLHF*
Ga0137388_1141439123300012189Vadose Zone SoilEFNITNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0137382_1033537813300012200Vadose Zone SoilRLDFEFDVTNVSNSTYQIAKESEEIPIQYAPARTVGGSLKFHF*
Ga0137363_1010729643300012202Vadose Zone SoilDITNVGNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0137363_1037734023300012202Vadose Zone SoilDLEFDITNVGNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0137399_1028795723300012203Vadose Zone SoilFEFNVTNVSNSVYQIAKESEEIPIQYAPSRTVGGSLKLHF*
Ga0137377_1164175423300012211Vadose Zone SoilRRLDFEFDVTNVSDSIYPIAKESEEIPIQYAPSRTIGGSLKFHF*
Ga0137387_1086621823300012349Vadose Zone SoilTSVSNSIYQIAKESEEIPIQFAPSRTVGGSLKFHF*
Ga0137372_1037218733300012350Vadose Zone SoilDVTNISNSIYQIAKESEEIPIQYAASQTAGGSLKFHF*
Ga0137372_1054241113300012350Vadose Zone SoilNVSDNVYQIAKESEEIPIQFAPSRTVGGSLKFHF*
Ga0137386_1034638733300012351Vadose Zone SoilDVTNVSDNRYKIAKESEEIPIQYAPSRTLGGSLKFHF*
Ga0137386_1063690123300012351Vadose Zone SoilDVTNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF*
Ga0137360_1036443923300012361Vadose Zone SoilDLEFDVTNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF*
Ga0137361_1192270623300012362Vadose Zone SoilEFDVTNVSNSVYQIAKESDEIPIQYAPSRTVGGSLKFHF*
Ga0137390_1008093863300012363Vadose Zone SoilEFDVTNVSNSIYQIAKESEEIPIQYAPSRTAGGSLKFHF*
Ga0137358_1042694513300012582Vadose Zone SoilLEFDVTNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0137398_1093213023300012683Vadose Zone SoilPRYLDFEFNVTNVSDSIYQIAKESEEIPIQYAPSRTVGGSLKLHF*
Ga0137396_1032204413300012918Vadose Zone SoilNVSNSVYQIAKESEEIPIQYAPSRTAGGSLKLHF*
Ga0137396_1121733313300012918Vadose Zone SoilPRYFDLEFDVTNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0137359_1178249013300012923Vadose Zone SoilVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKLHF*
Ga0137416_1130334513300012927Vadose Zone SoilLEFDVTNVSNSIYKIAKESEEIPIQYAPSRTVGGGLKFHF*
Ga0137404_1030938533300012929Vadose Zone SoilRRLDLEIDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF*
Ga0137404_1099683623300012929Vadose Zone SoilCEFNVTNVSDNVYKIAKESEEIPIQYAPSPTVGGSFRFHF*
Ga0137407_1063786523300012930Vadose Zone SoilVTNVSDSIYQIAKESEEIPIQYAPSRTIGASLKFHF*
Ga0137410_1158931513300012944Vadose Zone SoilRYLDLEFDVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0126375_1162533213300012948Tropical Forest SoilNATNLTDNRYQIAKESEEIPIQFAPSRTLGGSLKFHF*
Ga0164301_1157903823300012960SoilHLDLEFDVTNVSNNIYQIAKESEEIPIQYSPSRTVGGSLKFHF*
Ga0164302_1003593453300012961SoilFDVTNVSKSVYQIAKESEEIPIQYAPSRTIGGSLKFRF*
Ga0164304_1188585923300012986SoilRLDLELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF*
Ga0157374_1120560513300013296Miscanthus RhizosphereRRLDVELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF*
Ga0134079_1009676333300014166Grasslands SoilRLDLELDITNISNSIYQIAKESEEIPIQYAPSRTVGGSLRLHF*
Ga0137418_1105404623300015241Vadose Zone SoilLDFEFDVTNVSNSTYQIAKESEEIPIQYAPARTVGGSLKFHF*
Ga0137409_1070784633300015245Vadose Zone SoilFDITNVGNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF*
Ga0132255_10133954323300015374Arabidopsis RhizosphereLEFDVTNVSNSIYQIAKESEEIPIQYAPARTVGGSLKFHF*
Ga0066662_1028692123300018468Grasslands SoilEPPRLDLEFDVTNVSNSIYKIAKESEEIPIQYAPARTVGGSLKFHF
Ga0193721_104543713300020018SoilEFDVTNVSNSIYRIAKESEEIPIQYAPSRTVGGSLKFHF
Ga0210382_1017734523300021080Groundwater SedimentDLEFDITNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKLHF
Ga0207656_1015125823300025321Corn RhizosphereVTNLSDSRYQIAKESEEIPIQYAPSRTIGGSLKFHF
Ga0207692_1087834313300025898Corn, Switchgrass And Miscanthus RhizosphereDATNLTDSRYKISKESEEIPIQFAPSRTLGGSLKFHF
Ga0207699_1066080823300025906Corn, Switchgrass And Miscanthus RhizosphereSRRLDLELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF
Ga0207671_1033802113300025914Corn RhizosphereFDVTNLSDSRYQIAKESEEIPIQYAPSRTIGGSLKFHF
Ga0207687_1192799423300025927Miscanthus RhizosphereDLELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF
Ga0207700_1063518613300025928Corn, Switchgrass And Miscanthus RhizosphereLDLELDATNLTDNRYKVSKESEEIPVQFAPSRTLGGSLKFHF
Ga0207667_1011748413300025949Corn RhizosphereATNLTNNRYKISKESEEIPIQFAPSRTLGGSLKFHF
Ga0207702_1238314123300026078Corn RhizosphereFDVTNVSDSRYQIAKESEEIPIQFAPSRTVGGSMKFHF
Ga0209234_103423913300026295Grasslands SoilTNVFDSIYQIAKESEEIPIQYAPSRTIGGSLKFHF
Ga0209236_117562813300026298Grasslands SoilDFEFDVTNVSNNIYKIAKESEEIPIQYAPSRTAGGSLKFHF
Ga0209239_101236213300026310Grasslands SoilDLEFDVTNVSNSTYQIAKESEEIPLQYAPSRTVGGSLKFHF
Ga0209268_100309413300026314SoilDFELDITNISNSIYQIAKESEEIPIQYAPSRTVGGSLRLHF
Ga0209152_1002333233300026325SoilTNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF
Ga0209802_108133113300026328SoilTNVGNSIYQIAKESEDIPIQYAPSRTVGGSLKFHF
Ga0209375_107803413300026329SoilHLDLEFNVTNVSNSIYQIAKESEEIPIQFAPSRTVGGSLKFHF
Ga0209375_124159213300026329SoilLDLELDITNISNSIYQIAKESEEIPIQYAPSRTVGGSLRLHF
Ga0209267_108639213300026331SoilFDVTNVSDSRYKIAKESEEIPIQFAPSRTVGGSLKFHF
Ga0209804_122144023300026335SoilPRSFDLEFDITNVSNSIYKTAKESEEIPIQYAPSRTAGGSLKFHF
Ga0209057_104633513300026342SoilITNVSNSIYKIAKESEEIPLQYAPSRTVGGSLKLHF
Ga0257170_104718923300026351SoilKRLDLEFDVTNLSNSIYQIAKESEEIPIQYAPPRTVGGSLKLRF
Ga0209056_1064716413300026538SoilDVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF
Ga0209156_1017038513300026547SoilFDITNVSNSIYKIAKESEEIPIQYAPSRTAGGSLKFHF
Ga0209733_114645313300027591Forest SoilMQVDVTNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF
Ga0208988_102234033300027633Forest SoilLEFDITNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF
Ga0208990_108333423300027663Forest SoilLDLEFDVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF
Ga0209588_101873743300027671Vadose Zone SoilITNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF
Ga0257175_112932713300028673SoilEPRRLDFEFDVTNVFDSIYQIAKESEEIPIQYAPSRTIGGSLKFHF
Ga0307504_1000882013300028792SoilFEFNITNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKLHF
Ga0307308_1001591973300028884SoilPRYFDLEFDLTNVSNSIYKIAKESEEIPIQYAPSRTVGGGLKFHF
Ga0307469_1026471613300031720Hardwood Forest SoilDVTNVSDSIYQIAKESEEIPIQFAPSRTIGGSLKFHF
Ga0318546_1094055813300031771SoilVEFNATNVGNSVYKIAKESDEIPIQYAPWRTIGASLRFNF
Ga0310916_1150380013300031942SoilTNISDNRYKIAKESEEIPIQYAPSRTIGGSLKFHF
Ga0307479_1013907453300031962Hardwood Forest SoilEFDVTNVSNSIYKIAKESEEIPIQYAPSRTIGGSLKFHF
Ga0318524_1060252423300032067SoilRRVGVEFNATNVGNSVYKIAKESDEIPIQYAPWRTIGASLRFNF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.