NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070408

Metagenome / Metatranscriptome Family F070408

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070408
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 59 residues
Representative Sequence MRRVLDVGLILGFLAVDFLFFHDIFKAGEVTTLPQYMTGFLSILVFAICSQSLLKSERY
Number of Associated Samples 104
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 20.33 %
% of genes near scaffold ends (potentially truncated) 28.46 %
% of genes from short scaffolds (< 2000 bps) 86.18 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.740 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.073 % of family members)
Environment Ontology (ENVO) Unclassified
(15.447 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.846 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.87%    β-sheet: 0.00%    Coil/Unstructured: 47.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF01569PAP2 3.25
PF13207AAA_17 3.25
PF13238AAA_18 3.25
PF00583Acetyltransf_1 2.44
PF00903Glyoxalase 2.44
PF03640Lipoprotein_15 2.44
PF04203Sortase 2.44
PF08241Methyltransf_11 2.44
PF07883Cupin_2 2.44
PF00248Aldo_ket_red 1.63
PF01243Putative_PNPOx 1.63
PF08818DUF1801 1.63
PF00106adh_short 0.81
PF02635DrsE 0.81
PF03795YCII 0.81
PF02909TetR_C_1 0.81
PF14464Prok-JAB 0.81
PF07228SpoIIE 0.81
PF00440TetR_N 0.81
PF04024PspC 0.81
PF13545HTH_Crp_2 0.81
PF13302Acetyltransf_3 0.81
PF05050Methyltransf_21 0.81
PF00392GntR 0.81
PF09335SNARE_assoc 0.81
PF13521AAA_28 0.81
PF03176MMPL 0.81
PF04932Wzy_C 0.81
PF00672HAMP 0.81
PF01638HxlR 0.81
PF07676PD40 0.81
PF06689zf-C4_ClpX 0.81
PF13683rve_3 0.81
PF00999Na_H_Exchanger 0.81
PF01709Transcrip_reg 0.81
PF00753Lactamase_B 0.81
PF02773S-AdoMet_synt_C 0.81
PF14310Fn3-like 0.81
PF10604Polyketide_cyc2 0.81
PF04185Phosphoesterase 0.81
PF09954DUF2188 0.81
PF00565SNase 0.81
PF10041DUF2277 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 2.44
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 2.44
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 1.63
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 1.63
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 1.63
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.81
COG0192S-adenosylmethionine synthetaseCoenzyme transport and metabolism [H] 0.81
COG0217Transcriptional and/or translational regulatory protein YebC/TACO1Translation, ribosomal structure and biogenesis [J] 0.81
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.81
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.81
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.81
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.81
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.81
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.81
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.81
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.81
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.81
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.81
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.81
COG3307O-antigen ligaseCell wall/membrane/envelope biogenesis [M] 0.81
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.81
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.55 %
UnclassifiedrootN/A15.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309004|prs_FHA1B5K04X56KOAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli512Open in IMG/M
2170459003|FZ032L002HLDOYAll Organisms → cellular organisms → Bacteria524Open in IMG/M
2170459010|GIO7OMY01CC82BAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli505Open in IMG/M
2170459013|GO6OHWN02JPAQYNot Available505Open in IMG/M
3300001538|A10PFW1_11888943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli648Open in IMG/M
3300002568|C688J35102_119411485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli690Open in IMG/M
3300002568|C688J35102_120852357All Organisms → cellular organisms → Bacteria1825Open in IMG/M
3300004156|Ga0062589_100882805All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300004156|Ga0062589_101918260Not Available598Open in IMG/M
3300004479|Ga0062595_101784346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli584Open in IMG/M
3300004643|Ga0062591_101478162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300005260|Ga0074072_1051488All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300005336|Ga0070680_101354084Not Available616Open in IMG/M
3300005344|Ga0070661_101369394Not Available595Open in IMG/M
3300005355|Ga0070671_100834760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli803Open in IMG/M
3300005367|Ga0070667_100401911All Organisms → Viruses → Predicted Viral1247Open in IMG/M
3300005434|Ga0070709_10155512All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300005436|Ga0070713_100798250All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300005437|Ga0070710_10204468All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300005445|Ga0070708_101017962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300005451|Ga0066681_10863260All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005468|Ga0070707_101598295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium619Open in IMG/M
3300005526|Ga0073909_10518857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300005529|Ga0070741_10017903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia11565Open in IMG/M
3300005529|Ga0070741_10226081All Organisms → cellular organisms → Bacteria1801Open in IMG/M
3300005532|Ga0070739_10468593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300005534|Ga0070735_10117194All Organisms → cellular organisms → Bacteria1667Open in IMG/M
3300005536|Ga0070697_100163104All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300005538|Ga0070731_10029366All Organisms → cellular organisms → Bacteria3731Open in IMG/M
3300005538|Ga0070731_10613941Not Available723Open in IMG/M
3300005568|Ga0066703_10733300Not Available567Open in IMG/M
3300005587|Ga0066654_10535415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli644Open in IMG/M
3300005764|Ga0066903_100259076All Organisms → cellular organisms → Bacteria2696Open in IMG/M
3300005764|Ga0066903_100263910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2676Open in IMG/M
3300005764|Ga0066903_100367503Not Available2340Open in IMG/M
3300005764|Ga0066903_101150354All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300005764|Ga0066903_103162275All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300005891|Ga0075283_1100539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli541Open in IMG/M
3300006028|Ga0070717_10020286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5223Open in IMG/M
3300006041|Ga0075023_100339358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli632Open in IMG/M
3300006059|Ga0075017_100012632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5389Open in IMG/M
3300006175|Ga0070712_100287477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1326Open in IMG/M
3300006175|Ga0070712_100380738All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300006175|Ga0070712_101155886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli673Open in IMG/M
3300006579|Ga0074054_12130644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli787Open in IMG/M
3300006755|Ga0079222_10504614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli887Open in IMG/M
3300009177|Ga0105248_11097783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium899Open in IMG/M
3300010147|Ga0126319_1584091Not Available527Open in IMG/M
3300010154|Ga0127503_10205843Not Available1151Open in IMG/M
3300010358|Ga0126370_12002954Not Available566Open in IMG/M
3300010376|Ga0126381_100220885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2547Open in IMG/M
3300010376|Ga0126381_103051336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli664Open in IMG/M
3300012014|Ga0120159_1214450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha508Open in IMG/M
3300012212|Ga0150985_102251320All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300012469|Ga0150984_100049015All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300012951|Ga0164300_10258605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria888Open in IMG/M
3300012955|Ga0164298_10385616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria900Open in IMG/M
3300012957|Ga0164303_10663981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli697Open in IMG/M
3300012958|Ga0164299_10357379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli922Open in IMG/M
3300012958|Ga0164299_10961423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli626Open in IMG/M
3300012960|Ga0164301_10183727All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300012960|Ga0164301_10340972All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300012961|Ga0164302_10017915All Organisms → cellular organisms → Bacteria2993Open in IMG/M
3300012961|Ga0164302_11089557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli630Open in IMG/M
3300012984|Ga0164309_10752545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli779Open in IMG/M
3300012984|Ga0164309_11517753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli573Open in IMG/M
3300012984|Ga0164309_11882033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli513Open in IMG/M
3300012985|Ga0164308_10875787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli789Open in IMG/M
3300012987|Ga0164307_10842583Not Available732Open in IMG/M
3300012988|Ga0164306_10815106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli753Open in IMG/M
3300013307|Ga0157372_13122945Not Available529Open in IMG/M
3300014166|Ga0134079_10248354All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300014325|Ga0163163_11580519Not Available717Open in IMG/M
3300014838|Ga0182030_10000056All Organisms → cellular organisms → Bacteria155743Open in IMG/M
3300014969|Ga0157376_11643280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli677Open in IMG/M
3300015371|Ga0132258_10554963Not Available2879Open in IMG/M
3300015371|Ga0132258_13438607All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300016270|Ga0182036_10209402Not Available1435Open in IMG/M
3300017937|Ga0187809_10123159Not Available882Open in IMG/M
3300017937|Ga0187809_10439899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli503Open in IMG/M
3300017947|Ga0187785_10029176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1992Open in IMG/M
3300017955|Ga0187817_10583242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli713Open in IMG/M
3300018433|Ga0066667_10644774All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria885Open in IMG/M
3300018468|Ga0066662_10147434All Organisms → cellular organisms → Bacteria1773Open in IMG/M
3300019875|Ga0193701_1019852All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300019887|Ga0193729_1043876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1839Open in IMG/M
3300022467|Ga0224712_10093754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli1262Open in IMG/M
3300022756|Ga0222622_10007709All Organisms → cellular organisms → Bacteria4974Open in IMG/M
3300024286|Ga0247687_1004835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1688Open in IMG/M
3300025625|Ga0208219_1005700All Organisms → cellular organisms → Bacteria → Terrabacteria group4258Open in IMG/M
3300025898|Ga0207692_10124541All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300025905|Ga0207685_10016068All Organisms → cellular organisms → Bacteria2386Open in IMG/M
3300025906|Ga0207699_10079894All Organisms → cellular organisms → Bacteria2025Open in IMG/M
3300025915|Ga0207693_11133056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300025922|Ga0207646_10982926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria746Open in IMG/M
3300025931|Ga0207644_10756107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli812Open in IMG/M
3300025986|Ga0207658_10136068All Organisms → cellular organisms → Bacteria1981Open in IMG/M
3300026475|Ga0257147_1065954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli551Open in IMG/M
3300027869|Ga0209579_10766698Not Available521Open in IMG/M
3300027986|Ga0209168_10261676All Organisms → cellular organisms → Bacteria → Terrabacteria group855Open in IMG/M
3300028754|Ga0307297_10128452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli853Open in IMG/M
3300028800|Ga0265338_10009805All Organisms → cellular organisms → Bacteria11355Open in IMG/M
3300028876|Ga0307286_10082324Not Available1118Open in IMG/M
3300031057|Ga0170834_106807193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli744Open in IMG/M
3300031421|Ga0308194_10171609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium sullae683Open in IMG/M
3300031543|Ga0318516_10334525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14874Open in IMG/M
3300031543|Ga0318516_10377464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli817Open in IMG/M
3300031564|Ga0318573_10691211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14548Open in IMG/M
3300031715|Ga0307476_10087501All Organisms → cellular organisms → Bacteria2183Open in IMG/M
3300031716|Ga0310813_12292204Not Available512Open in IMG/M
3300031777|Ga0318543_10346391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300031778|Ga0318498_10250929All Organisms → cellular organisms → Bacteria → Terrabacteria group798Open in IMG/M
3300031779|Ga0318566_10639934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli517Open in IMG/M
3300031795|Ga0318557_10309298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli725Open in IMG/M
3300031880|Ga0318544_10406615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14529Open in IMG/M
3300031890|Ga0306925_12089954All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300031938|Ga0308175_100661513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter silvisoli1130Open in IMG/M
3300031996|Ga0308176_11673419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Halobacillus → unclassified Halobacillus → Halobacillus sp. A5679Open in IMG/M
3300032059|Ga0318533_10294474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1177Open in IMG/M
3300032090|Ga0318518_10110257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1380Open in IMG/M
3300032261|Ga0306920_103537349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300033803|Ga0314862_0162813All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300033805|Ga0314864_0079466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Nitrolancea → Nitrolancea hollandica781Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.07%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere12.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil7.32%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.25%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.25%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.44%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.44%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.63%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.63%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.63%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.63%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.81%
Green-Waste CompostEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost0.81%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.81%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309004Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto RicoEnvironmentalOpen in IMG/M
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2170459013Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cmEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005260Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, AustraliaEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024286Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
prs_003914402070309004Green-Waste CompostVDVGLIVGFLAVDFFFFHDIFKAGEVTTLPQYMTGFLSIVVFAICCQS
E4A_097548602170459003Grass SoilLIVGFLAVDFLFFHDIFKAGEVTTLPQYMTGFLSIAVFATCSQSLLKSSR
F62_010126102170459010Grass SoilMRRALEFALIVGFLAVDFLFFHDIFKAGEVTTVPQYMTGFLSIAVFALCSQSLLKLRR
N57_090743802170459013Grass SoilMRRGVDVCLIVGFLAVDFLFFHDIFKAGEVTTPPEYMAGFLSILVFAICGQSLLRSARP
A10PFW1_1188894313300001538PermafrostMKKIIAITLIVGFLAVDFLFFHDMLKPGEVTTVPQYLTGILSILVFALCLQSLLKDRKHIKLRYKHFAILN
C688J35102_11941148523300002568SoilEHGTPSGSATIQTMRRVLDLGLIVGFLAVDFLFFHDIFKAGEVTTMPQYMTGLLSIVVFAVCSQSLLSARL*
C688J35102_12085235723300002568SoilMRRGLDLSLIVGFLAVDFLFFHDALKAGEVITVPQYMTGFLSIAVFAMCSQSLLKLHR*
Ga0062589_10088280513300004156SoilMRRVLDVGLILGFLAVDFLFFHDIFKAGEITTLPQYMTGFLSILVFAICSQSLLKSERY*
Ga0062589_10191826023300004156SoilMRRVMDIGLIVGFLAVDFLFFHDIFKTGEVTTVPQYMTGLLSVLVFAMCSESLLKSARR*
Ga0062595_10178434623300004479SoilLIVGFLAVDFLFFHDIFKPGEVTTMPQYMTGLLSVLVFAMCSESLLKSARR*
Ga0062591_10147816223300004643SoilMRRVLDVGLILGFLAVDFLFFHDIFKAGEVTTLPQYMTGFLSILVFAICSQSLLKSERY*
Ga0074072_105148823300005260SoilMRRATDICLILGFLAVDFLFFHDLLKSGEHTTAPQYMTGLLSIAVFAICSRSLLTSVRL*
Ga0070680_10135408413300005336Corn RhizosphereESCRGVIYNRAMRRVMDIGLIVGFLAVDFLFFHDIFKTGEVTTVPQYMTGLLSVLVFAMCSESLLKSARR*
Ga0070661_10136939413300005344Corn RhizosphereMDIGLIVGFLAVDFLFFHDIFKTGEVTTVPQYMTGLLSVLVFAMCSESLLKSARR*
Ga0070671_10083476023300005355Switchgrass RhizosphereMRRAVDVLLIVGFLAVDFLFFHDLFKPGEATTPAQYMTGLLSILVIAVCGQSLLKSTRR*
Ga0070667_10040191123300005367Switchgrass RhizosphereMRRVLDVGLIVGFLAVDFLFFHDIFKTGEVTTLPQYLTGFLSILVFASCSQSLLTSRRH*
Ga0070709_1015551223300005434Corn, Switchgrass And Miscanthus RhizosphereMRRVLDVGLILVFLGVDFLFFHDIFKAGEATTLPQYTTGSLSILVFAICSQSLLKSERY*
Ga0070713_10079825013300005436Corn, Switchgrass And Miscanthus RhizosphereMRRVLDVGLILGFLAVDFLFFHDIFKAGEATTLPQYMTGFLSILVFAICSQSLLK
Ga0070710_1020446823300005437Corn, Switchgrass And Miscanthus RhizosphereMRRVLDVGLILGFLAVDFLFFHDIFKAGEATTLPQYTTGFLSILVFAICSQSLLKSERY*
Ga0070708_10101796223300005445Corn, Switchgrass And Miscanthus RhizosphereMRRVLDAGLILGFLAVDFLFFHDIFKAGEVTTLPQYMTGFLSILVFAICSQSLLKSERY*
Ga0066681_1086326023300005451SoilMSTLAEAEANAPSGYDQRMRRALDVALIGGFLVVDFFFFHDIFKAREVPSVPQYMTGVLSIVVFAMCCQSLLKSLR*
Ga0070707_10159829523300005468Corn, Switchgrass And Miscanthus RhizosphereMRRALDVGLIVGFLAVDFLFFHDVMKAREVTSLPQYMTGLLSIAVLAICGQSLLKSVRH*
Ga0073909_1051885713300005526Surface SoilMRRALDVALIVGFLAVDFLFFHDLFKPGESTSLPQYMTGFLSLAVFAICSQSLLKSGHR*
Ga0070741_1001790333300005529Surface SoilMRRVADAVLIVGFLTVDLFFFHDIFKAGEVTTLPQYMTGFLSLLVFAICGRSLLGSVNPRS*
Ga0070741_1022608143300005529Surface SoilMRRGLDVALIVGFLAVDFLFFHDIFKAGEVTTIPQYMTGFLSIAVFALCSQSLLKLRR*
Ga0070739_1046859323300005532Surface SoilMRRALDVGLILGFLAVDFLFFHDVLKPGEVTTLPQCMTGFLSVAVLAVCGQSLLKSA
Ga0070735_1011719423300005534Surface SoilMRRLVDITLIAGFLLVDLFFFHDIFKPGESTSLAQWMTGFLSIGVFAICAQSLLKPAR*
Ga0070697_10016310433300005536Corn, Switchgrass And Miscanthus RhizosphereMRRVLDVGLILGFLGVDLLFFHDIFKAGEATTLPQYTTGFLSILVFAICSQSLLKSERY*
Ga0070731_1002936623300005538Surface SoilMRRVLDVTLIAGFLLVDLFFFHDLFKPGESTSLPQWMTGFLSIGVFAVCGQSLLQAARRTLGFSRP*
Ga0070731_1061394113300005538Surface SoilMRRTLDVLLIVGFLAVDLMFFHDIFKPGESTSLPQYMTGFLSILVFAICTQ
Ga0066703_1073330023300005568SoilMRRALDVALIVGFLAVDFLFFHDIFKAGEVTTVPQYMTGFLSIAVFVLCSQSLLKLRR*
Ga0066654_1053541533300005587SoilMLAYNRAMRRTLAVVLIVGFLAVDFLFFHDLLKPGEVTTLPQYMTGFLSILVFAACAQSLLKSGR*
Ga0066903_10025907623300005764Tropical Forest SoilMRRVLDVALIAGFLAVDFFFFHDIFKAGEVTSLPQYMTGVLSLAVFAICAQSLLKSSH*
Ga0066903_10026391053300005764Tropical Forest SoilMRRVLDVALIAGFLAVDFFFFHDIFKAGEVTSLPQYMTGVLSLAVFAICAQSLLKSSC*
Ga0066903_10036750313300005764Tropical Forest SoilSAGALTYNRAMRRVLDVGLIVGFLTVDFFFFHDIFKAGEVTTVPQYMTGFLSILVFAICSASLLKSARH*
Ga0066903_10115035433300005764Tropical Forest SoilMRRALDVGLIGGFLAVDFLFFHDVLKAGEVTTLPQYMTGLLSIAVLTICGQSLLKSIRH*
Ga0066903_10316227523300005764Tropical Forest SoilMRRALNIGLIAGFLAVDFLFFHDILKAGEVTTLPQYMTGFLSIAVVAICGQSLLRAARR*
Ga0075283_110053923300005891Rice Paddy SoilMRRLLDAGLIVGFLAVDFLFFHDIFKAGEVTTLPQYMTGALSIVVFAVCSQSLLNLHR*
Ga0070717_1002028623300006028Corn, Switchgrass And Miscanthus RhizosphereMRRTLDLSLILGFLAVDFLFFHDLLKPGEVTTLPQYMTGFLSVIVFAVCAQSLLAQRG*
Ga0075023_10033935823300006041WatershedsMRRVLDVGLIVGFLAVDFLFFHDIFKAGEATTLPQYMTGFLSILVFAICTQSLLKSGRH*
Ga0075017_10001263273300006059WatershedsMRRVVDVGLIVGFLAVDFLFFHDILKAGEATTVPQYMTGLLSILVFAVCGQSLLRSGHR*
Ga0070712_10028747733300006175Corn, Switchgrass And Miscanthus RhizosphereAMRRVLDVALIVGFLAVDFFFFHDILKAGEVTTAPQYMTGFLSILVFAICSQSLLTKRR*
Ga0070712_10038073823300006175Corn, Switchgrass And Miscanthus RhizosphereMRRVLDVGLILGFLAVDFLFFHDIFKAREVTTLPQYMTGFLSILVFAICSQSLLKSERY*
Ga0070712_10115588633300006175Corn, Switchgrass And Miscanthus RhizosphereMRRVLDAGLIFGFLAVDFLFFHDLFKAGEVTTLPQYMTGFLSILVFVICGQSLLTQAR*
Ga0074054_1213064423300006579SoilMRRVLDVGLILGFLAVDFLFFHDIFKAGEVTTLPQYVTGFLSILVFAICSQSLLKSGRY*
Ga0079222_1050461433300006755Agricultural SoilVLIAGFLAVDFLFFHDLLKPGEVTTPPQYMTGFLSILVFAVCAQSLLKPKR*
Ga0105248_1109778313300009177Switchgrass RhizosphereMRRAIEVFLILGFLAVDFLFFHDILKPGDAPTPAQYMTGVLSIFVIAICAQSLLTPTRR*
Ga0126319_158409113300010147SoilMRRVLDVGLIVGFLAVDFFFFHDIFKAGEVTTVPQYMTGVLSVFVFAICGKSLLESGHHRARHASLTD*
Ga0127503_1020584323300010154SoilMRRALDISLILGFLAVDFLFFHDLLKAGEVTTIPQYMTGMLSILVFAICGQSLLTQRR*
Ga0126370_1200295413300010358Tropical Forest SoilMRRVLDVGLIVGFLTVDFFFFHDIFKAGEVTTVPQYMTGFLSILVFAICSASLLKSARH*
Ga0126381_10022088523300010376Tropical Forest SoilMRRALDLGLIVGFLAVDFLFFHDLFKPGEVTTLPQYMTGLLSVAVLAICGQSLLKSVSR*
Ga0126381_10305133623300010376Tropical Forest SoilMRRTLDVGLILGFLAVDFLFFHDILKAGEVTTLPQYMTGLLSIAVLAICGQSLLKSVRQ*
Ga0120159_121445023300012014PermafrostGLIYNQAMRRVLDVGLIVGFLAVDFLFFHDILKAGEVTTLPQYMTGFLSVLVFAICSQSLLMSGRH*
Ga0150985_10225132013300012212Avena Fatua RhizosphereGLDLSLIVGFLAVDFLFFHDALKAGEVITIPQYLTGFLSIAVFAMCSQSLLKLHR*
Ga0150984_10004901513300012469Avena Fatua RhizosphereGFLAVDFLFFHDALKAGEVITVPQYMTGFLSIAVFAMCSQSLLKLHR*
Ga0164300_1025860523300012951SoilMRRVLDGGLILGFLAVDFLFFHDIFKAGEVTTLPQYMTGFLSFLVFAICSQSLLKSERY*
Ga0164298_1038561623300012955SoilMRRVLDIGLIVGFLAVDFLFFHDILKTGEVTTVPQYMTGVLSLLVFAMCSESLLKSARHAG*
Ga0164303_1066398113300012957SoilMRRILDIGLIVGFLAVDFLFFHDILKTGEVTTVPQYMTGVLSLLVFAMCSESLLKSARHAG*
Ga0164299_1035737923300012958SoilGAMRRALDVALIVGFLAVDFLFFHDLFKPGESTSLTQYMTGFLSLAVFAICSQSLLKSGHR*
Ga0164299_1096142313300012958SoilMRRVLDVGLILGFLAVDFFFFHDIFKAGEVTTLPQYMTGFLSILVFAICSQSLLKSERY*
Ga0164301_1018372713300012960SoilMRRVLDVGLILGFLAVDFLFFHDIFKVGEVTTLPQYMTVFLSILVFAICSQSLLKSERY
Ga0164301_1034097223300012960SoilMRRLLDVGLILGFLAVDFLFFHDIFKAGEVTTLPQYVTGFLSILVFAICSQSLLKSGRY*
Ga0164302_1001791533300012961SoilMRRVLDVGLILGFLAVDFLFFHDIFKAGEVTTLPQYMTGFLSILVFAICSRSLLKSERY*
Ga0164302_1108955723300012961SoilMRRALDVALIVGFLAVDFLFFHDLFKPGESTSLTQYMTGFLSLAVFAICSQSLLKSGHR*
Ga0164309_1075254513300012984SoilMRRAIEVFLVVGFLAVDFLFFHDILKPGEAPTPAQYLTGLLSLFVIAICAQSLLTPTRR*
Ga0164309_1151775313300012984SoilLIYNRAMRRVLDVGLILGFLAVDFLFFHDIFKAGEVTTLPQYVTGFLSILVFAICSQSLLKSGRY*
Ga0164309_1188203323300012984SoilMRRAIDVFLIVGFLAVDFLFFHDLFKPGEVTTPAQYMTGLLSVVVIAVCGQSLLKS
Ga0164308_1087578723300012985SoilMRRAIDVFLIVGFLAVDFLFFHDLFKPGEVTTPAQYMTGLLSVVVIAVCGQSLLKSTQH*
Ga0164307_1084258323300012987SoilMRRILDIGLIVGFLAVDFLFFHDIFKTGEVTTVPQYMTGVLSLLVFAMCSESLLKSARR*
Ga0164306_1081510623300012988SoilMRRAIEVFLVVGFLAVDFLFFHDILKPGEAPTPAQYLTGLLSLFVIAICAQSLLNPTRR*
Ga0157372_1312294523300013307Corn RhizosphereMRRVLDVGVIVGFLAVDFLFFHDIFKTGEVTTVPQYMTGLLSVLVFAMCSESLLKSARR*
Ga0134079_1024835423300014166Grasslands SoilMSTLAEAEANAPSGYDQRMRRALDVALIGGFLVVDFFFFHDIFKAREVPSVPQYMTGVLSIVVFAMCCQSRLKSLR*
Ga0163163_1158051923300014325Switchgrass RhizosphereMRRAVDVLLIVGFLAVDFLFFHDLFKPGEATTPAQYMTGFLSILVIAVCGQSLLKSTRR*
Ga0182030_10000056733300014838BogMRKTIDVLLIVGFLLVDLFFFHDLFKVGEVTTLPQYMTGILSIFVIIRSTQSLLDL*
Ga0157376_1164328013300014969Miscanthus RhizosphereLDVALIVGFLAVDFLFFHDLFKPGESTSLPQYMTGFLSLAVFAICSQSLLKSGHR*
Ga0132258_1055496333300015371Arabidopsis RhizosphereMDVLLIVGFLAVDFLFFHDAFKVGEVTTPAQYMTGFLSILVIAICVQSLLKSTRH*
Ga0132258_1343860723300015371Arabidopsis RhizosphereMRRVLDIGLIVGFLAVDFLFFHDIFKTGEVTTVPQYMTGVLSLLVFAMCSESLLKSAHHAG*
Ga0182036_1020940223300016270SoilSRRLAYNRAMRRALDVTLIMGFLAVEFLFFHDLFKTGEVTTLPQYMTGLLSVLVVAICAVSLRKSARH
Ga0187809_1012315913300017937Freshwater SedimentMRRLVDITLIAGFLLVDLFFFHDVLKPGESTSLAQWMTGFLSVGVFAICAQSLLKSAR
Ga0187809_1043989913300017937Freshwater SedimentMRRTLDAALILGFLAVDFLFFHDLLKAGEVTTVPQYMTGVLSIFVFAICGQSLLTQQR
Ga0187785_1002917623300017947Tropical PeatlandMRRTLDIGLIVGFLAVDFLFFHDVLKAGEVTTLPQYMTGVLSILVFAICSQSLLRSVRR
Ga0187817_1058324213300017955Freshwater SedimentMRKMLDIILILGFLVVDFLFFHDIFKAGEVTTLPQYLTGFLSIIVFIIAGQSLFNRTTHN
Ga0066667_1064477423300018433Grasslands SoilMRPVLDVGLIVGFLAVDFLFFHDLLKAGEVTTVPQYLTGFLSIAVFAICSQSLLTARR
Ga0066662_1014743433300018468Grasslands SoilMRRALDVALIVGFLAVDFLFFHDIFKAGEVTTVPQYMTGFLSIAVFVLCSQSLLKLRR
Ga0193701_101985223300019875SoilMDRTTIQGMRRVVDVGLIVGFLAVDFFFFHDILKAGEVTTLPQYMTGFLSIVVFAICSQSLLKSGR
Ga0193729_104387643300019887SoilMKRVLDVGLILGFLAVDFLFFHDIFKAGEVTTLPQYVTGFLSILVFAICSQSLLKSGRY
Ga0224712_1009375433300022467Corn, Switchgrass And Miscanthus RhizosphereMRRVLDAGLIFGFLAVDFLFFHDLFKAGEVTTLPQYMTGFLSILVFVICGQSLLTQAR
Ga0222622_1000770953300022756Groundwater SedimentVDVGLIVGFLAVDFFFFHDILKAGEVTTLPQYMTGFLSIVVFAICSQSLLKSGR
Ga0247687_100483553300024286SoilSGMRRVLDAGLIFGFLAVDFLFFHDLFKAGEVTTLPQYMTGFLSILVFVICGQSLLTQAR
Ga0208219_100570033300025625Arctic Peat SoilMGRATIQGMRRGVDVALIVGFLAVDLFFFHDIFKAGESTSLPQYMTGFLSIAVFAICIQSLVKSGR
Ga0207692_1012454133300025898Corn, Switchgrass And Miscanthus RhizosphereMRRVLDVGLILGFLAVDFLFFHDIFKAGEATTLPQYTTGFLSILVFAICSQSLLKSERY
Ga0207685_1001606853300025905Corn, Switchgrass And Miscanthus RhizosphereMRRVLDVGLILGFLGVDLLFFHDIFKAGEATTLPQYTTGFLSILVFAICSQSLLKSERY
Ga0207699_1007989423300025906Corn, Switchgrass And Miscanthus RhizosphereMRRVLDVGLILGFLAVDFLFFHDIFKAGEATTLPQYTTGSLSILVFAICSQSLLKSERY
Ga0207693_1113305613300025915Corn, Switchgrass And Miscanthus RhizosphereYNQAMRRVLDVALIVGFLAVDFFFFHDILKAGEVTTAPQYMTGFLSILVFAICSQSLLTKRR
Ga0207646_1098292623300025922Corn, Switchgrass And Miscanthus RhizosphereMRRALDVGLIVGFLAVDFLFFHDVMKAREVTSLPQYMTGLLSIAVLAICGQSLLKSVRH
Ga0207644_1075610733300025931Switchgrass RhizosphereMRRAVDVLLIVGFLAVDFLFFHDLFKPGEATTPAQYMTGLLSILVIAVCGQSLLKSTRR
Ga0207658_1013606823300025986Switchgrass RhizosphereMRRVLDVGLIVGFLAVDFLFFHDIFKTGEVTTLPQYLTGFLSILVFASCSQSLLTSRRH
Ga0257147_106595413300026475SoilSLILGFLAVDFLFFHDLLKAGEVTTIPQYMTGMLSILVFAICGQSLLTQHR
Ga0209579_1076669823300027869Surface SoilMRRTLDVLLIVGFLAVDLMFFHDIFKPGESTSLPQYMTGFLSILVFAICTQSLL
Ga0209168_1026167623300027986Surface SoilMRRLVDITLIAGFLLVDLFFFHDIFKPGESTSLAQWMTGFLSIGVFAICAQSLLKPAR
Ga0307297_1012845223300028754SoilMRRAIEVFLVVVFLAVDFLFFHDILKPGEAPTPAQYLTGLLSLFVIAICAQSLLNPTRR
Ga0265338_1000980573300028800RhizosphereMKKVVSMVLVLGFLVVDFLFFHDLFKAGEVTSFAQKLTGILSILVFVVCVQSVLESETAK
Ga0307286_1008232413300028876SoilVDVGLIVGFLAVDFFFFHDILKAGEVTTLPQYMTGFLSIVVFTICSQSLLKSGR
Ga0170834_10680719323300031057Forest SoilMRRALDISLILGFLAVDFLFFHDLLKAGEVTTIPQYMTGMLSILVFAICGQSLLIQRR
Ga0308194_1017160913300031421SoilVDVGLIVGFLAVDFFFFHDNLKAGEVTTLPQYMTGFLSIVVFAICSQSLLKSGR
Ga0318516_1033452523300031543SoilMRRALDVALITGFLVVDFLFFHDLFKPGEVTTLPQYATGLLSILVFAICAQSLLKSGRH
Ga0318516_1037746423300031543SoilMRRALDVTLIMGFLAVEFLFFHDLFKTGEVTTLPQYMTGLLSVLVVAICAVSLRKSARH
Ga0318573_1069121123300031564SoilMRRALDVALITGFLVVDFLFFHDLFKPGEVTTPPQYATGLLSILVFAICAQSLLKSGRH
Ga0307476_1008750113300031715Hardwood Forest SoilVMRRLVDITLIAGFLLVDLFFFHDVLKPGESTSLAQWMTGFLSVGVFAICAQSLLKSAR
Ga0310813_1229220423300031716SoilIRCCTAYNRAMRRVVDLLLIVGFLAVDFLFFHDTFKAGEVTTVPQYMTGALSIVVFAVCGQSLLSSVRR
Ga0318543_1034639123300031777SoilMRRALDVTLIMGFLAVEFLFFHDLFKTGEVTTLPQYMTGLLSVLVVAICAVSLRK
Ga0318498_1025092913300031778SoilVALITGFLVVDFLFFHDLFKPGEVTTLPQYATGLLSILVFAICAQSLLKSGRH
Ga0318566_1063993423300031779SoilRAMRRALDVTLIMGFLAVEFLFFHDLFKTGEVTTLPQYMTGLLSVLVVAICAVSLRKSAR
Ga0318557_1030929813300031795SoilALDLTLIMGFLAVEFLFFHDLFKTGEVTTLPQYMTGLLSVLVVAICAVSLRKSARH
Ga0318544_1040661513300031880SoilMRRALDVALITGFLVVDFLFFHDLFKTGEATTVPQYMTGALSILVFAICGHSLLKSSGP
Ga0306925_1208995413300031890SoilMRRALDISLILGFLAVDFLFFHDVLKAGETTTAAQYLTGVLSLAVFAVCGQSLLRAS
Ga0308175_10066151323300031938SoilMRRAVDVFLIVGFLAVDFLFFHDLFKPGESTSLPQYMTGFLSIAVFAICCQSLLRSGTAS
Ga0308176_1167341913300031996SoilMRRGVDVALIVGFLAVDFFFFHDIFKAGEVTSLPQYMTGVLSIAVFAVCSQSLLRSAR
Ga0318533_1029447433300032059SoilMRRALDVTLIMGFLAVEFLFFHDLFKTGEVTTLPQYMTGLLSVLVVAICAVSLR
Ga0318518_1011025733300032090SoilMRRALDVTLIMGFLAVEFLFFHDLFKTGEVTTLPQYMTGLLSVLVVAICAVSL
Ga0306920_10353734923300032261SoilMRRALDISLILGFLAVDFLFFHDVLKAGETTTAAQYLTGVLSLAVFAVCGQSLLRASRS
Ga0314862_0162813_303_4793300033803PeatlandMRKVLDVVLIVGFLAVDFLFFHDLFKPGESTSLPQYMTGALSLAVFAICVPSLMKSSR
Ga0314864_0079466_365_5443300033805PeatlandMRRALDVGLIVGFLAVDFLFFHDLLKPGEVTTLPQYMTGVLSVAVLAICGRSLLRSSHR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.