


| Basic Information | |
|---|---|
| Family ID | F070080 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMVPF |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.53 % |
| % of genes near scaffold ends (potentially truncated) | 88.62 % |
| % of genes from short scaffolds (< 2000 bps) | 88.62 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.431 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.447 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.024 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.902 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 2.44 |
| PF13432 | TPR_16 | 1.63 |
| PF13385 | Laminin_G_3 | 0.81 |
| PF00069 | Pkinase | 0.81 |
| PF03948 | Ribosomal_L9_C | 0.81 |
| PF01883 | FeS_assembly_P | 0.81 |
| PF03372 | Exo_endo_phos | 0.81 |
| PF13620 | CarboxypepD_reg | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.25 |
| COG0359 | Ribosomal protein L9 | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.43 % |
| Unclassified | root | N/A | 10.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02JHPUK | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 2170459010|GIO7OMY02GRTX1 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 537 | Open in IMG/M |
| 2170459023|GZGNO2B02HJYMZ | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 525 | Open in IMG/M |
| 3300000955|JGI1027J12803_107264426 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 609 | Open in IMG/M |
| 3300000955|JGI1027J12803_108304934 | Not Available | 562 | Open in IMG/M |
| 3300000956|JGI10216J12902_113355692 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 958 | Open in IMG/M |
| 3300004157|Ga0062590_100690620 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300004463|Ga0063356_101217721 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300004479|Ga0062595_100669380 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 826 | Open in IMG/M |
| 3300004479|Ga0062595_100834959 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005167|Ga0066672_10368430 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300005167|Ga0066672_11028794 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
| 3300005171|Ga0066677_10420868 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005295|Ga0065707_10013055 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1886 | Open in IMG/M |
| 3300005331|Ga0070670_102060763 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005338|Ga0068868_102382216 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005353|Ga0070669_101010855 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005354|Ga0070675_100700365 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300005354|Ga0070675_100918485 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005455|Ga0070663_100301410 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1283 | Open in IMG/M |
| 3300005459|Ga0068867_101841005 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005467|Ga0070706_101003775 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 770 | Open in IMG/M |
| 3300005540|Ga0066697_10196899 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1197 | Open in IMG/M |
| 3300005719|Ga0068861_102541631 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006032|Ga0066696_10061870 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2139 | Open in IMG/M |
| 3300006046|Ga0066652_100375654 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1287 | Open in IMG/M |
| 3300006575|Ga0074053_10183225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 527 | Open in IMG/M |
| 3300006796|Ga0066665_10312348 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1268 | Open in IMG/M |
| 3300007255|Ga0099791_10122846 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1204 | Open in IMG/M |
| 3300007788|Ga0099795_10166479 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 913 | Open in IMG/M |
| 3300009147|Ga0114129_11351850 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 881 | Open in IMG/M |
| 3300009156|Ga0111538_10550931 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1462 | Open in IMG/M |
| 3300009157|Ga0105092_10822324 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300009176|Ga0105242_12610438 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010320|Ga0134109_10039010 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1539 | Open in IMG/M |
| 3300010360|Ga0126372_11559170 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 698 | Open in IMG/M |
| 3300010364|Ga0134066_10028129 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300010364|Ga0134066_10243763 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 619 | Open in IMG/M |
| 3300010373|Ga0134128_10349451 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300010400|Ga0134122_12734673 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012198|Ga0137364_10508895 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 905 | Open in IMG/M |
| 3300012198|Ga0137364_10916895 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 663 | Open in IMG/M |
| 3300012198|Ga0137364_11225989 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 561 | Open in IMG/M |
| 3300012199|Ga0137383_11225179 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 538 | Open in IMG/M |
| 3300012200|Ga0137382_10282164 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300012208|Ga0137376_11322878 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 611 | Open in IMG/M |
| 3300012285|Ga0137370_10064943 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1987 | Open in IMG/M |
| 3300012285|Ga0137370_10468078 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 769 | Open in IMG/M |
| 3300012285|Ga0137370_10677022 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
| 3300012360|Ga0137375_10987965 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 663 | Open in IMG/M |
| 3300012362|Ga0137361_11239321 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 669 | Open in IMG/M |
| 3300012915|Ga0157302_10180909 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012923|Ga0137359_11108894 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 677 | Open in IMG/M |
| 3300012927|Ga0137416_11900541 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 545 | Open in IMG/M |
| 3300012944|Ga0137410_11936732 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 523 | Open in IMG/M |
| 3300012976|Ga0134076_10217688 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 806 | Open in IMG/M |
| 3300012988|Ga0164306_10412935 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1017 | Open in IMG/M |
| 3300013306|Ga0163162_13142434 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300015053|Ga0137405_1409711 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4309 | Open in IMG/M |
| 3300015372|Ga0132256_101267782 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300015372|Ga0132256_101330296 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300015374|Ga0132255_102640826 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300016319|Ga0182033_12199890 | Not Available | 503 | Open in IMG/M |
| 3300017657|Ga0134074_1150274 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 814 | Open in IMG/M |
| 3300017659|Ga0134083_10526139 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300018000|Ga0184604_10030057 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1373 | Open in IMG/M |
| 3300018061|Ga0184619_10262779 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 793 | Open in IMG/M |
| 3300018071|Ga0184618_10171079 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 897 | Open in IMG/M |
| 3300018076|Ga0184609_10397894 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
| 3300019874|Ga0193744_1036713 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300019881|Ga0193707_1089262 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 934 | Open in IMG/M |
| 3300019881|Ga0193707_1102885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 851 | Open in IMG/M |
| 3300019881|Ga0193707_1106901 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300019883|Ga0193725_1053135 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300019996|Ga0193693_1010767 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1845 | Open in IMG/M |
| 3300020003|Ga0193739_1147045 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 566 | Open in IMG/M |
| 3300021344|Ga0193719_10006968 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 4679 | Open in IMG/M |
| 3300021411|Ga0193709_1129190 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 507 | Open in IMG/M |
| 3300021413|Ga0193750_1028838 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300021510|Ga0222621_1063994 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300022534|Ga0224452_1023789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1726 | Open in IMG/M |
| 3300022756|Ga0222622_10185962 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1368 | Open in IMG/M |
| 3300022756|Ga0222622_11161740 | Not Available | 568 | Open in IMG/M |
| 3300025898|Ga0207692_11021595 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300025906|Ga0207699_10542167 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300025912|Ga0207707_11409365 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
| 3300025925|Ga0207650_11273504 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300025926|Ga0207659_11484001 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 580 | Open in IMG/M |
| 3300025930|Ga0207701_10415227 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1158 | Open in IMG/M |
| 3300025930|Ga0207701_10683970 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300025937|Ga0207669_10307789 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300025939|Ga0207665_10259304 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300025939|Ga0207665_10319878 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1164 | Open in IMG/M |
| 3300025986|Ga0207658_11143679 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300026088|Ga0207641_10346918 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300026325|Ga0209152_10169366 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 822 | Open in IMG/M |
| 3300026326|Ga0209801_1195634 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 815 | Open in IMG/M |
| 3300026335|Ga0209804_1214828 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300026527|Ga0209059_1265665 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 577 | Open in IMG/M |
| 3300026532|Ga0209160_1003613 | All Organisms → cellular organisms → Bacteria | 12558 | Open in IMG/M |
| 3300026536|Ga0209058_1075835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1784 | Open in IMG/M |
| 3300026550|Ga0209474_10325775 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300027512|Ga0209179_1066567 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300027655|Ga0209388_1158631 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 638 | Open in IMG/M |
| 3300028799|Ga0307284_10418604 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 546 | Open in IMG/M |
| 3300028828|Ga0307312_10459612 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300030916|Ga0075386_12126612 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031097|Ga0308188_1015563 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300031231|Ga0170824_128461189 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 509 | Open in IMG/M |
| 3300031446|Ga0170820_12077989 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031716|Ga0310813_11801735 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 575 | Open in IMG/M |
| 3300031720|Ga0307469_11916101 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031996|Ga0308176_10877532 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.01% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.06% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.25% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.63% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_09207820 | 2170459005 | Grass Soil | MKNRNIQFKVTAGLLIPLLLACFAAVFISVSTPALARNEVPFNGTVSGYVETQ |
| F62_01790870 | 2170459010 | Grass Soil | MKNRNIQLKPTAGVLIPLLLVCFAAVFISAPTPAAARDMVPF |
| FA3_09931350 | 2170459023 | Grass Soil | MKNRNIQFKATAGVLIPLLLACSAAVFISSVTPVAARDMVPFNGTVSG |
| JGI1027J12803_1072644261 | 3300000955 | Soil | MKNPNIQFKTTAGILIPLLLACLAAVFISPPTPAAARDMVPFNGTV |
| JGI1027J12803_1083049342 | 3300000955 | Soil | VKNRNIHFKATAGLPIPLLLACFTAVFISAPIPAIAAGQVPF |
| JGI10216J12902_1133556922 | 3300000956 | Soil | MKNQNIQFKPRAGFLIPLLLVCLAAAFVSAPNTASARDQVPFNG |
| Ga0062590_1006906201 | 3300004157 | Soil | MKNRNIQFKPTAGVLMPLLLACFAAVFISAPSPAAASEMVPFNATLSGYVETSE |
| Ga0063356_1012177211 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKNRNIQFKPTAGVLMPLLLAGFAAVFISAPTPATARDMVPFNGTVS |
| Ga0063356_1029853542 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKNRNIQFKPTAGVLIPLLLACLAAVFISGPTPALARDEVPFNGTVSGYVES |
| Ga0062595_1006693802 | 3300004479 | Soil | VKNRNIQFKPTAGVLIPLLLACLAAVFISASNPVSARDQVPFNGTLGGCVDTQ |
| Ga0062595_1008349591 | 3300004479 | Soil | MKNRNIQFKPTAGLLIPLLLACFAAVFISAPNSASAGDQVPFIGTLA |
| Ga0062594_1020703741 | 3300005093 | Soil | MKNQNIQVKPTAGVLIPLLLACLAAMSISAPNPASARDQVPFNGVVAGYNNPPSGTEC |
| Ga0066672_103684301 | 3300005167 | Soil | MKNRNIQLKSSTGVLIPLLLACLAAAFISAPTRAQAGDTVPFNGTVS |
| Ga0066672_110287942 | 3300005167 | Soil | MKHRIIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMVPFNGTV |
| Ga0066677_104208682 | 3300005171 | Soil | MKNRNIQLKSSTGVLIPLLLACLAAAFISAPTRAQAGDTVPFNGTVSGYV |
| Ga0065707_100130554 | 3300005295 | Switchgrass Rhizosphere | MKNRNIQFKATAGVLVPLLLAFFAAVFISTPTPAAARDMV |
| Ga0070670_1020607632 | 3300005331 | Switchgrass Rhizosphere | MKNRNIQFKPTAGVLMPLLLACFAAVFMSIPTPAAARDLVPFKATFTGSSSS |
| Ga0068868_1023822161 | 3300005338 | Miscanthus Rhizosphere | MKNRSIQFKPTAGLLIPLLLACFAAVFVSAAAPARAGDTVPFKG |
| Ga0070669_1010108551 | 3300005353 | Switchgrass Rhizosphere | MKNRSIQFKPTAGLLIPLLLACFAAVFVSAVAPARAGDTVPFKGTLSGTIISSVPLD |
| Ga0070675_1007003652 | 3300005354 | Miscanthus Rhizosphere | MKNRSIQFKPTAGLLIPLLLACFAAVFVSAAAPARAGDTVPFKGTLSGTIISSVPLD |
| Ga0070675_1009184852 | 3300005354 | Miscanthus Rhizosphere | MKNPNSQFKPTAGLLIPLLVACFAAVFVSSATPAIAGETVPFKGVLSGSTISSVPL |
| Ga0070663_1003014102 | 3300005455 | Corn Rhizosphere | MKNRNIQFKPAATVLMPLLLACFAAVFISAPTLAAARDMVPFNGTVSGFV |
| Ga0070663_1003216681 | 3300005455 | Corn Rhizosphere | MKNQNIQVKPTAGVLIPLLLACLAAMSISAPNLASARDQVPFNGVVAGYNNPPSGT |
| Ga0068867_1018410052 | 3300005459 | Miscanthus Rhizosphere | MKNRNIQFKPTAGVLIPLLLACFAAVFICAATPVAARDLV |
| Ga0070706_1010037752 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNRNIQFKPTAGLLIPLFLACFAAVFVSAPTPAAARDMVPFNGTV |
| Ga0066697_101968991 | 3300005540 | Soil | MKNRNIQFKPTAGILIPLLFVCFAAVFISAPTPASARDEV |
| Ga0068861_1025416312 | 3300005719 | Switchgrass Rhizosphere | MKNQNIQFKPTAGVLIPLLLACLAAMSISAPNLASARDQVPFNGVVAGYNNP |
| Ga0066696_100618704 | 3300006032 | Soil | MKNRNIQFKLAARLAILLLLACFAAVFISAPIPAAA |
| Ga0066652_1003756541 | 3300006046 | Soil | MKNRNIQFKATTVVLIPLLLACSAAVFISSPTPAAAR |
| Ga0074053_101832251 | 3300006575 | Soil | MKNRNSQFKATTGVLIPLLLTCFAAVFISALTPVAARDMVPFNGTVSGYVDSQ |
| Ga0066665_103123481 | 3300006796 | Soil | MKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMVPF |
| Ga0075434_1021966312 | 3300006871 | Populus Rhizosphere | MKNRIIQFKATAGVLIPRLLVCLAAVFISAPNSALARDQVPFNGIVSGFVETSEFLPPCTIH |
| Ga0099791_101228463 | 3300007255 | Vadose Zone Soil | MKNRNIQFKPTAGPLIPLLLACFAAVFISAPNPAL |
| Ga0099795_101664791 | 3300007788 | Vadose Zone Soil | MKNRNIQFKPTAGLLIALFLACFAAAFISAPTPAAARDMVP |
| Ga0075418_105474282 | 3300009100 | Populus Rhizosphere | MKNRNIQFKPPAGLLIPLLLACVAAVFISAPNSALARDQVPFNGIVSGFVETSEFLPPCT |
| Ga0114129_113518501 | 3300009147 | Populus Rhizosphere | MKNRNIQFKATAGVLIPLLLACSAAVFISSSTPAAARDMVP |
| Ga0111538_105509311 | 3300009156 | Populus Rhizosphere | MKNRNIQFKATAGVLIPPLLACSAAVFISSPTPAAARDMVPFN |
| Ga0105092_108223241 | 3300009157 | Freshwater Sediment | MKNRNIQFKPTAGLLIPLLLACFAALFISAPTPAAATEMVPFN |
| Ga0105242_126104382 | 3300009176 | Miscanthus Rhizosphere | MKNRNIQFKPTAGVLIPLLLACFAAVFISIPTLAAVGGMVLFKATFTGSSTSDPG |
| Ga0134109_100390101 | 3300010320 | Grasslands Soil | MKNRNIQFKPSAGLLIPLFLGCFAAVFILAPTPAAARDMV |
| Ga0126372_115591702 | 3300010360 | Tropical Forest Soil | MKNRNIQFKPTAGVLIPLLLACLAAVFISASNHASA |
| Ga0134066_100281291 | 3300010364 | Grasslands Soil | MKNRNIQFKATAVVLIPLLLACFAAVFISSPTPAAARDMVP |
| Ga0134066_102437632 | 3300010364 | Grasslands Soil | MQNRNSQFKATTGVLIPLLLACFAAVFISAPNPASAG |
| Ga0134128_103494511 | 3300010373 | Terrestrial Soil | MKNPNSQFKPTAGLLIPLLVACFAAVFVSSATPAIAGET |
| Ga0134122_127346732 | 3300010400 | Terrestrial Soil | MKNRNIQFKPTAGVLIPLLLACFAAVFISIPTPAAARDPVPFKATFTG |
| Ga0137364_105088952 | 3300012198 | Vadose Zone Soil | MKNRNIQFKPTAGLLIPLLLACFATVLISAPTPAAARDMVPFN |
| Ga0137364_109168952 | 3300012198 | Vadose Zone Soil | MKNRNIQFKSTAGVLIPLLLACFAAVFISAPSPAA |
| Ga0137364_112259892 | 3300012198 | Vadose Zone Soil | MKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPATARDMV |
| Ga0137383_112251791 | 3300012199 | Vadose Zone Soil | MKNRNIQFKPTAGVLIPLLLACLAAVFISAPTPAAASEIVPFNGTLSGLVETQ |
| Ga0137382_102821641 | 3300012200 | Vadose Zone Soil | MKNRNIQFKPTAGVVIPLLLACFAAVFFATTPALARDEVPFNGTVS |
| Ga0137376_113228781 | 3300012208 | Vadose Zone Soil | MKNRNIQFKPTAGVLIPLLLACFAAVFISAPTPAA |
| Ga0137370_100649433 | 3300012285 | Vadose Zone Soil | MKNRNLQFKPTAGLLIPLLLACFAAVFISAPTPAAARDMVPFNGTV |
| Ga0137370_104680781 | 3300012285 | Vadose Zone Soil | MKNRNIQFKPTAGLLIPLLLACFATVLISAPTPAAARDMVPFNGTV |
| Ga0137370_106770222 | 3300012285 | Vadose Zone Soil | MKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPATARDMVPF |
| Ga0137375_109879652 | 3300012360 | Vadose Zone Soil | MKNRNIQFKPTAGLLIPLLLACFAAVFISAPTPAAARDMVPFNSTVS |
| Ga0137361_112393213 | 3300012362 | Vadose Zone Soil | MKNRNVQFKPAAGLLIPLLLACFTVVFISAPIPAAAGETV |
| Ga0157302_101809091 | 3300012915 | Soil | MKNRNIQFKPTAGVLIPLLLACFAAVFISATTPASASDQVPFKATFT |
| Ga0137359_111088942 | 3300012923 | Vadose Zone Soil | MKNRNVQFKPAARLLIPLLLACFAEVLIWAPTPAAA |
| Ga0137416_119005412 | 3300012927 | Vadose Zone Soil | MKHRIIQFKPTAGLLIPLFLACFAAVFILASTPAAAREIVPFNATLAGYVE |
| Ga0137410_119367321 | 3300012944 | Vadose Zone Soil | MKNRNIQFKPTAGLLIPLFLACFATVLISAPSPAAARDMVPFNGTVSGYVDS |
| Ga0134076_102176882 | 3300012976 | Grasslands Soil | MKNRNIQFKPTTGLLIPLLLTCFAAAFISAPTPAAAGE |
| Ga0164306_104129352 | 3300012988 | Soil | MKNRNIQFKPAARVLIPLLLACLGAVFISAPTPAAAR |
| Ga0163162_131424342 | 3300013306 | Switchgrass Rhizosphere | MKNRNIQFEPTAGVLIPLLLACFAVVFISATTPASASDQVPFK |
| Ga0137405_14097117 | 3300015053 | Vadose Zone Soil | MKNSKHSVQPSAGLLIPLFLACFAAVFILAPTPAAARDMVPFNGTVLGVR* |
| Ga0132256_1012677822 | 3300015372 | Arabidopsis Rhizosphere | MKNRNIHFKPTAGLLIPLLLACFAAVFISGPTPATARDMV |
| Ga0132256_1013302961 | 3300015372 | Arabidopsis Rhizosphere | MKNRNIQFKPTAGVLIPLLLACFAAVFISATTPAAAR |
| Ga0132255_1002027811 | 3300015374 | Arabidopsis Rhizosphere | MKNRNIQFKPRARHSKNMGLLACLAAGLLLAPNPASAGNQLPFHATLSGY |
| Ga0132255_1026408262 | 3300015374 | Arabidopsis Rhizosphere | MKNRKIQFKPTAGLLIPLLLACFAAVFASAAAPAIAGD |
| Ga0182033_121998902 | 3300016319 | Soil | MKNRNIQFKTTPTFLIPLLLTCLAVLIPATTPALARDEVPFNGTVSG |
| Ga0134074_11502741 | 3300017657 | Grasslands Soil | MKNRNIQFKPTAGLLIPLLLACFAAVFISASTPAAARDMVPFNGT |
| Ga0134083_105261392 | 3300017659 | Grasslands Soil | MKNRNIQFKPSAGLLIPLFLACFAAVFILAPTPAAARDMVPFN |
| Ga0184604_100300571 | 3300018000 | Groundwater Sediment | MKNRNIQFKPTAGVLIPLLLVCFAAVFICAATPAAARDL |
| Ga0184608_102326201 | 3300018028 | Groundwater Sediment | MKNPNIQFKPTAGVLIPLLLACLAAVFISAPNPASAGDQVPFHATLSGYVETSEFLPP |
| Ga0184619_102627792 | 3300018061 | Groundwater Sediment | MKNRIIQFKPTAGLLIPLSFACVAAVFIAAITPARAGEM |
| Ga0184618_101710791 | 3300018071 | Groundwater Sediment | MKHRIIQFKPTAGLLIPLFLACFAAVFILAPTPAAAREIVPLNATLSGYVETSKNLP |
| Ga0184609_103978941 | 3300018076 | Groundwater Sediment | MKNRNIQFKPTAGVLIPLLLGCFAAVIISVQDPAEARDMVPFNGTVSGY |
| Ga0193744_10367131 | 3300019874 | Soil | MKNRNIQFKPTAGVLIPLLLVCFAAVFICAATPAAARDLVPFKATFTGSS |
| Ga0193701_10483212 | 3300019875 | Soil | MKNRSIQFKPTAGLLIPLLLACFAAVFISTPTPASAHDEVPFNGTVSGYVESQSGTE |
| Ga0193707_10892621 | 3300019881 | Soil | MKNRNIQFKPTAGVLIPLLLACFAAVFISAPTPAAASEMVPFNG |
| Ga0193707_11028851 | 3300019881 | Soil | MKHRIIQFKPTAGLLIPLFLACFAAVFISAPTPAAAGDQ |
| Ga0193707_11069011 | 3300019881 | Soil | MKNRNIQFKPTAGVLIPLLLACFVASAPNPASASDQVPFNGTLSGYVET |
| Ga0193725_10531351 | 3300019883 | Soil | MKNRNIQFKATSGILIPLLLACFAAVFISAPTPAAARDMVPLQWHCLGVR |
| Ga0193693_10107671 | 3300019996 | Soil | MKNLNIQFKPTAGLLIPLLLACFVAVFISAPNPASAGNQV |
| Ga0193739_11470451 | 3300020003 | Soil | MKNRNIQFSPTAGLLIPLLLACFAAVFISAPNPAQAGDTVPFNGTVAGVQ |
| Ga0193719_100069685 | 3300021344 | Soil | MKHRIIQFKPTAGLLIPLFLACFAAVFISAPTPAAAREIVPFNATL |
| Ga0193709_11291901 | 3300021411 | Soil | MKNRNIQFKPTAGLLIPLFLACFAAVFILAPTPAAARDMVP |
| Ga0193750_10288382 | 3300021413 | Soil | MKNRNIRFKPTLGLLIPLLLACLAAGFISAPNPASARDQV |
| Ga0222621_10639941 | 3300021510 | Groundwater Sediment | MKNRNLQFKPTAGLLIPLFLACFAAVFVSAPTPAAAR |
| Ga0224452_10237891 | 3300022534 | Groundwater Sediment | MKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMV |
| Ga0222622_101859623 | 3300022756 | Groundwater Sediment | MKNQNIQFKPSAGLLIPLFLACFAAVFISAPTPAAARDM |
| Ga0222622_111617402 | 3300022756 | Groundwater Sediment | MKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPVAARDMVPF |
| Ga0207692_110215951 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNRNIQFKPTAGLLIPLFLACFAAVFISAATPAAAG |
| Ga0207699_105421671 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNRNIQFKPTAGVLIPLLLACFAAVFISIPTAAAARDLVPFKATFTGNSTSV |
| Ga0207707_114093651 | 3300025912 | Corn Rhizosphere | MKNRTIQFKPTAGLLIPLLLACFAAVFISATTPASASDQVPFKATFTGSSTSGPG |
| Ga0207650_112735042 | 3300025925 | Switchgrass Rhizosphere | MKNPNSQFKPTAGLLIPLLVACFAAVFVSSATPAI |
| Ga0207659_114840011 | 3300025926 | Miscanthus Rhizosphere | MKNRNIHFKPTAVVLIPLLLACFAAVFISAPTPAQA |
| Ga0207701_104152272 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNRNIQFKATAGVLVPLLLAFFAAVFISAPNPASARDQVPFQRHSRGMR |
| Ga0207701_106839702 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNRSIQFKPTAGLLIPLLLACFAAVFVSAAAPARAGDTVPFKGTLSGTI |
| Ga0207669_103077891 | 3300025937 | Miscanthus Rhizosphere | MKNRNIQFKPTAGVLIPLLLACFAAVFISATTPAAA |
| Ga0207665_102593041 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNRNIQFKPTAGVLIPLLLACFAAVFISIPTAAAARDLVPFKATFTGNST |
| Ga0207665_103198781 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNRNIQFKPTAGVLIPLLLACFAAVFISGPHPAAAGEM |
| Ga0207658_111436791 | 3300025986 | Switchgrass Rhizosphere | MKNPNSQFKPTAGLLIPLLVACFAAVFVSSAAPAIAGETVPF |
| Ga0207641_103469181 | 3300026088 | Switchgrass Rhizosphere | MKNRNIQFTTARLLIPLFLACFAAVFILAPTPAAARDMVPFN |
| Ga0209152_101693662 | 3300026325 | Soil | MMKNRNIQFKPTAVVLIPLFLACFAAVFISAPTPAAARDMVPFNGTVS |
| Ga0209801_11956341 | 3300026326 | Soil | MKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMVPFTGT |
| Ga0209804_12148282 | 3300026335 | Soil | MKHRIIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMV |
| Ga0209059_12656652 | 3300026527 | Soil | MKHRIIQFKPTAGLLIPLFLACFAAVFISAPTPAAAR |
| Ga0209160_100361310 | 3300026532 | Soil | MKNRNIQFKPSAGLLIPLFLACFAAVFILAPTPAAARDMVPFNG |
| Ga0209058_10758353 | 3300026536 | Soil | MKNRNIQFKPTAGLIALLLACFAAVFISTLTPARAGDTVQFNGTV |
| Ga0209474_103257752 | 3300026550 | Soil | MKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPATALD |
| Ga0209179_10665672 | 3300027512 | Vadose Zone Soil | MKNRNIQFKPTAGLLIPLFLTCFAAVFISAPTPAAAGNMV |
| Ga0209388_11586312 | 3300027655 | Vadose Zone Soil | MKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMVPFNGTV |
| Ga0307284_104186042 | 3300028799 | Soil | MKNRNIHFKPTAGVLIPLLLACFAAVFISAPTPAAA |
| Ga0307312_104596122 | 3300028828 | Soil | MKNRNIQFKPTAGVLIPLLLACFAAVFISATTPASASDQVPFKATFTGSSTSGPGN |
| Ga0075386_121266122 | 3300030916 | Soil | MKNRKIQIKTTARLLIPLFLACFAAVFTSATTPVSARDQ |
| Ga0308188_10155632 | 3300031097 | Soil | MKNRNIQFTPTAGLLIPLFLACFAAVFISAPTPAAASEMV |
| Ga0170824_1284611892 | 3300031231 | Forest Soil | MKNRNIQFKPTAGVLIPLLLACSAAVFISSLTPVAA |
| Ga0170820_120779893 | 3300031446 | Forest Soil | MRNRNIQFKATVQCLLLACFGVFVSATTPALARDEVPFNG |
| Ga0310813_118017352 | 3300031716 | Soil | MKNRNIQFKPSAGVLIPLLLCFAAVFISAHTPAAASEIVPF |
| Ga0307469_119161011 | 3300031720 | Hardwood Forest Soil | MKNQSTQFKPTAGLLIPLLLACVAAVFISTPPLASAGNQVPFNGT |
| Ga0307468_1005395831 | 3300031740 | Hardwood Forest Soil | MKNRNIQFKPTLALLIPLLLVCLAAVFISAPNSARAGGMVPFNGTVSGYVDSQSG |
| Ga0310916_117028251 | 3300031942 | Soil | MKNRNIQFKTTPTFLIPLLLTCLAVLIPATTPALARDEVPFNGTVSGYVETQEP |
| Ga0308176_108775322 | 3300031996 | Soil | MKNRNSQLEPTAGLLIPLLLACFAVVFASAAAPAIAGDT |
| ⦗Top⦘ |