Basic Information | |
---|---|
Family ID | F070428 |
Family Type | Metagenome |
Number of Sequences | 123 |
Average Sequence Length | 45 residues |
Representative Sequence | TPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRKHRTG |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 11.82 % |
% of genes near scaffold ends (potentially truncated) | 42.28 % |
% of genes from short scaffolds (< 2000 bps) | 70.73 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.17 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (62.602 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (31.707 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.528 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.724 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.71% β-sheet: 0.00% Coil/Unstructured: 94.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF13683 | rve_3 | 6.50 |
PF03401 | TctC | 2.44 |
PF04392 | ABC_sub_bind | 2.44 |
PF00665 | rve | 2.44 |
PF13358 | DDE_3 | 2.44 |
PF01381 | HTH_3 | 1.63 |
PF01479 | S4 | 1.63 |
PF13538 | UvrD_C_2 | 1.63 |
PF01434 | Peptidase_M41 | 0.81 |
PF00550 | PP-binding | 0.81 |
PF07167 | PhaC_N | 0.81 |
PF13458 | Peripla_BP_6 | 0.81 |
PF13561 | adh_short_C2 | 0.81 |
PF13432 | TPR_16 | 0.81 |
PF01979 | Amidohydro_1 | 0.81 |
PF00275 | EPSP_synthase | 0.81 |
PF01710 | HTH_Tnp_IS630 | 0.81 |
PF00903 | Glyoxalase | 0.81 |
PF06100 | MCRA | 0.81 |
PF00375 | SDF | 0.81 |
PF14414 | WHH | 0.81 |
PF00805 | Pentapeptide | 0.81 |
PF13186 | SPASM | 0.81 |
PF00596 | Aldolase_II | 0.81 |
PF09084 | NMT1 | 0.81 |
PF01828 | Peptidase_A4 | 0.81 |
PF13701 | DDE_Tnp_1_4 | 0.81 |
PF02371 | Transposase_20 | 0.81 |
PF05199 | GMC_oxred_C | 0.81 |
PF01323 | DSBA | 0.81 |
PF07505 | DUF5131 | 0.81 |
PF13414 | TPR_11 | 0.81 |
PF13391 | HNH_2 | 0.81 |
PF00239 | Resolvase | 0.81 |
PF04909 | Amidohydro_2 | 0.81 |
PF02274 | ADI | 0.81 |
PF02738 | MoCoBD_1 | 0.81 |
PF00487 | FA_desaturase | 0.81 |
PF13676 | TIR_2 | 0.81 |
PF08240 | ADH_N | 0.81 |
PF07683 | CobW_C | 0.81 |
PF13419 | HAD_2 | 0.81 |
PF13443 | HTH_26 | 0.81 |
PF11188 | DUF2975 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 2.44 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 2.44 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.44 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.44 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 2.44 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 2.44 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG0523 | Zinc metallochaperone YeiR/ZagA and related GTPases, G3E family | General function prediction only [R] | 0.81 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.81 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.81 |
COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.81 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.81 |
COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.81 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.81 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.81 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.81 |
COG3243 | Poly-beta-hydroxybutyrate synthase | Lipid transport and metabolism [I] | 0.81 |
COG3415 | CRISPR-associated protein Csa3, CARF domain | Defense mechanisms [V] | 0.81 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.81 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
COG4716 | Myosin-crossreactive antigen (function unknown) | Function unknown [S] | 0.81 |
COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 62.60 % |
Unclassified | root | N/A | 37.40 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002121|C687J26615_10112413 | Not Available | 684 | Open in IMG/M |
3300004480|Ga0062592_100582967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 946 | Open in IMG/M |
3300004633|Ga0066395_10038723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2041 | Open in IMG/M |
3300005332|Ga0066388_102893450 | Not Available | 877 | Open in IMG/M |
3300005467|Ga0070706_101060391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 746 | Open in IMG/M |
3300005471|Ga0070698_100072634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3448 | Open in IMG/M |
3300005536|Ga0070697_100115653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2240 | Open in IMG/M |
3300005536|Ga0070697_101631567 | Not Available | 577 | Open in IMG/M |
3300005764|Ga0066903_100728780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129 | 1755 | Open in IMG/M |
3300005764|Ga0066903_101053941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1493 | Open in IMG/M |
3300005764|Ga0066903_103625430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 831 | Open in IMG/M |
3300005764|Ga0066903_106612691 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005764|Ga0066903_108233106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 533 | Open in IMG/M |
3300005764|Ga0066903_108393469 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005921|Ga0070766_10664503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 703 | Open in IMG/M |
3300006038|Ga0075365_10012011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5120 | Open in IMG/M |
3300006038|Ga0075365_10035883 | All Organisms → cellular organisms → Bacteria | 3211 | Open in IMG/M |
3300006174|Ga0075014_100522575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
3300006194|Ga0075427_10074325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium macuxiense | 609 | Open in IMG/M |
3300006845|Ga0075421_100493847 | Not Available | 1455 | Open in IMG/M |
3300007982|Ga0102924_1116679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1305 | Open in IMG/M |
3300009100|Ga0075418_10062552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3974 | Open in IMG/M |
3300009100|Ga0075418_11249042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 805 | Open in IMG/M |
3300009147|Ga0114129_11001986 | Not Available | 1052 | Open in IMG/M |
3300009147|Ga0114129_11882633 | Not Available | 726 | Open in IMG/M |
3300009166|Ga0105100_10530765 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300009630|Ga0116114_1089709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
3300009640|Ga0116126_1019386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3029 | Open in IMG/M |
3300009640|Ga0116126_1233373 | Not Available | 581 | Open in IMG/M |
3300010043|Ga0126380_11638140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
3300010046|Ga0126384_10256159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1417 | Open in IMG/M |
3300010046|Ga0126384_10368361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1203 | Open in IMG/M |
3300010046|Ga0126384_10534014 | Not Available | 1017 | Open in IMG/M |
3300010046|Ga0126384_11226227 | Not Available | 693 | Open in IMG/M |
3300010046|Ga0126384_11842290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 575 | Open in IMG/M |
3300010358|Ga0126370_10001936 | All Organisms → cellular organisms → Bacteria | 9641 | Open in IMG/M |
3300010358|Ga0126370_10062389 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
3300010358|Ga0126370_10420256 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300010358|Ga0126370_11274225 | Not Available | 687 | Open in IMG/M |
3300010358|Ga0126370_11532162 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300010358|Ga0126370_12494061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
3300010359|Ga0126376_10007148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6781 | Open in IMG/M |
3300010359|Ga0126376_10638945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1013 | Open in IMG/M |
3300010359|Ga0126376_12203606 | Not Available | 596 | Open in IMG/M |
3300010359|Ga0126376_13190832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 507 | Open in IMG/M |
3300010359|Ga0126376_13239685 | Not Available | 503 | Open in IMG/M |
3300010360|Ga0126372_10492032 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300010361|Ga0126378_10095679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2918 | Open in IMG/M |
3300010361|Ga0126378_10250066 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
3300010361|Ga0126378_10451548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1399 | Open in IMG/M |
3300010361|Ga0126378_10793670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1056 | Open in IMG/M |
3300010361|Ga0126378_11470925 | Not Available | 772 | Open in IMG/M |
3300010362|Ga0126377_11808709 | Not Available | 686 | Open in IMG/M |
3300010376|Ga0126381_100408080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1894 | Open in IMG/M |
3300010376|Ga0126381_104509061 | Not Available | 538 | Open in IMG/M |
3300010379|Ga0136449_100384101 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
3300010398|Ga0126383_12905572 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300010863|Ga0124850_1008593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3235 | Open in IMG/M |
3300011120|Ga0150983_14451405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
3300012021|Ga0120192_10015399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
3300012189|Ga0137388_11200527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
3300012210|Ga0137378_11386872 | Not Available | 617 | Open in IMG/M |
3300012363|Ga0137390_10965065 | Not Available | 805 | Open in IMG/M |
3300012910|Ga0157308_10245950 | Not Available | 628 | Open in IMG/M |
3300012944|Ga0137410_10651201 | Not Available | 874 | Open in IMG/M |
3300012971|Ga0126369_10023894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4939 | Open in IMG/M |
3300012971|Ga0126369_10187260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1984 | Open in IMG/M |
3300012971|Ga0126369_10986280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 930 | Open in IMG/M |
3300012971|Ga0126369_12250440 | Not Available | 632 | Open in IMG/M |
3300014159|Ga0181530_10584864 | Not Available | 547 | Open in IMG/M |
3300014495|Ga0182015_10023746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4913 | Open in IMG/M |
3300014495|Ga0182015_11054139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300015053|Ga0137405_1327309 | Not Available | 2231 | Open in IMG/M |
3300015242|Ga0137412_10610139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
3300015359|Ga0134085_10428383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
3300016387|Ga0182040_10166753 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
3300016422|Ga0182039_11507671 | Not Available | 612 | Open in IMG/M |
3300017925|Ga0187856_1020703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3364 | Open in IMG/M |
3300017925|Ga0187856_1146208 | Not Available | 894 | Open in IMG/M |
3300017931|Ga0187877_1077891 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300018002|Ga0187868_1056473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1655 | Open in IMG/M |
3300018017|Ga0187872_10008168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6853 | Open in IMG/M |
3300018022|Ga0187864_10036087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2882 | Open in IMG/M |
3300018023|Ga0187889_10125380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1241 | Open in IMG/M |
3300018038|Ga0187855_10081593 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
3300018061|Ga0184619_10490167 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300019361|Ga0173482_10555964 | Not Available | 568 | Open in IMG/M |
3300020579|Ga0210407_10488959 | Not Available | 962 | Open in IMG/M |
3300021560|Ga0126371_10164708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129 | 2289 | Open in IMG/M |
3300021560|Ga0126371_10429706 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
3300022557|Ga0212123_10292771 | Not Available | 1142 | Open in IMG/M |
3300025160|Ga0209109_10063142 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
3300025327|Ga0209751_11019892 | Not Available | 624 | Open in IMG/M |
3300025916|Ga0207663_10476249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 967 | Open in IMG/M |
3300026319|Ga0209647_1147467 | Not Available | 1004 | Open in IMG/M |
3300027070|Ga0208365_1008482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1253 | Open in IMG/M |
3300027874|Ga0209465_10041545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2187 | Open in IMG/M |
3300027909|Ga0209382_10724779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1067 | Open in IMG/M |
3300027911|Ga0209698_10493691 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300028755|Ga0307316_10038381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1584 | Open in IMG/M |
3300028814|Ga0307302_10030381 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
3300028876|Ga0307286_10134442 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300031128|Ga0170823_13058575 | Not Available | 521 | Open in IMG/M |
3300031226|Ga0307497_10025918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Paralcaligenes → Paralcaligenes ureilyticus | 1864 | Open in IMG/M |
3300031543|Ga0318516_10812988 | Not Available | 528 | Open in IMG/M |
3300031820|Ga0307473_10151732 | Not Available | 1318 | Open in IMG/M |
3300031820|Ga0307473_10163250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1282 | Open in IMG/M |
3300032160|Ga0311301_12383741 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300032205|Ga0307472_102023109 | Not Available | 577 | Open in IMG/M |
3300033289|Ga0310914_10071090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2927 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 31.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.94% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.50% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.06% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.44% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.44% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.63% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.63% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.63% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.63% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.63% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.63% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.63% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.81% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.81% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031563 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1128499522 | 3300000956 | Soil | MRRTPQGNIELMPQKQVLDFNPAPRPERVDDKRHKQAK |
C687J26615_101124131 | 3300002121 | Soil | TVRCTPQGNIELMPKKKVLDFKPARGLEQVGNEGPKQMEDGKHRVK* |
Ga0062592_1005829672 | 3300004480 | Soil | MPQGNIELMPKKKVLDFKPARGPEPVGNESPKQMEDGKHRVR* |
Ga0066395_100387234 | 3300004633 | Tropical Forest Soil | MVRYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEPLEDRQHRTG* |
Ga0066388_1028934502 | 3300005332 | Tropical Forest Soil | KLQTVRCTPQGNIELMAEKEVLDFKPAPRPEEVRDESPEHLEDRKHRTG* |
Ga0070706_1010603912 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VRCTPQSNIELMPEKEVLDFKPAPRPEQVRDKYPKQLKECKHRVG* |
Ga0070698_1000726341 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VRCTPQSNIELMPEKEVLDFKPAPRLEWVGDKRPKQLKEPKHRAG* |
Ga0070697_1001156531 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRTPQNNIELMPKEEILDFKPASRLEQFGDKRPKQLKKCKHRAV* |
Ga0070697_1016315671 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PQSNIELMPEKEVLDFKPAPRLEQVGDRRSKQLEDAKHRLG* |
Ga0066903_1007287802 | 3300005764 | Tropical Forest Soil | MVRYTPQGNIDLMPEKEVLDFKLTPRPEQVGDERPEQLEDREHRTG* |
Ga0066903_1010539411 | 3300005764 | Tropical Forest Soil | YQQCSVTPTKPQMVRYTPQGNIELMPEKEVLDFKLTPRPAQVGDEHPEQLEDRKHRTG* |
Ga0066903_1036254302 | 3300005764 | Tropical Forest Soil | RYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRTHRTR* |
Ga0066903_1066126911 | 3300005764 | Tropical Forest Soil | KPQMVRYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPERLEDRKQRTG* |
Ga0066903_1082331061 | 3300005764 | Tropical Forest Soil | PQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRKHRTG* |
Ga0066903_1083934692 | 3300005764 | Tropical Forest Soil | CSVTPTKPPMVRYTPQGNIELMPEKEVLDFKLTPRPEQVGHERPEQLEDRKHRTG* |
Ga0070766_106645032 | 3300005921 | Soil | MSQGNIELMPKKEILEFKSVSRLEQVGDKCPEQIEHGNHRVGR* |
Ga0075365_100120115 | 3300006038 | Populus Endosphere | MPQGNIELMPKKEILDFKPAPRLEQVGDKRSKQMAHGKHRGG* |
Ga0075365_100358833 | 3300006038 | Populus Endosphere | MAWCTSQGNIELMPKKQVLDFKPAPRLEKVGDGRSEQMEDGKHRVG* |
Ga0075014_1005225752 | 3300006174 | Watersheds | MQPEAGCTPQCNIELMPKKEILHFQLASRPEQVGDKRPKQMDNGEHRGG* |
Ga0075427_100743251 | 3300006194 | Populus Rhizosphere | PQGNIELMPKKEILDFKPAPRLEQVGDKRPKQMEHGKHRGG* |
Ga0075421_1004938472 | 3300006845 | Populus Rhizosphere | MARYTSQGNIELMPKKQVLDFKAPRLEKAGDGRSEQMEDGKHRVG* |
Ga0102924_11166792 | 3300007982 | Iron-Sulfur Acid Spring | VGCTPQGNIKLMPKKEILEFKWALRLEQVGDKRPKQMEHGNHRVG* |
Ga0075418_100625521 | 3300009100 | Populus Rhizosphere | MAWCTSQGNIELMPKKQVLDFKPAPRLEKVGDARSEQPEDGKHRVG* |
Ga0075418_112490423 | 3300009100 | Populus Rhizosphere | VRGERRNIELIPKKEILNFKSAPRLEQVGDKRPKQMEHGKHRGG* |
Ga0114129_110019863 | 3300009147 | Populus Rhizosphere | TSQGNIELMPKKQVLDFKAPRLEKAGDGRSEQMEDGKHRVG* |
Ga0114129_118826332 | 3300009147 | Populus Rhizosphere | MARCTSQGNIELMPKKQVLDFKPAPRLEKVGDGRSEQMEDGKHRVG* |
Ga0105100_105307651 | 3300009166 | Freshwater Sediment | TQPQTVRCTPQGNIELMPKKKVLDFKPARGLEQVGNEGPKQMEDGKHRVK* |
Ga0116114_10897094 | 3300009630 | Peatland | VWCTPQGNIELMPKKEILEFKSALRLEQVGHNRPKQMEHRNHRVG* |
Ga0116126_10193861 | 3300009640 | Peatland | GNIELMPKKEILKLKSAPRLEQVGDNCPKQMEHRNHRVPLPTR* |
Ga0116126_12333731 | 3300009640 | Peatland | MTKREPRGNIELMPKKEILELKSAPRFEQAGDKRRKQMERRNHRVG* |
Ga0126315_100443752 | 3300010038 | Serpentine Soil | MRRTPQGDIELMPQIQVLDFKPTPRLEPVGDERNEQAKQGKHR* |
Ga0126380_116381401 | 3300010043 | Tropical Forest Soil | QTVRCTPQGNIKLMPEKEVLDFKPLPRPELVGDKRHKQLEDRKHRAG* |
Ga0126384_102561594 | 3300010046 | Tropical Forest Soil | PYQQCSVTPTKPQMVRYTPQGNIELMPEKEVLDFKLTPRPAQVGDEHPEQLEDRKHRTG* |
Ga0126384_103683612 | 3300010046 | Tropical Forest Soil | VRRAPQGDIELVSEKEVLDFKPTPGPEQVGDKRPKQLEDRKHRTG* |
Ga0126384_104836011 | 3300010046 | Tropical Forest Soil | TPQGNIELMPEKEVLDFKPVPRPEQVGDERPEQLADRKHRTG* |
Ga0126384_105340142 | 3300010046 | Tropical Forest Soil | MVRYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDREHRTG* |
Ga0126384_112262271 | 3300010046 | Tropical Forest Soil | MVWYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRKH |
Ga0126384_118422902 | 3300010046 | Tropical Forest Soil | QGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRKHRTG* |
Ga0126382_102514422 | 3300010047 | Tropical Forest Soil | MRWAPQNNIELMPEKEILHFKLAPRPEQVGDKRPKQLKECEHRAG* |
Ga0126370_100019361 | 3300010358 | Tropical Forest Soil | TPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRKHRTG* |
Ga0126370_100623891 | 3300010358 | Tropical Forest Soil | KPLTVRCTPQRNVELMPEKDVLDFKPPPRPEQVRNKRPKQLEDRKHHAG* |
Ga0126370_104202562 | 3300010358 | Tropical Forest Soil | VRRTPQGDIELVSEKEVLDFKPTPGPEQVGDKRPKQLEDRKHRTG* |
Ga0126370_112742251 | 3300010358 | Tropical Forest Soil | MVRYTPQGNIELMPEKEVLDFKPAPRPEQVRNKRPKQLENRKHRTG* |
Ga0126370_115321622 | 3300010358 | Tropical Forest Soil | MVRYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRKHR |
Ga0126370_124940611 | 3300010358 | Tropical Forest Soil | NIELMPEKKVLDFKPAPRPEQVGDRRSEQKEDGKHRVE* |
Ga0126376_100071487 | 3300010359 | Tropical Forest Soil | VRRTPQGDIELVSEKEVLDFKPAPGPEQVGDKRPKQLEDRKHRTG* |
Ga0126376_106389453 | 3300010359 | Tropical Forest Soil | PTKPQMVRYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEPLEDRQHRTG* |
Ga0126376_122036061 | 3300010359 | Tropical Forest Soil | TVRCMPQGDIELMAEEEVLDFKPPRRPEQVGDERSDQLKGRNHRTG* |
Ga0126376_131908321 | 3300010359 | Tropical Forest Soil | VRCAPQSNIELMPEKEVLDFKLAPRPERVGDKYPQQLKE* |
Ga0126376_132396851 | 3300010359 | Tropical Forest Soil | YQQCSVTPTKPQMVRYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPERLEDRKQRTG* |
Ga0126372_104920322 | 3300010360 | Tropical Forest Soil | MLRGWYAGIELMPEKEVLDRKPPSRPEQVGDERPEPLEDRKGRTG* |
Ga0126372_123624712 | 3300010360 | Tropical Forest Soil | MPEGDIELMPEKEVLDFKPAPRPEHVGDKRPKQLDDRKHRTG* |
Ga0126378_100956791 | 3300010361 | Tropical Forest Soil | YTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRKHRTG* |
Ga0126378_102500663 | 3300010361 | Tropical Forest Soil | MARCTSQRNIELMAEKEILDFEPVPQVGDKRPKQLKECKHRAA* |
Ga0126378_104515484 | 3300010361 | Tropical Forest Soil | VTPTKPQMVRYTPQGNIELMPEKEVLDFKLTPRPAQVGDEHPEQLEDRKHRTG* |
Ga0126378_107936701 | 3300010361 | Tropical Forest Soil | TPTKPQMVRYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPERLEDRKQRTG* |
Ga0126378_114709251 | 3300010361 | Tropical Forest Soil | MVRYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRKH |
Ga0126377_100963943 | 3300010362 | Tropical Forest Soil | MPQGNIELMAEKEVLDFKPPRRPEQVGDERPEQLEDRKHRTG* |
Ga0126377_118087091 | 3300010362 | Tropical Forest Soil | VSCTPQDNIELMPKKEVVDFEPARRPEQVGDKRPEQLEDRKHRAG* |
Ga0126379_121382191 | 3300010366 | Tropical Forest Soil | GDIELMPEKEVLDLKPAPRPEQVSDKRPEQLEYRKHRTG* |
Ga0126381_1004080802 | 3300010376 | Tropical Forest Soil | MVRYTPQGNIELMPEKAVLDFKLTPRPEQVGDERPEPLEDRQHRTG* |
Ga0126381_1045090612 | 3300010376 | Tropical Forest Soil | MVRYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRKHRTG* |
Ga0136449_1003841012 | 3300010379 | Peatlands Soil | MDGVSGTDTVWCTPQGNIEPMSENEILDFKPAPRPEQVDHERRKQMEDAEHRAR* |
Ga0126383_129055721 | 3300010398 | Tropical Forest Soil | TPQGNIELMPEKEVLDFKLTPRPEQVGDERPERLEDRKQRTG* |
Ga0126383_132374591 | 3300010398 | Tropical Forest Soil | IELMPEKEVLDFKLTPRPEQVGDERPEQLEDRKHRTG* |
Ga0124850_10085934 | 3300010863 | Tropical Forest Soil | MVRYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRTHRTR* |
Ga0150983_144514052 | 3300011120 | Forest Soil | VGCTPQGNIELLPKKEILEFKWALRLEQVGDKRPKQMEHGNHRVG* |
Ga0120192_100153991 | 3300012021 | Terrestrial | MPQGNIELMPKKEILDFKPAPRLEQVGDKRPKQMEHGKHRRMMP* |
Ga0137388_112005272 | 3300012189 | Vadose Zone Soil | VRCTPQGNIELMTKKEILDFKPAPRLEQVGDKRPKQMEDRKHRIG* |
Ga0137378_113868721 | 3300012210 | Vadose Zone Soil | AQSNIELMTKKEVLDFKPAPRPEQVGDERPKQMEDGKHRAAG* |
Ga0137390_109650651 | 3300012363 | Vadose Zone Soil | VRRTPQSNIELMPEKEVLDFKPAPRPEWVGEERPKQLKETKHRAG* |
Ga0157308_102459502 | 3300012910 | Soil | MPQGNIELMPKKKVLDFKPARGPDPVGNESPKQMEDGKHRVR* |
Ga0137410_106512012 | 3300012944 | Vadose Zone Soil | MSQGDIELMPKKEVLDFKSPPRPEQVGDERPEQLEDRKHRTG* |
Ga0126369_100238942 | 3300012971 | Tropical Forest Soil | MVRYTPQGNIELMPEKEVLDFKLTPRPAQVGDEHPEQLEDRKHRTG* |
Ga0126369_101872603 | 3300012971 | Tropical Forest Soil | VRRAPQGDIELVSEKEVLDFKPAPGPEQVGDKRPKQLEDRKHRTG* |
Ga0126369_109862802 | 3300012971 | Tropical Forest Soil | MVRYTPQGNIELMPEKEVFDFKLTPRPEQVGDERPEQLEDRKHRTG* |
Ga0126369_122504402 | 3300012971 | Tropical Forest Soil | MVWYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQL |
Ga0181530_105848641 | 3300014159 | Bog | VWCTPQGNIELMPKKEILEFKSAPRLEQVGDNPPKQMEHRNHRVG* |
Ga0181538_104784352 | 3300014162 | Bog | MPKKEILKIKSVPRLEQVGDKRPKQMDHRNHRVG* |
Ga0182015_100237467 | 3300014495 | Palsa | ELMPKKDILELKSAPRLEQVGDKRPKPMKHRNHRVG* |
Ga0182015_110541392 | 3300014495 | Palsa | VWCTPQRNIELMPKKDILELKSAPRLEQVGDKRPKPMKHRNHRVG* |
Ga0137405_13273093 | 3300015053 | Vadose Zone Soil | VRCTPQGNIELMSKKKVLDFKPAPRLEQIDDKRPKQMEDGKHRVG* |
Ga0137412_106101392 | 3300015242 | Vadose Zone Soil | KAETLRCTAQGNIQLMLKKEILDFKPASRPEQVGDKRSKQREDRRHRIG* |
Ga0134085_104283831 | 3300015359 | Grasslands Soil | PQSNIELMPKEEILDFKPAPRLERVRDRCSKQMEDGKHRVG* |
Ga0182040_101667533 | 3300016387 | Soil | VRCTPQCNIELMSEKEVLDFKPALRLEQVGKERPKQVEHPEHRAR |
Ga0182039_115076711 | 3300016422 | Soil | MRCTPYGDIKLMPEKEVLGFKPAARLEQIGDKRSKQLEDRKHPTR |
Ga0187856_10207035 | 3300017925 | Peatland | RGNIELMPKKEILELKSAPRFEQAGDKRRKQMERRNHRVG |
Ga0187856_11462081 | 3300017925 | Peatland | TPQGNIELMPKKEILEFKSAPRLEQVGHNRPKQMEHRNHRIGS |
Ga0187877_10778911 | 3300017931 | Peatland | MILGKDRCTPQGNIELMPKKEILKLKSAPRLEQVGDNGPKQMEHRNHRVDDEL |
Ga0187868_10564735 | 3300018002 | Peatland | VWCTPQGNIELMPKKEILEFKSALRLEQVGHNRPKQMEHRNHRVG |
Ga0187872_100081683 | 3300018017 | Peatland | MTKREPRGNIELMPKKEILELKSAPRFEQAGDKRRKQMERRNHRVG |
Ga0187864_100360875 | 3300018022 | Peatland | TPQGNIELMPKKEILKLKSAPRLEQVGDNCPKQMEHRNHRVPLPTR |
Ga0187889_101253801 | 3300018023 | Peatland | PTQPQVWCTPQGNIELMPKKEILEFKSALRLEQVGHNRPKQMEHRNHRVG |
Ga0187855_100815933 | 3300018038 | Peatland | GCTPQGNIELMPKKEMLKIKSVPRLEQVGDKRPKQMDHRNHRVG |
Ga0184619_104901672 | 3300018061 | Groundwater Sediment | MARCTPQGNIELVPEKEVLDIKLAPRLEQVGDKRPKQMEDRKHRIG |
Ga0173482_105559642 | 3300019361 | Soil | MPQGNIELMPKKKVLDFKPARALEQVGNEGPKQMEDGKHRVK |
Ga0210407_104889591 | 3300020579 | Soil | MRCTSKSDIQLMPKEDILDFKPVWRLAQSGDKRRKQMEDGKHRAA |
Ga0126371_101647082 | 3300021560 | Tropical Forest Soil | MVRYTPQGNIDLMPEKEVLDFKLTPRPEQVGDERPEQLEDREHRTG |
Ga0126371_104297062 | 3300021560 | Tropical Forest Soil | MVRYTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEQLEDRKHRTG |
Ga0212123_102927712 | 3300022557 | Iron-Sulfur Acid Spring | VGCTPQGNIKLMPKKEILEFKWALRLEQVGDKRPKQMEHGNHRVG |
Ga0209109_100631422 | 3300025160 | Soil | VRCTPQGNIELMPKKKVLDFKPARGLEQVGNEGPKQMEDGKHRVK |
Ga0209751_110198921 | 3300025327 | Soil | VRCTPQGNIELMPKKKVLDFKPARGLEQVGNEGPKQMEDGKQRVT |
Ga0207663_104762491 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PQTVWCTPQGNIELMPKKEVLDFKPAPRPEQVDDKCSKQKKDRKHRLAGMR |
Ga0209647_11474672 | 3300026319 | Grasslands Soil | VRRTPQSNIELMPEKEVLDFKPAPRPEWVGDKRPKQLKEPKHRAG |
Ga0208365_10084822 | 3300027070 | Forest Soil | MRRTSKGNIQLMPKKEILDFKPVWRLAQSGDKRRKQMEDGKHRGA |
Ga0209799_10600091 | 3300027654 | Tropical Forest Soil | IELMPEKEVLDFKPTPRPEQVGDERPEQLEDRKHRTG |
Ga0209465_100415451 | 3300027874 | Tropical Forest Soil | YTPQGNIELMPEKEVLDFKLTPRPEQVGDERPEPLEDRQHRTG |
Ga0209382_107247791 | 3300027909 | Populus Rhizosphere | MPQGNIELMPKKEILDFKPAPRLEQVGDKRSKQMAHGKHRGG |
Ga0209698_104936911 | 3300027911 | Watersheds | MQPEAGCTPQCNIELMPKKEILHFQLASRPEQVGDKRPKQMDNGEHRGG |
Ga0307316_100383813 | 3300028755 | Soil | VRCTPQGNIELMSKKKVLDFKPAPRLEQIDDKRPKQMEDR |
Ga0307302_100303812 | 3300028814 | Soil | MARCTPQGNIELVPEKEVLDFKLAPRLEQVGDKRPKQLKDCKHRAA |
Ga0307286_101344422 | 3300028876 | Soil | VRCTPQGNIELMSKKKVLDFKPAPRLEQIDDKRPKQMEGRK |
Ga0170823_130585752 | 3300031128 | Forest Soil | WCTPQGDTELMSQEQILNFKPVSRREQVGDKRRKQMKDRKHHVE |
Ga0307497_100259181 | 3300031226 | Soil | MQPQTVQGTPQGNIELMTQKEVLDFKLAPRLERGGDECPKQMKDGKHRV |
Ga0318516_108129881 | 3300031543 | Soil | CTPQSNIELMPKEEILDFKPAPRLEQVGDRCSKQMEDGKHRVE |
Ga0307436_10119853 | 3300031563 | Salt Marsh | MRRAPQGNIELMPEKQVLDFYPAPGAERVGDKHHKQMAERKHHVG |
Ga0318501_103591641 | 3300031736 | Soil | IELVPKKKVLDFKLPPRLEQAGNQRSEQMEDGKHHAG |
Ga0307473_101517321 | 3300031820 | Hardwood Forest Soil | TMRCTPQGNIELMPEKEVLDFKPAPRPEQVGDERPEQLEDR |
Ga0307473_101632502 | 3300031820 | Hardwood Forest Soil | AKLQTVRCTPQGNIELMPEKEVLDFKPAPRPEKVSDKRPKQLEYRKHHAA |
Ga0310912_100434985 | 3300031941 | Soil | SNIELMAKEEDLDFKPAPRLEQVGDGCSKQMEDGKHRVE |
Ga0311301_123837411 | 3300032160 | Peatlands Soil | APQSNIELMSKKEILEFKSAPRLEQVGNNRPKQMEHRNHRVG |
Ga0307472_1020231091 | 3300032205 | Hardwood Forest Soil | GAVHPPGNIEVMPEKEVLDFKPAPRPELVGDNRHKQQEDRKYRAG |
Ga0310914_100710905 | 3300033289 | Soil | MRRAPQSNIELMAEKEILDFKPAPRPEEVNDKPSKQLKGCEHRVG |
⦗Top⦘ |