NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070080

Metagenome / Metatranscriptome Family F070080

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070080
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 44 residues
Representative Sequence MKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMVPF
Number of Associated Samples 105
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.53 %
% of genes near scaffold ends (potentially truncated) 88.62 %
% of genes from short scaffolds (< 2000 bps) 88.62 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.431 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.447 % of family members)
Environment Ontology (ENVO) Unclassified
(39.024 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.902 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 37.14%    β-sheet: 0.00%    Coil/Unstructured: 62.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF00196GerE 2.44
PF13432TPR_16 1.63
PF13385Laminin_G_3 0.81
PF00069Pkinase 0.81
PF03948Ribosomal_L9_C 0.81
PF01883FeS_assembly_P 0.81
PF03372Exo_endo_phos 0.81
PF13620CarboxypepD_reg 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.25
COG0359Ribosomal protein L9Translation, ribosomal structure and biogenesis [J] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.43 %
UnclassifiedrootN/A10.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02JHPUKAll Organisms → cellular organisms → Bacteria533Open in IMG/M
2170459010|GIO7OMY02GRTX1All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium537Open in IMG/M
2170459023|GZGNO2B02HJYMZAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300000955|JGI1027J12803_107264426All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia609Open in IMG/M
3300000955|JGI1027J12803_108304934Not Available562Open in IMG/M
3300000956|JGI10216J12902_113355692All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium958Open in IMG/M
3300004157|Ga0062590_100690620All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300004463|Ga0063356_101217721All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300004479|Ga0062595_100669380All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia826Open in IMG/M
3300004479|Ga0062595_100834959All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300005167|Ga0066672_10368430All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300005167|Ga0066672_11028794All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium501Open in IMG/M
3300005171|Ga0066677_10420868All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300005295|Ga0065707_10013055All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1886Open in IMG/M
3300005331|Ga0070670_102060763All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005338|Ga0068868_102382216All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005353|Ga0070669_101010855All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300005354|Ga0070675_100700365All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300005354|Ga0070675_100918485All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300005455|Ga0070663_100301410All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1283Open in IMG/M
3300005459|Ga0068867_101841005All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005467|Ga0070706_101003775All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium770Open in IMG/M
3300005540|Ga0066697_10196899All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1197Open in IMG/M
3300005719|Ga0068861_102541631All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006032|Ga0066696_10061870All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2139Open in IMG/M
3300006046|Ga0066652_100375654All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1287Open in IMG/M
3300006575|Ga0074053_10183225All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia527Open in IMG/M
3300006796|Ga0066665_10312348All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1268Open in IMG/M
3300007255|Ga0099791_10122846All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1204Open in IMG/M
3300007788|Ga0099795_10166479All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia913Open in IMG/M
3300009147|Ga0114129_11351850All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia881Open in IMG/M
3300009156|Ga0111538_10550931All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1462Open in IMG/M
3300009157|Ga0105092_10822324All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300009176|Ga0105242_12610438All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300010320|Ga0134109_10039010All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1539Open in IMG/M
3300010360|Ga0126372_11559170All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium698Open in IMG/M
3300010364|Ga0134066_10028129All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300010364|Ga0134066_10243763All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia619Open in IMG/M
3300010373|Ga0134128_10349451All Organisms → cellular organisms → Bacteria1652Open in IMG/M
3300010400|Ga0134122_12734673All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300012198|Ga0137364_10508895All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia905Open in IMG/M
3300012198|Ga0137364_10916895All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia663Open in IMG/M
3300012198|Ga0137364_11225989All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium561Open in IMG/M
3300012199|Ga0137383_11225179All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia538Open in IMG/M
3300012200|Ga0137382_10282164All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300012208|Ga0137376_11322878All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium611Open in IMG/M
3300012285|Ga0137370_10064943All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter1987Open in IMG/M
3300012285|Ga0137370_10468078All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia769Open in IMG/M
3300012285|Ga0137370_10677022All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium641Open in IMG/M
3300012360|Ga0137375_10987965All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium663Open in IMG/M
3300012362|Ga0137361_11239321All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia669Open in IMG/M
3300012915|Ga0157302_10180909All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300012923|Ga0137359_11108894All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium677Open in IMG/M
3300012927|Ga0137416_11900541All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium545Open in IMG/M
3300012944|Ga0137410_11936732All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia523Open in IMG/M
3300012976|Ga0134076_10217688All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia806Open in IMG/M
3300012988|Ga0164306_10412935All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1017Open in IMG/M
3300013306|Ga0163162_13142434All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300015053|Ga0137405_1409711All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4309Open in IMG/M
3300015372|Ga0132256_101267782All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300015372|Ga0132256_101330296All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300015374|Ga0132255_102640826All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300016319|Ga0182033_12199890Not Available503Open in IMG/M
3300017657|Ga0134074_1150274All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium814Open in IMG/M
3300017659|Ga0134083_10526139All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300018000|Ga0184604_10030057All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1373Open in IMG/M
3300018061|Ga0184619_10262779All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia793Open in IMG/M
3300018071|Ga0184618_10171079All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium897Open in IMG/M
3300018076|Ga0184609_10397894All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium641Open in IMG/M
3300019874|Ga0193744_1036713All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300019881|Ga0193707_1089262All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia934Open in IMG/M
3300019881|Ga0193707_1102885All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium851Open in IMG/M
3300019881|Ga0193707_1106901All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300019883|Ga0193725_1053135All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300019996|Ga0193693_1010767All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1845Open in IMG/M
3300020003|Ga0193739_1147045All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium566Open in IMG/M
3300021344|Ga0193719_10006968All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium4679Open in IMG/M
3300021411|Ga0193709_1129190All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium507Open in IMG/M
3300021413|Ga0193750_1028838All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300021510|Ga0222621_1063994All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300022534|Ga0224452_1023789All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1726Open in IMG/M
3300022756|Ga0222622_10185962All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1368Open in IMG/M
3300022756|Ga0222622_11161740Not Available568Open in IMG/M
3300025898|Ga0207692_11021595All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium546Open in IMG/M
3300025906|Ga0207699_10542167All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300025912|Ga0207707_11409365All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium555Open in IMG/M
3300025925|Ga0207650_11273504All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300025926|Ga0207659_11484001All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium580Open in IMG/M
3300025930|Ga0207701_10415227All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1158Open in IMG/M
3300025930|Ga0207701_10683970All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300025937|Ga0207669_10307789All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300025939|Ga0207665_10259304All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300025939|Ga0207665_10319878All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1164Open in IMG/M
3300025986|Ga0207658_11143679All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300026088|Ga0207641_10346918All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300026325|Ga0209152_10169366All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia822Open in IMG/M
3300026326|Ga0209801_1195634All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium815Open in IMG/M
3300026335|Ga0209804_1214828All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300026527|Ga0209059_1265665All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium577Open in IMG/M
3300026532|Ga0209160_1003613All Organisms → cellular organisms → Bacteria12558Open in IMG/M
3300026536|Ga0209058_1075835All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1784Open in IMG/M
3300026550|Ga0209474_10325775All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300027512|Ga0209179_1066567All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300027655|Ga0209388_1158631All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium638Open in IMG/M
3300028799|Ga0307284_10418604All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia546Open in IMG/M
3300028828|Ga0307312_10459612All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300030916|Ga0075386_12126612All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031097|Ga0308188_1015563All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300031231|Ga0170824_128461189All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium509Open in IMG/M
3300031446|Ga0170820_12077989All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300031716|Ga0310813_11801735All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium575Open in IMG/M
3300031720|Ga0307469_11916101All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300031996|Ga0308176_10877532All Organisms → cellular organisms → Bacteria941Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil13.01%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.06%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.06%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.25%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.25%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.25%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.63%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.63%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.63%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.63%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.63%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300019874Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019996Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031097Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_092078202170459005Grass SoilMKNRNIQFKVTAGLLIPLLLACFAAVFISVSTPALARNEVPFNGTVSGYVETQ
F62_017908702170459010Grass SoilMKNRNIQLKPTAGVLIPLLLVCFAAVFISAPTPAAARDMVPF
FA3_099313502170459023Grass SoilMKNRNIQFKATAGVLIPLLLACSAAVFISSVTPVAARDMVPFNGTVSG
JGI1027J12803_10726442613300000955SoilMKNPNIQFKTTAGILIPLLLACLAAVFISPPTPAAARDMVPFNGTV
JGI1027J12803_10830493423300000955SoilVKNRNIHFKATAGLPIPLLLACFTAVFISAPIPAIAAGQVPF
JGI10216J12902_11335569223300000956SoilMKNQNIQFKPRAGFLIPLLLVCLAAAFVSAPNTASARDQVPFNG
Ga0062590_10069062013300004157SoilMKNRNIQFKPTAGVLMPLLLACFAAVFISAPSPAAASEMVPFNATLSGYVETSE
Ga0063356_10121772113300004463Arabidopsis Thaliana RhizosphereMKNRNIQFKPTAGVLMPLLLAGFAAVFISAPTPATARDMVPFNGTVS
Ga0063356_10298535423300004463Arabidopsis Thaliana RhizosphereMKNRNIQFKPTAGVLIPLLLACLAAVFISGPTPALARDEVPFNGTVSGYVES
Ga0062595_10066938023300004479SoilVKNRNIQFKPTAGVLIPLLLACLAAVFISASNPVSARDQVPFNGTLGGCVDTQ
Ga0062595_10083495913300004479SoilMKNRNIQFKPTAGLLIPLLLACFAAVFISAPNSASAGDQVPFIGTLA
Ga0062594_10207037413300005093SoilMKNQNIQVKPTAGVLIPLLLACLAAMSISAPNPASARDQVPFNGVVAGYNNPPSGTEC
Ga0066672_1036843013300005167SoilMKNRNIQLKSSTGVLIPLLLACLAAAFISAPTRAQAGDTVPFNGTVS
Ga0066672_1102879423300005167SoilMKHRIIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMVPFNGTV
Ga0066677_1042086823300005171SoilMKNRNIQLKSSTGVLIPLLLACLAAAFISAPTRAQAGDTVPFNGTVSGYV
Ga0065707_1001305543300005295Switchgrass RhizosphereMKNRNIQFKATAGVLVPLLLAFFAAVFISTPTPAAARDMV
Ga0070670_10206076323300005331Switchgrass RhizosphereMKNRNIQFKPTAGVLMPLLLACFAAVFMSIPTPAAARDLVPFKATFTGSSSS
Ga0068868_10238221613300005338Miscanthus RhizosphereMKNRSIQFKPTAGLLIPLLLACFAAVFVSAAAPARAGDTVPFKG
Ga0070669_10101085513300005353Switchgrass RhizosphereMKNRSIQFKPTAGLLIPLLLACFAAVFVSAVAPARAGDTVPFKGTLSGTIISSVPLD
Ga0070675_10070036523300005354Miscanthus RhizosphereMKNRSIQFKPTAGLLIPLLLACFAAVFVSAAAPARAGDTVPFKGTLSGTIISSVPLD
Ga0070675_10091848523300005354Miscanthus RhizosphereMKNPNSQFKPTAGLLIPLLVACFAAVFVSSATPAIAGETVPFKGVLSGSTISSVPL
Ga0070663_10030141023300005455Corn RhizosphereMKNRNIQFKPAATVLMPLLLACFAAVFISAPTLAAARDMVPFNGTVSGFV
Ga0070663_10032166813300005455Corn RhizosphereMKNQNIQVKPTAGVLIPLLLACLAAMSISAPNLASARDQVPFNGVVAGYNNPPSGT
Ga0068867_10184100523300005459Miscanthus RhizosphereMKNRNIQFKPTAGVLIPLLLACFAAVFICAATPVAARDLV
Ga0070706_10100377523300005467Corn, Switchgrass And Miscanthus RhizosphereMKNRNIQFKPTAGLLIPLFLACFAAVFVSAPTPAAARDMVPFNGTV
Ga0066697_1019689913300005540SoilMKNRNIQFKPTAGILIPLLFVCFAAVFISAPTPASARDEV
Ga0068861_10254163123300005719Switchgrass RhizosphereMKNQNIQFKPTAGVLIPLLLACLAAMSISAPNLASARDQVPFNGVVAGYNNP
Ga0066696_1006187043300006032SoilMKNRNIQFKLAARLAILLLLACFAAVFISAPIPAAA
Ga0066652_10037565413300006046SoilMKNRNIQFKATTVVLIPLLLACSAAVFISSPTPAAAR
Ga0074053_1018322513300006575SoilMKNRNSQFKATTGVLIPLLLTCFAAVFISALTPVAARDMVPFNGTVSGYVDSQ
Ga0066665_1031234813300006796SoilMKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMVPF
Ga0075434_10219663123300006871Populus RhizosphereMKNRIIQFKATAGVLIPRLLVCLAAVFISAPNSALARDQVPFNGIVSGFVETSEFLPPCTIH
Ga0099791_1012284633300007255Vadose Zone SoilMKNRNIQFKPTAGPLIPLLLACFAAVFISAPNPAL
Ga0099795_1016647913300007788Vadose Zone SoilMKNRNIQFKPTAGLLIALFLACFAAAFISAPTPAAARDMVP
Ga0075418_1054742823300009100Populus RhizosphereMKNRNIQFKPPAGLLIPLLLACVAAVFISAPNSALARDQVPFNGIVSGFVETSEFLPPCT
Ga0114129_1135185013300009147Populus RhizosphereMKNRNIQFKATAGVLIPLLLACSAAVFISSSTPAAARDMVP
Ga0111538_1055093113300009156Populus RhizosphereMKNRNIQFKATAGVLIPPLLACSAAVFISSPTPAAARDMVPFN
Ga0105092_1082232413300009157Freshwater SedimentMKNRNIQFKPTAGLLIPLLLACFAALFISAPTPAAATEMVPFN
Ga0105242_1261043823300009176Miscanthus RhizosphereMKNRNIQFKPTAGVLIPLLLACFAAVFISIPTLAAVGGMVLFKATFTGSSTSDPG
Ga0134109_1003901013300010320Grasslands SoilMKNRNIQFKPSAGLLIPLFLGCFAAVFILAPTPAAARDMV
Ga0126372_1155917023300010360Tropical Forest SoilMKNRNIQFKPTAGVLIPLLLACLAAVFISASNHASA
Ga0134066_1002812913300010364Grasslands SoilMKNRNIQFKATAVVLIPLLLACFAAVFISSPTPAAARDMVP
Ga0134066_1024376323300010364Grasslands SoilMQNRNSQFKATTGVLIPLLLACFAAVFISAPNPASAG
Ga0134128_1034945113300010373Terrestrial SoilMKNPNSQFKPTAGLLIPLLVACFAAVFVSSATPAIAGET
Ga0134122_1273467323300010400Terrestrial SoilMKNRNIQFKPTAGVLIPLLLACFAAVFISIPTPAAARDPVPFKATFTG
Ga0137364_1050889523300012198Vadose Zone SoilMKNRNIQFKPTAGLLIPLLLACFATVLISAPTPAAARDMVPFN
Ga0137364_1091689523300012198Vadose Zone SoilMKNRNIQFKSTAGVLIPLLLACFAAVFISAPSPAA
Ga0137364_1122598923300012198Vadose Zone SoilMKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPATARDMV
Ga0137383_1122517913300012199Vadose Zone SoilMKNRNIQFKPTAGVLIPLLLACLAAVFISAPTPAAASEIVPFNGTLSGLVETQ
Ga0137382_1028216413300012200Vadose Zone SoilMKNRNIQFKPTAGVVIPLLLACFAAVFFATTPALARDEVPFNGTVS
Ga0137376_1132287813300012208Vadose Zone SoilMKNRNIQFKPTAGVLIPLLLACFAAVFISAPTPAA
Ga0137370_1006494333300012285Vadose Zone SoilMKNRNLQFKPTAGLLIPLLLACFAAVFISAPTPAAARDMVPFNGTV
Ga0137370_1046807813300012285Vadose Zone SoilMKNRNIQFKPTAGLLIPLLLACFATVLISAPTPAAARDMVPFNGTV
Ga0137370_1067702223300012285Vadose Zone SoilMKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPATARDMVPF
Ga0137375_1098796523300012360Vadose Zone SoilMKNRNIQFKPTAGLLIPLLLACFAAVFISAPTPAAARDMVPFNSTVS
Ga0137361_1123932133300012362Vadose Zone SoilMKNRNVQFKPAAGLLIPLLLACFTVVFISAPIPAAAGETV
Ga0157302_1018090913300012915SoilMKNRNIQFKPTAGVLIPLLLACFAAVFISATTPASASDQVPFKATFT
Ga0137359_1110889423300012923Vadose Zone SoilMKNRNVQFKPAARLLIPLLLACFAEVLIWAPTPAAA
Ga0137416_1190054123300012927Vadose Zone SoilMKHRIIQFKPTAGLLIPLFLACFAAVFILASTPAAAREIVPFNATLAGYVE
Ga0137410_1193673213300012944Vadose Zone SoilMKNRNIQFKPTAGLLIPLFLACFATVLISAPSPAAARDMVPFNGTVSGYVDS
Ga0134076_1021768823300012976Grasslands SoilMKNRNIQFKPTTGLLIPLLLTCFAAAFISAPTPAAAGE
Ga0164306_1041293523300012988SoilMKNRNIQFKPAARVLIPLLLACLGAVFISAPTPAAAR
Ga0163162_1314243423300013306Switchgrass RhizosphereMKNRNIQFEPTAGVLIPLLLACFAVVFISATTPASASDQVPFK
Ga0137405_140971173300015053Vadose Zone SoilMKNSKHSVQPSAGLLIPLFLACFAAVFILAPTPAAARDMVPFNGTVLGVR*
Ga0132256_10126778223300015372Arabidopsis RhizosphereMKNRNIHFKPTAGLLIPLLLACFAAVFISGPTPATARDMV
Ga0132256_10133029613300015372Arabidopsis RhizosphereMKNRNIQFKPTAGVLIPLLLACFAAVFISATTPAAAR
Ga0132255_10020278113300015374Arabidopsis RhizosphereMKNRNIQFKPRARHSKNMGLLACLAAGLLLAPNPASAGNQLPFHATLSGY
Ga0132255_10264082623300015374Arabidopsis RhizosphereMKNRKIQFKPTAGLLIPLLLACFAAVFASAAAPAIAGD
Ga0182033_1219989023300016319SoilMKNRNIQFKTTPTFLIPLLLTCLAVLIPATTPALARDEVPFNGTVSG
Ga0134074_115027413300017657Grasslands SoilMKNRNIQFKPTAGLLIPLLLACFAAVFISASTPAAARDMVPFNGT
Ga0134083_1052613923300017659Grasslands SoilMKNRNIQFKPSAGLLIPLFLACFAAVFILAPTPAAARDMVPFN
Ga0184604_1003005713300018000Groundwater SedimentMKNRNIQFKPTAGVLIPLLLVCFAAVFICAATPAAARDL
Ga0184608_1023262013300018028Groundwater SedimentMKNPNIQFKPTAGVLIPLLLACLAAVFISAPNPASAGDQVPFHATLSGYVETSEFLPP
Ga0184619_1026277923300018061Groundwater SedimentMKNRIIQFKPTAGLLIPLSFACVAAVFIAAITPARAGEM
Ga0184618_1017107913300018071Groundwater SedimentMKHRIIQFKPTAGLLIPLFLACFAAVFILAPTPAAAREIVPLNATLSGYVETSKNLP
Ga0184609_1039789413300018076Groundwater SedimentMKNRNIQFKPTAGVLIPLLLGCFAAVIISVQDPAEARDMVPFNGTVSGY
Ga0193744_103671313300019874SoilMKNRNIQFKPTAGVLIPLLLVCFAAVFICAATPAAARDLVPFKATFTGSS
Ga0193701_104832123300019875SoilMKNRSIQFKPTAGLLIPLLLACFAAVFISTPTPASAHDEVPFNGTVSGYVESQSGTE
Ga0193707_108926213300019881SoilMKNRNIQFKPTAGVLIPLLLACFAAVFISAPTPAAASEMVPFNG
Ga0193707_110288513300019881SoilMKHRIIQFKPTAGLLIPLFLACFAAVFISAPTPAAAGDQ
Ga0193707_110690113300019881SoilMKNRNIQFKPTAGVLIPLLLACFVASAPNPASASDQVPFNGTLSGYVET
Ga0193725_105313513300019883SoilMKNRNIQFKATSGILIPLLLACFAAVFISAPTPAAARDMVPLQWHCLGVR
Ga0193693_101076713300019996SoilMKNLNIQFKPTAGLLIPLLLACFVAVFISAPNPASAGNQV
Ga0193739_114704513300020003SoilMKNRNIQFSPTAGLLIPLLLACFAAVFISAPNPAQAGDTVPFNGTVAGVQ
Ga0193719_1000696853300021344SoilMKHRIIQFKPTAGLLIPLFLACFAAVFISAPTPAAAREIVPFNATL
Ga0193709_112919013300021411SoilMKNRNIQFKPTAGLLIPLFLACFAAVFILAPTPAAARDMVP
Ga0193750_102883823300021413SoilMKNRNIRFKPTLGLLIPLLLACLAAGFISAPNPASARDQV
Ga0222621_106399413300021510Groundwater SedimentMKNRNLQFKPTAGLLIPLFLACFAAVFVSAPTPAAAR
Ga0224452_102378913300022534Groundwater SedimentMKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMV
Ga0222622_1018596233300022756Groundwater SedimentMKNQNIQFKPSAGLLIPLFLACFAAVFISAPTPAAARDM
Ga0222622_1116174023300022756Groundwater SedimentMKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPVAARDMVPF
Ga0207692_1102159513300025898Corn, Switchgrass And Miscanthus RhizosphereMKNRNIQFKPTAGLLIPLFLACFAAVFISAATPAAAG
Ga0207699_1054216713300025906Corn, Switchgrass And Miscanthus RhizosphereMKNRNIQFKPTAGVLIPLLLACFAAVFISIPTAAAARDLVPFKATFTGNSTSV
Ga0207707_1140936513300025912Corn RhizosphereMKNRTIQFKPTAGLLIPLLLACFAAVFISATTPASASDQVPFKATFTGSSTSGPG
Ga0207650_1127350423300025925Switchgrass RhizosphereMKNPNSQFKPTAGLLIPLLVACFAAVFVSSATPAI
Ga0207659_1148400113300025926Miscanthus RhizosphereMKNRNIHFKPTAVVLIPLLLACFAAVFISAPTPAQA
Ga0207701_1041522723300025930Corn, Switchgrass And Miscanthus RhizosphereMKNRNIQFKATAGVLVPLLLAFFAAVFISAPNPASARDQVPFQRHSRGMR
Ga0207701_1068397023300025930Corn, Switchgrass And Miscanthus RhizosphereMKNRSIQFKPTAGLLIPLLLACFAAVFVSAAAPARAGDTVPFKGTLSGTI
Ga0207669_1030778913300025937Miscanthus RhizosphereMKNRNIQFKPTAGVLIPLLLACFAAVFISATTPAAA
Ga0207665_1025930413300025939Corn, Switchgrass And Miscanthus RhizosphereMKNRNIQFKPTAGVLIPLLLACFAAVFISIPTAAAARDLVPFKATFTGNST
Ga0207665_1031987813300025939Corn, Switchgrass And Miscanthus RhizosphereMKNRNIQFKPTAGVLIPLLLACFAAVFISGPHPAAAGEM
Ga0207658_1114367913300025986Switchgrass RhizosphereMKNPNSQFKPTAGLLIPLLVACFAAVFVSSAAPAIAGETVPF
Ga0207641_1034691813300026088Switchgrass RhizosphereMKNRNIQFTTARLLIPLFLACFAAVFILAPTPAAARDMVPFN
Ga0209152_1016936623300026325SoilMMKNRNIQFKPTAVVLIPLFLACFAAVFISAPTPAAARDMVPFNGTVS
Ga0209801_119563413300026326SoilMKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMVPFTGT
Ga0209804_121482823300026335SoilMKHRIIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMV
Ga0209059_126566523300026527SoilMKHRIIQFKPTAGLLIPLFLACFAAVFISAPTPAAAR
Ga0209160_1003613103300026532SoilMKNRNIQFKPSAGLLIPLFLACFAAVFILAPTPAAARDMVPFNG
Ga0209058_107583533300026536SoilMKNRNIQFKPTAGLIALLLACFAAVFISTLTPARAGDTVQFNGTV
Ga0209474_1032577523300026550SoilMKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPATALD
Ga0209179_106656723300027512Vadose Zone SoilMKNRNIQFKPTAGLLIPLFLTCFAAVFISAPTPAAAGNMV
Ga0209388_115863123300027655Vadose Zone SoilMKNRNIQFKPTAGLLIPLFLACFAAVFISAPTPAAARDMVPFNGTV
Ga0307284_1041860423300028799SoilMKNRNIHFKPTAGVLIPLLLACFAAVFISAPTPAAA
Ga0307312_1045961223300028828SoilMKNRNIQFKPTAGVLIPLLLACFAAVFISATTPASASDQVPFKATFTGSSTSGPGN
Ga0075386_1212661223300030916SoilMKNRKIQIKTTARLLIPLFLACFAAVFTSATTPVSARDQ
Ga0308188_101556323300031097SoilMKNRNIQFTPTAGLLIPLFLACFAAVFISAPTPAAASEMV
Ga0170824_12846118923300031231Forest SoilMKNRNIQFKPTAGVLIPLLLACSAAVFISSLTPVAA
Ga0170820_1207798933300031446Forest SoilMRNRNIQFKATVQCLLLACFGVFVSATTPALARDEVPFNG
Ga0310813_1180173523300031716SoilMKNRNIQFKPSAGVLIPLLLCFAAVFISAHTPAAASEIVPF
Ga0307469_1191610113300031720Hardwood Forest SoilMKNQSTQFKPTAGLLIPLLLACVAAVFISTPPLASAGNQVPFNGT
Ga0307468_10053958313300031740Hardwood Forest SoilMKNRNIQFKPTLALLIPLLLVCLAAVFISAPNSARAGGMVPFNGTVSGYVDSQSG
Ga0310916_1170282513300031942SoilMKNRNIQFKTTPTFLIPLLLTCLAVLIPATTPALARDEVPFNGTVSGYVETQEP
Ga0308176_1087753223300031996SoilMKNRNSQLEPTAGLLIPLLLACFAVVFASAAAPAIAGDT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.