NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069968

Metagenome / Metatranscriptome Family F069968

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069968
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 60 residues
Representative Sequence MPVKYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYWLRIADGGAS
Number of Associated Samples 108
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 98.37 %
% of genes from short scaffolds (< 2000 bps) 90.24 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.244 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(39.024 % of family members)
Environment Ontology (ENVO) Unclassified
(34.146 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(40.650 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.84%    β-sheet: 18.39%    Coil/Unstructured: 59.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF00067p450 13.82
PF12840HTH_20 8.94
PF00005ABC_tran 5.69
PF00903Glyoxalase 4.88
PF01022HTH_5 4.88
PF03928HbpS-like 4.07
PF00378ECH_1 3.25
PF08327AHSA1 1.63
PF16483Glyco_hydro_64 1.63
PF13280WYL 0.81
PF03992ABM 0.81
PF01381HTH_3 0.81
PF14032PknH_C 0.81
PF12681Glyoxalase_2 0.81
PF11716MDMPI_N 0.81
PF00069Pkinase 0.81
PF04185Phosphoesterase 0.81
PF00550PP-binding 0.81
PF03976PPK2 0.81
PF00196GerE 0.81
PF08281Sigma70_r4_2 0.81
PF12323HTH_OrfB_IS605 0.81
PF01522Polysacc_deac_1 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG2124Cytochrome P450Defense mechanisms [V] 13.82
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.25
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.81
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.81
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.24 %
UnclassifiedrootN/A9.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M101DM1GFAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii510Open in IMG/M
3300002245|JGIcombinedJ26739_100427798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1202Open in IMG/M
3300003505|JGIcombinedJ51221_10349505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300003505|JGIcombinedJ51221_10393245Not Available563Open in IMG/M
3300004080|Ga0062385_11293958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii502Open in IMG/M
3300004091|Ga0062387_101287842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter coccineus577Open in IMG/M
3300005179|Ga0066684_10073959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2025Open in IMG/M
3300005340|Ga0070689_102234170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii502Open in IMG/M
3300005435|Ga0070714_101885021All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005436|Ga0070713_102403402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → Sporichthya polymorpha509Open in IMG/M
3300005610|Ga0070763_10482802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300005921|Ga0070766_10050044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2345Open in IMG/M
3300005921|Ga0070766_10485169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia819Open in IMG/M
3300006041|Ga0075023_100117208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii942Open in IMG/M
3300006755|Ga0079222_11136945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia691Open in IMG/M
3300006903|Ga0075426_10337175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1106Open in IMG/M
3300007255|Ga0099791_10460224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii616Open in IMG/M
3300009098|Ga0105245_12908904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii531Open in IMG/M
3300009520|Ga0116214_1436190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii513Open in IMG/M
3300009521|Ga0116222_1174783All Organisms → cellular organisms → Bacteria → Terrabacteria group924Open in IMG/M
3300009672|Ga0116215_1328214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii664Open in IMG/M
3300009672|Ga0116215_1542932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii502Open in IMG/M
3300009700|Ga0116217_10584172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii697Open in IMG/M
3300010379|Ga0136449_102959841All Organisms → cellular organisms → Bacteria → Terrabacteria group665Open in IMG/M
3300010877|Ga0126356_11056109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1095Open in IMG/M
3300012189|Ga0137388_11013897All Organisms → cellular organisms → Bacteria → Terrabacteria group766Open in IMG/M
3300012201|Ga0137365_10423028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria982Open in IMG/M
3300012201|Ga0137365_11071574All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012357|Ga0137384_10051690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3401Open in IMG/M
3300012508|Ga0157315_1036281Not Available604Open in IMG/M
3300012985|Ga0164308_10388582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1138Open in IMG/M
3300015051|Ga0137414_1079713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii546Open in IMG/M
3300016357|Ga0182032_11085545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium686Open in IMG/M
3300017821|Ga0187812_1195554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii647Open in IMG/M
3300017924|Ga0187820_1001464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5351Open in IMG/M
3300017926|Ga0187807_1064693Not Available1137Open in IMG/M
3300017926|Ga0187807_1318591Not Available519Open in IMG/M
3300017928|Ga0187806_1051971All Organisms → cellular organisms → Bacteria → Terrabacteria group1248Open in IMG/M
3300017932|Ga0187814_10093403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1108Open in IMG/M
3300017932|Ga0187814_10129374All Organisms → cellular organisms → Bacteria → Terrabacteria group938Open in IMG/M
3300017937|Ga0187809_10282249All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300017943|Ga0187819_10152780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1374Open in IMG/M
3300017955|Ga0187817_10909141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii563Open in IMG/M
3300017959|Ga0187779_10749516All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300018007|Ga0187805_10516564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii560Open in IMG/M
3300018086|Ga0187769_11066880All Organisms → cellular organisms → Bacteria → Terrabacteria group611Open in IMG/M
3300020581|Ga0210399_10052435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3278Open in IMG/M
3300020581|Ga0210399_10418497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1117Open in IMG/M
3300020583|Ga0210401_10652409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii913Open in IMG/M
3300021180|Ga0210396_10147418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2114Open in IMG/M
3300021402|Ga0210385_10312785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces roseochromogenus1166Open in IMG/M
3300021403|Ga0210397_10704122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium776Open in IMG/M
3300021403|Ga0210397_10728819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia763Open in IMG/M
3300021407|Ga0210383_10345569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1282Open in IMG/M
3300021474|Ga0210390_10028502All Organisms → cellular organisms → Bacteria4543Open in IMG/M
3300021478|Ga0210402_10097789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2631Open in IMG/M
3300024227|Ga0228598_1035621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium981Open in IMG/M
3300024323|Ga0247666_1104350All Organisms → cellular organisms → Bacteria → Terrabacteria group563Open in IMG/M
3300027096|Ga0208099_1065344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii512Open in IMG/M
3300027765|Ga0209073_10493990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii515Open in IMG/M
3300027884|Ga0209275_10066536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1774Open in IMG/M
3300027889|Ga0209380_10010977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5254Open in IMG/M
3300027895|Ga0209624_10911152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300027908|Ga0209006_10193254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1771Open in IMG/M
3300028800|Ga0265338_10287170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1200Open in IMG/M
3300028872|Ga0307314_10228627All Organisms → cellular organisms → Bacteria → Terrabacteria group570Open in IMG/M
3300028906|Ga0308309_11063632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii700Open in IMG/M
3300029943|Ga0311340_10850305Not Available764Open in IMG/M
3300030503|Ga0311370_10484894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1521Open in IMG/M
3300030618|Ga0311354_10178231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2293Open in IMG/M
3300030815|Ga0265746_1048800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii585Open in IMG/M
3300031543|Ga0318516_10522889All Organisms → cellular organisms → Bacteria → Terrabacteria group680Open in IMG/M
3300031543|Ga0318516_10856178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii512Open in IMG/M
3300031545|Ga0318541_10879218Not Available500Open in IMG/M
3300031549|Ga0318571_10426947All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300031679|Ga0318561_10225629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1019Open in IMG/M
3300031680|Ga0318574_10848209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300031708|Ga0310686_118870566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii532Open in IMG/M
3300031713|Ga0318496_10076673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1767Open in IMG/M
3300031713|Ga0318496_10137235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1330Open in IMG/M
3300031713|Ga0318496_10291239All Organisms → cellular organisms → Bacteria → Terrabacteria group901Open in IMG/M
3300031715|Ga0307476_10900295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium653Open in IMG/M
3300031747|Ga0318502_10740121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii595Open in IMG/M
3300031753|Ga0307477_10666128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium698Open in IMG/M
3300031770|Ga0318521_10080802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1753Open in IMG/M
3300031782|Ga0318552_10415131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia686Open in IMG/M
3300031793|Ga0318548_10298870All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300031794|Ga0318503_10105971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium895Open in IMG/M
3300031794|Ga0318503_10141828Not Available773Open in IMG/M
3300031795|Ga0318557_10524882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300031796|Ga0318576_10356927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium691Open in IMG/M
3300031819|Ga0318568_10229314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1148Open in IMG/M
3300031831|Ga0318564_10146164Not Available1054Open in IMG/M
3300031832|Ga0318499_10345722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii572Open in IMG/M
3300031833|Ga0310917_10853859Not Available613Open in IMG/M
3300031859|Ga0318527_10394824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii590Open in IMG/M
3300031860|Ga0318495_10398918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia606Open in IMG/M
3300031890|Ga0306925_11300254All Organisms → cellular organisms → Bacteria → Terrabacteria group723Open in IMG/M
3300031890|Ga0306925_12277944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii501Open in IMG/M
3300031894|Ga0318522_10222439Not Available715Open in IMG/M
3300031894|Ga0318522_10325075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii583Open in IMG/M
3300031896|Ga0318551_10305073All Organisms → cellular organisms → Bacteria → Terrabacteria group896Open in IMG/M
3300031910|Ga0306923_10820684All Organisms → cellular organisms → Bacteria → Terrabacteria group1025Open in IMG/M
3300031939|Ga0308174_11727203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii538Open in IMG/M
3300031941|Ga0310912_10815048Not Available721Open in IMG/M
3300032008|Ga0318562_10630617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii618Open in IMG/M
3300032039|Ga0318559_10568628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium529Open in IMG/M
3300032043|Ga0318556_10066591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1775Open in IMG/M
3300032044|Ga0318558_10234296Not Available901Open in IMG/M
3300032067|Ga0318524_10610984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura574Open in IMG/M
3300032067|Ga0318524_10683664All Organisms → cellular organisms → Bacteria → Terrabacteria group541Open in IMG/M
3300032068|Ga0318553_10175377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1115Open in IMG/M
3300032089|Ga0318525_10073915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1715Open in IMG/M
3300032094|Ga0318540_10135676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1174Open in IMG/M
3300032174|Ga0307470_11807798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii517Open in IMG/M
3300032261|Ga0306920_103708338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii560Open in IMG/M
3300032805|Ga0335078_12282202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii567Open in IMG/M
3300032893|Ga0335069_10093917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3802Open in IMG/M
3300032895|Ga0335074_10774334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii903Open in IMG/M
3300032954|Ga0335083_10095801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2942Open in IMG/M
3300032955|Ga0335076_11595415All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300033134|Ga0335073_11681461All Organisms → cellular organisms → Bacteria → Terrabacteria group600Open in IMG/M
3300033289|Ga0310914_11735229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii528Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil39.02%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment8.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.25%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.44%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.44%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.63%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.81%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_059910902189573001Grass SoilMMPVKYLSPEWIDAYNAAVAADDAVHKSLKGKSAVIQMVVADAPAGEIRYALRIADGTAX
JGIcombinedJ26739_10042779813300002245Forest SoilMPVKYLSPEWIDAYNATVAADESVRAAMKGRNAVIQMLIAEGPDGEIHYWLRIGDGS
JGIcombinedJ51221_1034950513300003505Forest SoilMPLKYLSPEWIDAYNATVAADDSVRAAMKGKNAVIQMLIAEAPDGEIHYWLRIGDG
JGIcombinedJ51221_1039324523300003505Forest SoilMSILPVQYLSQEWVDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGEVRYW
Ga0062385_1129395813300004080Bog Forest SoilMPVKYLSQEWIDEYNAALEQDAVRAALKGKSATIQMVISDSPQGEIHYWLRFAD
Ga0062387_10128784213300004091Bog Forest SoilMPVKYLSPEWFDAYNAAVAADDAVHKALKGKSAVIQMVVAEAPAGEVRYALRIGDGTASASLGDAAD
Ga0066684_1007395913300005179SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVISDAPEEGEIRYWLRIEDGGAAAGL
Ga0070689_10223417013300005340Switchgrass RhizosphereMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPEGEIRYWLRIEDGGAAAGLGDLDGP
Ga0070714_10188502113300005435Agricultural SoilMPVKYLSQEWIDAYNDALAGDALRAAMKGKNATIQMVISDAPEEAEIRYWLRIEDGGAA
Ga0070713_10240340213300005436Corn, Switchgrass And Miscanthus RhizosphereMPVKYLSQEWIDAYNAALAGDAVRAAMKGKNATIQMVISDAPEEGEIRYWLRIEDGGAAA
Ga0070763_1048280213300005610SoilMPLKYLSPEWIDAYNATVAADDSVRAAMKGKSAVLQMLIAEAPGGEIHYWLRIG
Ga0070766_1005004443300005921SoilMPVKYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYWLR
Ga0070766_1048516923300005921SoilMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYWLR
Ga0075023_10011720813300006041WatershedsMPVTYLSQEWVEAYNATMAGDDAVRAALKGKSAALQMVISGAPQGEVRYWLRIADGGASA
Ga0079222_1113694513300006755Agricultural SoilMPVKYLSQEWIDAYNNALAGDAVRAAMKGKNATIQMVISDAPEEGEIRYWLRIEDGGAAAGLGDLD
Ga0075426_1033717533300006903Populus RhizosphereMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPRDGEIRYWLRIEDGGAAAGLG
Ga0099791_1046022423300007255Vadose Zone SoilMPVKYLSQEWIDAYNNALTGDAVRGALKGKNATIQMVISDAPEEGEIRYWLRIEDGGAAAGLGDL
Ga0105245_1290890413300009098Miscanthus RhizosphereMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPRDGEIRYWLRIEDGG
Ga0116214_143619013300009520Peatlands SoilMPVKYLSQEWIDEYNAALAADDAVRASLKGKSASIQMVISDSPQGEIHYWLRIGDGGASAGLGDLD
Ga0116222_117478313300009521Peatlands SoilMPVKYLSQEWIDAYNATLASDEAVRAALKGKSATIQMVISDAPRGEVHYWLRIADGGASA
Ga0116215_132821423300009672Peatlands SoilMPVKYLSQEWIDEYNAALAADDAVRAALKGKSASIQMVISDSPQGEIHYWLRIGDGGASAGLGDLDG
Ga0116215_154293213300009672Peatlands SoilMPVKYLSQEWIDEYNAALAADDAVRASLKGKSASIQMVISDSPQGEIHYWLRIGDGGASAGLGDLDG
Ga0116217_1058417213300009700Peatlands SoilMPVKYLSQEWIDAYNATLASDEAVRAALKGKSATIQMVISDAPRGEVHYWLRIADGGASAGLGDLDAPE
Ga0136449_10295984113300010379Peatlands SoilMPVKYLSQEWIDAYNAALAGDDAVHAALKGKNATLQMVISDAPQGEVRYWLRLADGDASTGLGDAA
Ga0126356_1105610913300010877Boreal Forest SoilMPVKYLSQEWIDAYNAAVAADDAVRKALKGKSAVIQMVVSEAPDGEVRYWLRIGDGTASV
Ga0137388_1101389713300012189Vadose Zone SoilMPVKYLSQEWIDAYNAALASDEAVRAAMKGKSATIQMVISDAPQGEIRYWLRIAD
Ga0137365_1042302833300012201Vadose Zone SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVISDAPEEGEIRYWLRIEDGGAAAGLGDL
Ga0137365_1107157423300012201Vadose Zone SoilMPVKYLSQEWIDAYNNALAGDAVRAAMKGKNATIQMVISDAPEEGEIRYWLRIEDGGAA
Ga0137384_1005169053300012357Vadose Zone SoilMPVKYLSQEWIDAYNAAMEQDAVRGALKGKNATIQMVVSDSPQGEIRYWLRIADGGAAA
Ga0157315_103628123300012508Arabidopsis RhizosphereMPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVISDAPRDGEIRYWLRIEDGGAAAAAVSGVTS*
Ga0164308_1038858233300012985SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISDAPEEGEIRYWLRIDDGGAAAGLGDLD
Ga0137414_107971313300015051Vadose Zone SoilMPVKYLSQEWIDAYNDALAGDAVRTAMKGKNATIQMVISDAPEEGEIRYWLRIEDGGA
Ga0182032_1108554513300016357SoilMPVKYLSQEWVDAYNAALAGDDAVRAALAGKSAALQMVISGAPQGEVRYWLRLADGSASAGL
Ga0187812_119555423300017821Freshwater SedimentMSAMPDKYLSQEWVEAYNTALAGDDAVRAALKGKNAVLQMVISGAPQGEVRYWLRIADGSASAGL
Ga0187820_100146443300017924Freshwater SedimentMPVTYLSQEWIDAYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYWLRIADADVTIRQA
Ga0187807_106469323300017926Freshwater SedimentMSAMPVKYLSQEWVEAYNTALAGDDAVRAALKGKNAVLQMVISGAPQGEVRYWLRIADG
Ga0187807_131859113300017926Freshwater SedimentMSAMPVKYLSQDWVEAYNTALAGDDAVRAALKGKNAVLQMVISGAPQGEVRYWL
Ga0187806_105197123300017928Freshwater SedimentMPVKYLSQEWVDAYNAAMAGDDAVRAALKGKSAALQMVISDAPQGEVRYWLRIADGG
Ga0187814_1009340313300017932Freshwater SedimentMPVKYLSQEWVEAYNTALAGDDAVRAALKGKNAVLQMVISGAPQGEVRYWLRIADGSASAGLGDNP
Ga0187814_1012937423300017932Freshwater SedimentMPVKYLSQEWIDAYNAAMADGAVRGAVKGKSATIQMVVSDAPQGGEVHYWLRIADG
Ga0187809_1028224923300017937Freshwater SedimentMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISDAPEEAEIRYWLRIEDGGAAAGLG
Ga0187819_1015278013300017943Freshwater SedimentMPVKYLSQEWVEAYNTALAGDDAVRAALKGKNAVLQMVISGAPQGEVRYWLRIADGSASAGLGDN
Ga0187817_1090914113300017955Freshwater SedimentMSAMPVKYLSQEWVEAYNTALAGDDAVRAALKGKNAVLQMVISGAPQGEVRYWLRIADGS
Ga0187779_1074951623300017959Tropical PeatlandMAVTYLSQEWIDQYNAAMAGDEAVRAAAKGKSAVLQMVISGAPQGEVRYWLRIADDGATAGLG
Ga0187805_1051656423300018007Freshwater SedimentMPVKYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAPQGDVRYWLRIADGGASAGLGDID
Ga0187769_1106688013300018086Tropical PeatlandMPVKYLSQEWIDAYNAALAGDDAVHAALKGKNATLQMVIWDAPQGEVHYWLRLADGGASTGLGD
Ga0210399_1005243553300020581SoilMMEMSAMPVKYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAPQGDVRY
Ga0210399_1041849713300020581SoilMPVKYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYWLRIADGG
Ga0210401_1065240913300020583SoilMPVKYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYWLRIADGGAS
Ga0210396_1014741813300021180SoilMPVKYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYWLRIADGGASAGLGDID
Ga0210385_1031278513300021402SoilMPVKFLSQEWIDAYNEAVAVDAVRTAMKGKSAVIQMLIAEAPAGEVHYYMRIGDGSVAAGLGDAEG
Ga0210397_1070412223300021403SoilMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYWLRIADGG
Ga0210397_1072881913300021403SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVIADAPEEGEIRYWLRIEDGGA
Ga0210383_1034556933300021407SoilMPLKYLSPEWIDAYNATVAADDSVRAAMKGKSAVLQMLIAEAPGGEIHYWLRIGDGTV
Ga0210390_1002850263300021474SoilMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYWLRIADGGASAGL
Ga0210402_1009778913300021478SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISDAPEEAEIRYWLRIEDGGAAAGLGDLDGP
Ga0228598_103562123300024227RhizosphereMPVKYLSQEWVEAYNAALAGDEAVRAALKGKSATLQMVISGSPQGEVRYWLRIADGGAS
Ga0247666_110435013300024323SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVISDAPQEGEIRYWLRIEDGSAAAGLGDLDG
Ga0208099_106534413300027096Forest SoilMPVKYLSQEWIDEYNAALAADDAVHAALAGKSASIQMVISDSPQGEIRYWLRIADGGAST
Ga0209073_1049399013300027765Agricultural SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKSATIQMVISDAPEEGEIRYWLRIEDGGAAAGLGDLDGP
Ga0209275_1006653633300027884SoilMPVKYLSPEWIDAYNATVAADDSVRAAMKGKNAVIQMLIAEAPDGEIHYWLRIGDGSVSAALGD
Ga0209380_1001097713300027889SoilMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGTPQGEVRYWLRIADGGASAGLGDIDGAD
Ga0209624_1091115223300027895Forest SoilMPVKYLSPEWIDAYNAVVGADDAVRKALKGKSAVIQMVVADAPAGEIHYALRIGD
Ga0209006_1019325413300027908Forest SoilMPVKYLSAEWIDAYNAAVTGDDAVAGAMKGKNAVIQMVIAEAPAGEVRYWMRIG
Ga0265338_1028717013300028800RhizosphereMPVKYLSPEWIDAYNATMAADDAVHKALKGKSAVIQMVVTDAPVGEVRYALHIGDGTASA
Ga0307314_1022862713300028872SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVISDAPRDGEIRYWLRIEDGGAA
Ga0308309_1106363223300028906SoilMPVKYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAPQGDVRYWLRIADGGASAGLGDIDGA
Ga0311340_1085030513300029943PalsaMPVKYLSPEWIDAYNAAVAADDAVAAAMKGKNAVIQMVISEAPAGEVRYWMRIGDGTVSAGLGDS
Ga0311370_1048489413300030503PalsaMPLKYLSPEWIDAYNATVAADDSVRAAMKGKNAVIQMLIAEAPDGEIHYWLRIGDGSVSAALGDAEGA
Ga0311354_1017823113300030618PalsaMPLKYLSPEWIDAYNATVAADDSVRAAMKGKNAVIQMLIAEAPDGEIHYWLRIGDGSVSAALGDAEGAEVTIS
Ga0265746_104880013300030815SoilMPVKYLSPEWIDAYNATVAADESVRAAMKGRNAVIQMLIAEGPDGEIHYWLRIGDGSVSAALGD
Ga0318516_1052288923300031543SoilMPVKYLSQEWIDAYNAALAGDDAVHAALRGKSATLQMVISGAPQGEVRYWLRL
Ga0318516_1085617823300031543SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKSATIQMVVSDAPEQGEIHYWLRMEDGG
Ga0318541_1087921813300031545SoilMPVKYLSQAWIEAYNAALAGDDAVRAALAGKSAALQMVISGAPQGEVRYWLRIA
Ga0318571_1042694713300031549SoilMSVRYLSQEWIDAYNAALARDEAVRAALKGKSAALQMVISGAPQGEVRYWLR
Ga0318561_1022562923300031679SoilMPVTYLSQEWIDQYNAALAGDEAVRAALAGKSAALQMVISGAPQGEVRYWLRIADGSATA
Ga0318574_1084820913300031680SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKSATIQMVVADAPEQGEIHYWLRIE
Ga0310686_11887056613300031708SoilMPVKYLSPEWIDAYNAAVAGDDSVRAALKGKNAVIQMVVAEAPEGEIRYWLRI
Ga0318496_1007667333300031713SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKSATIQMVVSDAPEQGEIHYWLRME
Ga0318496_1013723513300031713SoilMPVTYLSQEWIDAYNDALAGDAVRAAMKGKSATIQMVVSDAPEQGEIRYWLRIEDGGASETTIW
Ga0318496_1029123913300031713SoilMPVKYLSQEWIDAYNAALAGDDAVHAALRGKSATLQMVISGAPQGEVRYWLRLADGDASA
Ga0307476_1090029513300031715Hardwood Forest SoilMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYWLRI
Ga0318502_1074012113300031747SoilMPVTYLSQEWIDQYNAALAGDEAVRAALAGKSAALQMVISGAPQGEVRYWLRIADGSATAGLGDIADADV
Ga0307477_1066612823300031753Hardwood Forest SoilMPVKYLSQEWIDQYNTALAGNAAVRAALKGKSAALQMVISGAPQGEVRYWLRIADGGASAGLGDID
Ga0318521_1008080223300031770SoilMPVKYLSQEWIDAYNAALAGDDAVHAALRGKSATLQMVISGAPQGEVRYWLRLADGDASAGLG
Ga0318552_1041513123300031782SoilMPVTYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVVSDAPEQGEIRYWLRIEDGGASAGLGDLD
Ga0318548_1029887023300031793SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKSATIQMVVSDAPEQGEIHYWLRIEDGGAAA
Ga0318503_1010597123300031794SoilMPVKYLSQEWIDAYNAALAGDDAVHAALRGKSATLQMVISGAPQGEVRYWL
Ga0318503_1014182813300031794SoilMPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVISGAPQGEIRYWLRIADGDAST
Ga0318557_1052488223300031795SoilMPVKYLSQEWIDAYNAELAGDGAVRAALAGKSATLQMVISDAPQGEVRYWLRIADGDA
Ga0318576_1035692723300031796SoilMSVRYLSQDWIDAYNTAMAGDEAVHAALKGKSAALQMVISGAPQGEVRYWLRL
Ga0318568_1022931423300031819SoilMPVTYLSQEWIDQYNAALAGDEAVRAALAGKSAALQMVISGAPQGEVRYWLRIAD
Ga0318564_1014616413300031831SoilMPVTYLSQEWIDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGEVRYWLRIADGSATAGLGDIADADV
Ga0318499_1034572213300031832SoilMPVTYLSQEWIDQYNAALAGDEAVRAALAGKSAALQMVISGAPQGEVRYWLRIADGSATAGLGD
Ga0310917_1085385923300031833SoilMPVKYLSQAWIEAYNAALAGDDAVHAALKGKNATLQMVISGAPQGEVRYWLRLADGG
Ga0318527_1039482423300031859SoilMPVKYLSQEWVDAYNVTMAGDDAVRAALKGKSAALQMVISDAPQGEVRYWLRLADGSATAGL
Ga0318495_1039891823300031860SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKSATIQMVVSDAPEQGEIRYWLRIEDGG
Ga0306925_1130025413300031890SoilMPVKYLSQEWIDAYNAALAGDDAVHAALRGKSATLQMVISGAPQGEVRYWLRLADGDASAGLGDADGAD
Ga0306925_1227794423300031890SoilMRVRYLSQEWIDAYNDALAGDAVRAAVKGKSATIQMVVSDAPDGEVHYWLRIE
Ga0318522_1022243923300031894SoilMPVKYLSQAWIEAYNAALAGDDAVHAALKGKNATLQMVVSGAPQGEVRYWLRLADGG
Ga0318522_1032507523300031894SoilMPVKYLSQEWVDAYNAALAGDDAVRAALKGKSAALQMVISGAPQGDVRYWLRIAD
Ga0318551_1030507313300031896SoilMPVKYLSQEWIDAYNAELAGDGAVRAALAGKSATLHMVISDAPQGEVRYWLR
Ga0306923_1082068423300031910SoilMPVKYLSQEWVDAYNAALAGDDAVRAALAGKSAALQMVISGAPQGEVRYWLRIADGSASAGLGDIDGADV
Ga0308174_1172720313300031939SoilMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPRDGEIRYWLRIEDGGAAAGLGD
Ga0310912_1081504823300031941SoilMPVKYLSQEWVDAYNAALAGDEAVRAALKGKSAALQMVISGAPRGEVRYWLRIADGGA
Ga0318562_1063061713300032008SoilMPVTYLSQEWIDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGEVRYWLRIADGSATAGLG
Ga0318559_1056862813300032039SoilMPVKYLSQEWIDAYNAALAGDDAVRAAVKGKSAALQMVISDSPQGEVRYWLRIADGS
Ga0318556_1006659123300032043SoilMPVKYLSQEWIDAYNAALAGDDAVHAALRGKSATLQMVISGAPQGEVRYWLRLADGSASAGLGDID
Ga0318558_1023429613300032044SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMMVSDAPSGEVHYWLRIGDG
Ga0318524_1061098413300032067SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMMVSDAPSGEVHYWLRIGDGTASV
Ga0318524_1068366413300032067SoilMPVKYLSQEWIDQYNAAMAGDEAVRAAVKGKSAVLQMVISGAPQGEVRYWLRIADGGVAAGLGDSPDA
Ga0318553_1017537723300032068SoilMPVKYLSQEWIEAYNAALAGDDAVHAALKGKNATLQMVISGAPQGEVRYWLRLADGDAST
Ga0318525_1007391513300032089SoilMPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVISGAPQGEIRYWLRIAEA
Ga0318540_1013567613300032094SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMLVTDAPEGEVHYWLRIDDG
Ga0307470_1180779823300032174Hardwood Forest SoilMPVKYLSQEWIDAYNDALAGDAVRTAMKGKNATIQMVISDAPEEGEIRYWLRIEDG
Ga0306920_10370833813300032261SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMLVTDAPEGEVHYW
Ga0335078_1228220213300032805SoilMPVKYLSQEWVDQYNTALAGDEAVRAALKGKNATLQMVISGAPQGEVRYWLRIADGGA
Ga0335069_1009391713300032893SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVVSDAPEQGEIHYWLRIEDGGAAAGLGD
Ga0335074_1077433423300032895SoilMPVKYLSPEWIDAYNATVAADDSVRAAMKGKNAVLQMLIADAPGGEIHYWLRIGDGTVAA
Ga0335083_1009580153300032954SoilMPVKYLSQEWIDAYNATMASDDAVRAALKGKSATIQMVVSDAPQGGEVHYWLRIADGGATTG
Ga0335076_1159541513300032955SoilMPVKYLSQEWIDAYNAAMASSDAVRAALKGKNATIQMVVSDAPAGGEVHYWLRIAD
Ga0335073_1168146123300033134SoilMPVKYLSQEWIDAYNAAMASDDAVRAALKGKNATIQMVVSDAPAGGEVHYWLRI
Ga0310914_1173522913300033289SoilMPVTYLSQEWIDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGEVRYWLRIADGSATAGLGDI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.