Metagenome / Metatranscriptome Family F069475

Basic Information
Family ID	F069475
Family Type	Metagenome / Metatranscriptome
Number of Sequences	124
Average Sequence Length	44 residues
Representative Sequence	SAAVHRLAAAARPLIGTLDADQMRAAHGLAQEMGLGPVVAALR
Number of Associated Samples	117
Number of Associated Scaffolds	124

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.81 %
% of genes near scaffold ends (potentially truncated)	97.58 %
% of genes from short scaffolds (< 2000 bps)	88.71 %
Associated GOLD sequencing projects	112
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.63

Most Common Taxonomy
Group	Unclassified (58.065 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (9.677 % of family members)
Environment Ontology (ENVO)	Unclassified (20.968 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (50.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 124 Family Scaffolds
PF03480	DctP	58.06
PF06808	DctM	4.03
PF13458	Peripla_BP_6	2.42
PF12697	Abhydrolase_6	1.61
PF07813	LTXXQ	1.61
PF04290	DctQ	0.81
PF00211	Guanylate_cyc	0.81
PF02775	TPP_enzyme_C	0.81
PF13751	DDE_Tnp_1_6	0.81
PF13520	AA_permease_2	0.81

COG ID	Name	Functional Category	% Frequency in 124 Family Scaffolds
COG3678	Periplasmic chaperone Spy, Spy/CpxP family	Posttranslational modification, protein turnover, chaperones [O]	6.45
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.81

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
All Organisms	root	All Organisms	41.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
cellular organisms	root	All Organisms → cellular organisms	41.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	40.32 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	36.29 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	1.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	20.16 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.61 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	15.32 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	2.42 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	1.61 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.61 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	7.26 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	1.61 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1.61 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	1.61 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4.03 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Pararhodospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum	1.61 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	1.61 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	1.61 %
Thioalkalivibrio	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	1.61 %
Pararhodospirillum photometricum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum	1.61 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	58.06 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.42 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1.61 %
Pararhodospirillum photometricum DSM 122	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1.61 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.81 %
Thioalkalivibrio sulfidiphilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	0.81 %
Bradyrhizobium daqingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	0.81 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908028\|beta3_all_NODE_36418_len_624_cov_18_391026	Not Available	674	Open in IMG/M
2170459005\|F1BAP7Q01DW6F7	Not Available	509	Open in IMG/M
2209111022\|2221189781	Not Available	511	Open in IMG/M
3300000734\|JGI12535J11911_1019014	Not Available	541	Open in IMG/M
3300001417\|JGI20196J14858_1002659	Not Available	1549	Open in IMG/M
3300002244\|JGI24742J22300_10107284	Not Available	544	Open in IMG/M
3300003995\|Ga0055438_10253490	All Organisms → cellular organisms → Bacteria → Proteobacteria	545	Open in IMG/M
3300004019\|Ga0055439_10287088	All Organisms → cellular organisms → Bacteria → Proteobacteria	542	Open in IMG/M
3300005168\|Ga0066809_10106967	All Organisms → cellular organisms → Bacteria → Proteobacteria	690	Open in IMG/M
3300005186\|Ga0066676_10980460	Not Available	563	Open in IMG/M
3300005204\|Ga0068997_10049269	Not Available	805	Open in IMG/M
3300005330\|Ga0070690_100678070	All Organisms → cellular organisms → Bacteria → Proteobacteria	790	Open in IMG/M
3300005332\|Ga0066388_105391091	All Organisms → cellular organisms → Bacteria → Proteobacteria	648	Open in IMG/M
3300005332\|Ga0066388_106623231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	584	Open in IMG/M
3300005336\|Ga0070680_100428475	Not Available	1129	Open in IMG/M
3300005336\|Ga0070680_100610364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	936	Open in IMG/M
3300005341\|Ga0070691_10101630	Not Available	1428	Open in IMG/M
3300005435\|Ga0070714_100852475	Not Available	884	Open in IMG/M
3300005439\|Ga0070711_101162453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	666	Open in IMG/M
3300005440\|Ga0070705_100058686	Not Available	2275	Open in IMG/M
3300005458\|Ga0070681_11665624	Not Available	564	Open in IMG/M
3300005459\|Ga0068867_101774462	Not Available	580	Open in IMG/M
3300005466\|Ga0070685_10263207	Not Available	1147	Open in IMG/M
3300005545\|Ga0070695_100250218	Not Available	1289	Open in IMG/M
3300005549\|Ga0070704_101021748	All Organisms → cellular organisms → Bacteria	748	Open in IMG/M
3300005616\|Ga0068852_101673938	Not Available	659	Open in IMG/M
3300005713\|Ga0066905_101646091	Not Available	588	Open in IMG/M
3300005834\|Ga0068851_10515525	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	719	Open in IMG/M
3300005842\|Ga0068858_101006815	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	817	Open in IMG/M
3300005949\|Ga0066791_10036879	Not Available	966	Open in IMG/M
3300006041\|Ga0075023_100592846	Not Available	514	Open in IMG/M
3300006579\|Ga0074054_11954136	All Organisms → cellular organisms → Bacteria → Proteobacteria	603	Open in IMG/M
3300006806\|Ga0079220_10228833	Not Available	1096	Open in IMG/M
3300007076\|Ga0075435_100379843	Not Available	1213	Open in IMG/M
3300007076\|Ga0075435_100387800	Not Available	1200	Open in IMG/M
3300009093\|Ga0105240_11934245	Not Available	613	Open in IMG/M
3300009551\|Ga0105238_13007128	Not Available	506	Open in IMG/M
3300010046\|Ga0126384_10241923	Not Available	1454	Open in IMG/M
3300010231\|Ga0136216_1058706	Not Available	615	Open in IMG/M
3300010362\|Ga0126377_12393440	Not Available	604	Open in IMG/M
3300010371\|Ga0134125_13113104	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300010375\|Ga0105239_12694477	Not Available	580	Open in IMG/M
3300010396\|Ga0134126_10183061	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio sulfidiphilus	2518	Open in IMG/M
3300010396\|Ga0134126_10381966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	1638	Open in IMG/M
3300010399\|Ga0134127_10966532	All Organisms → cellular organisms → Bacteria → Proteobacteria	910	Open in IMG/M
3300010399\|Ga0134127_11730004	Not Available	701	Open in IMG/M
3300010399\|Ga0134127_12580044	Not Available	588	Open in IMG/M
3300010403\|Ga0134123_10077226	All Organisms → cellular organisms → Bacteria → Proteobacteria	2583	Open in IMG/M
3300011269\|Ga0137392_10266130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1413	Open in IMG/M
3300012004\|Ga0120134_1036590	All Organisms → cellular organisms → Bacteria	824	Open in IMG/M
3300012206\|Ga0137380_11297541	All Organisms → cellular organisms → Bacteria → Proteobacteria	613	Open in IMG/M
3300012948\|Ga0126375_10797620	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	747	Open in IMG/M
3300012961\|Ga0164302_10856917	Not Available	692	Open in IMG/M
3300012964\|Ga0153916_12007408	Not Available	648	Open in IMG/M
3300012985\|Ga0164308_10593527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	941	Open in IMG/M
3300013102\|Ga0157371_10111714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1940	Open in IMG/M
3300013105\|Ga0157369_10814272	Not Available	959	Open in IMG/M
3300013308\|Ga0157375_13761902	Not Available	504	Open in IMG/M
3300014205\|Ga0172380_10667918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	754	Open in IMG/M
3300014314\|Ga0075316_1126343	Not Available	629	Open in IMG/M
3300014325\|Ga0163163_12233502	Not Available	606	Open in IMG/M
3300014838\|Ga0182030_10559581	Not Available	1118	Open in IMG/M
3300014969\|Ga0157376_10289784	Not Available	1545	Open in IMG/M
3300015372\|Ga0132256_101724058	Not Available	735	Open in IMG/M
3300015374\|Ga0132255_105670955	Not Available	528	Open in IMG/M
3300016294\|Ga0182041_11789360	Not Available	569	Open in IMG/M
3300016341\|Ga0182035_11531253	All Organisms → cellular organisms → Bacteria → Proteobacteria	600	Open in IMG/M
3300016422\|Ga0182039_10242397	All Organisms → cellular organisms → Bacteria → Proteobacteria	1464	Open in IMG/M
3300017939\|Ga0187775_10161853	Not Available	805	Open in IMG/M
3300017944\|Ga0187786_10266082	Not Available	687	Open in IMG/M
3300017961\|Ga0187778_10009872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5970	Open in IMG/M
3300018029\|Ga0187787_10301415	Not Available	602	Open in IMG/M
3300018032\|Ga0187788_10464075	Not Available	542	Open in IMG/M
3300018060\|Ga0187765_11377577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense	503	Open in IMG/M
3300018073\|Ga0184624_10488037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	537	Open in IMG/M
3300019879\|Ga0193723_1118153	Not Available	737	Open in IMG/M
3300021078\|Ga0210381_10334657	Not Available	551	Open in IMG/M
3300022892\|Ga0247753_1001048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2672	Open in IMG/M
3300023067\|Ga0247743_1034830	Not Available	695	Open in IMG/M
3300023102\|Ga0247754_1001622	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3944	Open in IMG/M
3300025321\|Ga0207656_10666619	All Organisms → cellular organisms → Bacteria → Proteobacteria	532	Open in IMG/M
3300025475\|Ga0208478_1100868	Not Available	505	Open in IMG/M
3300025495\|Ga0207932_1099509	Not Available	576	Open in IMG/M
3300025544\|Ga0208078_1067353	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	745	Open in IMG/M
3300025930\|Ga0207701_11085282	All Organisms → cellular organisms → Bacteria	664	Open in IMG/M
3300025972\|Ga0207668_10066164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2561	Open in IMG/M
3300026031\|Ga0208909_1030628	Not Available	548	Open in IMG/M
3300026088\|Ga0207641_10779170	All Organisms → cellular organisms → Bacteria → Proteobacteria	945	Open in IMG/M
3300026759\|Ga0207527_100410	Not Available	1157	Open in IMG/M
3300026817\|Ga0207775_118877	Not Available	518	Open in IMG/M
3300026824\|Ga0207723_100427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4744	Open in IMG/M
3300026847\|Ga0207802_1001501	Not Available	2188	Open in IMG/M
3300026858\|Ga0207729_104064	Not Available	796	Open in IMG/M
3300026866\|Ga0207786_100751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3326	Open in IMG/M
3300026867\|Ga0207475_1000713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1535	Open in IMG/M
3300026910\|Ga0207840_1008143	Not Available	1141	Open in IMG/M
3300027435\|Ga0207553_1009477	Not Available	521	Open in IMG/M
3300027560\|Ga0207981_1059230	All Organisms → cellular organisms → Bacteria → Proteobacteria	700	Open in IMG/M
3300027680\|Ga0207826_1006384	Not Available	3194	Open in IMG/M
3300027703\|Ga0207862_1016934	Not Available	2161	Open in IMG/M
3300027775\|Ga0209177_10020494	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1627	Open in IMG/M
3300027819\|Ga0209514_10403527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	588	Open in IMG/M
3300027910\|Ga0209583_10757282	Not Available	512	Open in IMG/M
3300028556\|Ga0265337_1193774	Not Available	552	Open in IMG/M
3300028589\|Ga0247818_10224719	Not Available	1237	Open in IMG/M
3300028715\|Ga0307313_10117749	Not Available	812	Open in IMG/M
3300028876\|Ga0307286_10327048	All Organisms → cellular organisms → Bacteria → Proteobacteria	569	Open in IMG/M
3300029913\|Ga0311362_10534957	Not Available	1072	Open in IMG/M
3300031595\|Ga0265313_10025817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3106	Open in IMG/M
3300031653\|Ga0315550_1144261	Not Available	958	Open in IMG/M
3300031770\|Ga0318521_10452477	Not Available	769	Open in IMG/M
3300031779\|Ga0318566_10537671	Not Available	571	Open in IMG/M
3300031792\|Ga0318529_10348671	Not Available	689	Open in IMG/M
3300031847\|Ga0310907_10500038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	650	Open in IMG/M
3300031913\|Ga0310891_10089446	All Organisms → cellular organisms → Bacteria → Proteobacteria	930	Open in IMG/M
3300031913\|Ga0310891_10238184	Not Available	624	Open in IMG/M
3300031946\|Ga0310910_10247536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122	1393	Open in IMG/M
3300032001\|Ga0306922_10179345	All Organisms → cellular organisms → Bacteria	2271	Open in IMG/M
3300032076\|Ga0306924_11131472	Not Available	851	Open in IMG/M
3300032770\|Ga0335085_10422595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1541	Open in IMG/M
3300032828\|Ga0335080_10962275	Not Available	872	Open in IMG/M
3300033433\|Ga0326726_10929071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	844	Open in IMG/M
3300033760\|Ga0314870_021249	All Organisms → cellular organisms → Bacteria → Proteobacteria	572	Open in IMG/M
3300034817\|Ga0373948_0044229	All Organisms → cellular organisms → Bacteria → Proteobacteria	940	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	79.84%
Host-Associated	Host-Associated	18.55%
Engineered	Engineered	1.61%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	71.77%
Plants	Host-Associated → Plants	18.55%
Aquatic	Environmental → Aquatic	8.06%
Solid Waste	Engineered → Solid Waste	0.81%
Lab Enrichment	Engineered → Lab Enrichment	0.81%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	70.16%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.29%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.45%
Marine	Environmental → Aquatic → Marine	3.23%
Freshwater	Environmental → Aquatic → Freshwater	2.42%
Sediment	Environmental → Aquatic → Sediment	2.42%
Peat	Environmental → Terrestrial → Peat	1.61%
Roots	Host-Associated → Plants → Roots	0.81%
Landfill	Engineered → Solid Waste → Landfill	0.81%
Unclassified	Engineered → Lab Enrichment → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	41.13%
Loam	Environmental → Terrestrial → Soil → Loam	18.55%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	10.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.26%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.65%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.03%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.42%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.61%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.81%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.81%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.81%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.81%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.81%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	0.81%
Unclassified	Engineered → Lab Enrichment → Unclassified → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	16.94%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	9.68%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.87%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.87%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.26%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.26%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.65%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	4.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.03%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.23%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.42%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.42%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.61%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.61%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.81%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.81%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	0.81%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.81%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.81%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	0.81%
Unclassified	Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	9.68%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	5.65%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.03%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.03%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.03%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	3.23%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.23%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.23%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.42%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.42%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.42%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.42%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.42%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.61%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.61%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.61%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.61%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.61%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.61%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.61%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.61%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.81%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.81%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	0.81%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	0.81%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.81%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.81%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.81%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.81%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.81%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.81%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	0.81%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.81%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.81%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.81%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.81%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.81%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.81%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.81%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.81%
Landfill Leachate	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate	0.81%
Soil	Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil	0.81%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908028	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3	Environmental	Open in IMG/M
2170459005	Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm	Environmental	Open in IMG/M
2209111022	Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment	Environmental	Open in IMG/M
3300000734	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81	Environmental	Open in IMG/M
3300001417	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012	Environmental	Open in IMG/M
3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Host-Associated	Open in IMG/M
3300003995	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2	Environmental	Open in IMG/M
3300004019	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2	Environmental	Open in IMG/M
3300005168	Soil and rhizosphere microbial communities from Laval, Canada - mgLPC	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005204	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005949	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006579	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010231	Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week5, replicate 1	Engineered	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300012004	Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014205	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG	Engineered	Open in IMG/M
3300014314	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014838	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017939	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG	Environmental	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental	Open in IMG/M
3300018032	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300021078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo	Environmental	Open in IMG/M
3300022892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5	Environmental	Open in IMG/M
3300023067	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5	Environmental	Open in IMG/M
3300023102	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025475	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes)	Environmental	Open in IMG/M
3300025495	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes)	Environmental	Open in IMG/M
3300025544	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026031	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd (SPAdes)	Environmental	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026759	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-12 (SPAdes)	Environmental	Open in IMG/M
3300026817	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes)	Environmental	Open in IMG/M
3300026824	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes)	Environmental	Open in IMG/M
3300026847	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes)	Environmental	Open in IMG/M
3300026858	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 69 (SPAdes)	Environmental	Open in IMG/M
3300026866	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 76 (SPAdes)	Environmental	Open in IMG/M
3300026867	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-12 (SPAdes)	Environmental	Open in IMG/M
3300026910	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes)	Environmental	Open in IMG/M
3300027435	Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K3-12 (SPAdes)	Environmental	Open in IMG/M
3300027560	Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)	Environmental	Open in IMG/M
3300027680	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)	Environmental	Open in IMG/M
3300027703	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027819	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)	Environmental	Open in IMG/M
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental	Open in IMG/M
3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Host-Associated	Open in IMG/M
3300028589	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1	Environmental	Open in IMG/M
3300028715	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203	Environmental	Open in IMG/M
3300028876	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140	Environmental	Open in IMG/M
3300029913	III_Bog_N3 coassembly	Environmental	Open in IMG/M
3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Host-Associated	Open in IMG/M
3300031653	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031779	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22	Environmental	Open in IMG/M
3300031792	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031913	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033760	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_C	Environmental	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.63
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.63
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F069475

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
beta3_all_00485830	2124908028	Soil	IVLNSAAVERLVVAARPLIAKLNDEQKQAAGQLAQEMGLGSVVMAALN
E41_04515590	2170459005	Grass Soil	VVTIVLNSAAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR
2222003664	2209111022	Grass Soil	AVSARPLMAMLDADQMRAAHGLAREMGLGPVVAALK
JGI12535J11911_10190143	3300000734	Tropical Forest Soil	VSIALNSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN*
JGI20196J14858_10026591	3300001417	Arctic Peat Soil	SRRVISIVLNSAAVERLVVAARPLIAKLNDEQKQAAGQLAQEMGLGSVVMAALN*
JGI24742J22300_101072841	3300002244	Corn, Switchgrass And Miscanthus Rhizosphere	AAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK*
Ga0055438_102534901	3300003995	Natural And Restored Wetlands	NSATIQKLAAAARPLIGVLDAEQMRTAHGLAQEMGLGPVVATLR*
Ga0055439_102870881	3300004019	Natural And Restored Wetlands	RVVSIALNSATIQKLAAAARPLIGVLDAEQMRTAHGLAQEMGLGPVVATLR*
Ga0066809_101069671	3300005168	Soil	QRLAVAARPLIGTLDPEQMRAAQGLAQEMGLGPVVAALR*
Ga0066676_109804601	3300005186	Soil	VVLNSAAVQRLAVAARPLIAMLDDEQRRAAHGLAQEMGLGPVVAALR*
Ga0068997_100492691	3300005204	Natural And Restored Wetlands	VSIALNSATIQKLAAAARPLIGVLDAEQMRTAHGLAQEMGLGPVVAALR*
Ga0070690_1006780702	3300005330	Switchgrass Rhizosphere	VHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK*
Ga0066388_1053910912	3300005332	Tropical Forest Soil	VTVVLNSSAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR*
Ga0066388_1066232311	3300005332	Tropical Forest Soil	AAVQRLAVAARPLVASLDQEQMRAAQGLAQEMGLGPVVAALR*
Ga0070680_1004284752	3300005336	Corn Rhizosphere	HRVVSIVLNSAAVQRLAVAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK*
Ga0070680_1006103641	3300005336	Corn Rhizosphere	QVALNSATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK*
Ga0070691_101016301	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	ATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK*
Ga0070714_1008524752	3300005435	Agricultural Soil	SIVLNSAAVQRLAVAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK*
Ga0070711_1011624532	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	TSAAVQRLASAARPLIAALSDEQKRSAQSLAQEMGLGPVVAALN*
Ga0070705_1000586862	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	RVSKRAVQIALNSATIHRLAAAARPLVKTFDEHQMQTAQGLAQQMGLGPVVAALK*
Ga0070681_116656241	3300005458	Corn Rhizosphere	SIQRVASAARPLIAVLDFQQLQAASGLCNQMGLGPVVAALR*
Ga0068867_1017744622	3300005459	Miscanthus Rhizosphere	RVVSIVLNSAAVQRLAVAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK*
Ga0070685_102632071	3300005466	Switchgrass Rhizosphere	HRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK*
Ga0070695_1002502182	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	LNSAAVQRLAVAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK*
Ga0070704_1010217481	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	RAVQIALNSATIHRLAAAARPLVKTFDEHQMQTAQGLAQQMGLGPVVAALK*
Ga0068852_1016739382	3300005616	Corn Rhizosphere	IARVAAAARPLAAVLDQEQMQAASGLASEMGLGPVVAALR*
Ga0066905_1016460911	3300005713	Tropical Forest Soil	VQRLAVAARPLVASLDHEQMRAAQGLAQEMGLGPVVAALR*
Ga0068851_105155252	3300005834	Corn Rhizosphere	AAARPLAAVLDQEQMQAASGLASEMGLGPVVAALR*
Ga0068858_1010068153	3300005842	Switchgrass Rhizosphere	ALNSATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK*
Ga0066791_100368791	3300005949	Soil	VERLVVAARPLIAKLDDQQKQAAGQLAQEMGLGSVVMAALN*
Ga0075023_1005928462	3300006041	Watersheds	NSAAVQRLAVAARPLIAKLDEDQMRAAHGLAAEMGLGPVVAALR*
Ga0074054_119541361	3300006579	Soil	VSVVLNSAAVQRLAVSARPLIAMLDADQMRAAHGLAREMGLGPVVAALK*
Ga0079220_102288331	3300006806	Agricultural Soil	KLAVAARPLIGVLNDQQIQTAHGLAQEMGLGPVVAALR*
Ga0075435_1003798432	3300007076	Populus Rhizosphere	RVSKRVVQIALNSATVHRLVAAARPLVKTFDEHQMQTAHGLAQEMGLGPVVAALK*
Ga0075435_1003878001	3300007076	Populus Rhizosphere	VVLNSSAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR*
Ga0105240_119342452	3300009093	Corn Rhizosphere	VAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR*
Ga0105238_130071281	3300009551	Corn Rhizosphere	ALNSATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK*
Ga0126384_102419231	3300010046	Tropical Forest Soil	AVQRLAVAARPLIAMLDAEQMRAAHSLAQEMGLGPVVAALR*
Ga0136216_10587061	3300010231	Soil	XXXNAAIARVAAAARPLAAVLDQEQMQAASGLANEMGLGPVVAALR*
Ga0126377_123934402	3300010362	Tropical Forest Soil	ISNRVVTVVLNSSAIQRLAVAARPLVASLDHDQMRAAQGLAQEIGLGPVVAALR*
Ga0134125_131131041	3300010371	Terrestrial Soil	IVLDNAAIARLAAAARPLIAVLDQEQMQAASGLASEMGLGPVVAAMR*
Ga0105239_126944772	3300010375	Corn Rhizosphere	NSATVHRLVAAARPLVKTFDEQQMQTAHGLAQEMGLGPVVAAMK*
Ga0134126_101830611	3300010396	Terrestrial Soil	VSIVLDNAAIARLAAAARPLIAVLDQEQMQAASGLASEMGLGPVVAAMR*
Ga0134126_103819661	3300010396	Terrestrial Soil	IARLAAAARPLIAVLDQEQMQAASGLAGEMGLGPVVAALR*
Ga0134127_109665321	3300010399	Terrestrial Soil	IAARPLVKTFDDQQMQTAHGLAQEMGLGSVVAALK*
Ga0134127_117300042	3300010399	Terrestrial Soil	NSATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK*
Ga0134127_125800441	3300010399	Terrestrial Soil	RLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK*
Ga0134123_100772261	3300010403	Terrestrial Soil	VQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR*
Ga0137392_102661301	3300011269	Vadose Zone Soil	VVLNSAAVQRLAVAARPLVAMLNEEQMRAAHGLAREMGLGPVVAALK*
Ga0120134_10365903	3300012004	Permafrost	VERLAVAARPLIARLDDGQKQAAGQLAQEMGLGPVVMAALN*
Ga0137380_112975412	3300012206	Vadose Zone Soil	RVVSVVLNSAAVQRLAVAARPLVAMLNEEQMRAAHGLAREMGLGPVVAALK*
Ga0126375_107976202	3300012948	Tropical Forest Soil	SAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR*
Ga0164302_108569172	3300012961	Soil	GAIHRIASAARPLMATLDLGQLQAANGLASEMGLGAVVAALR*
Ga0153916_120074082	3300012964	Freshwater Wetlands	SIVLNSAAVERLAVAARPLIAVLDDEQKRAASGLAQEMGLGAVVVAALK*
Ga0164308_105935272	3300012985	Soil	AVSIVLTSAAVQRLASAARPLIAALSDEQKRSAQSLAQEMGLGPVVAALN*
Ga0157371_101117141	3300013102	Corn Rhizosphere	AARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK*
Ga0157369_108142721	3300013105	Corn Rhizosphere	RLALAARPLVEKLDYQQMQTANGLAQEMGLGPVVAALR*
Ga0157375_137619021	3300013308	Miscanthus Rhizosphere	AARPLVKTFDEQQMQTAHGLAQEMGLGPVVAAMK*
Ga0172380_106679181	3300014205	Landfill Leachate	ISNRVIQIVLTSAAVERLAVAARPLIAVLDDNQKRAASGLAQEMGLGPVVMAALK*
Ga0075316_11263431	3300014314	Natural And Restored Wetlands	IRRLAVAARPLLAALTDEQKQTAFGVAQEMGLGPVLAALN*
Ga0163163_122335021	3300014325	Switchgrass Rhizosphere	TVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK*
Ga0182030_105595812	3300014838	Bog	VVSIVLNSAAVERLAVAARPLIVRLDDGQKQAAGQLAQEMGLGPVVMAALN*
Ga0157376_102897841	3300014969	Miscanthus Rhizosphere	QRLAVAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK*
Ga0132256_1017240581	3300015372	Arabidopsis Rhizosphere	VAARPLIAMLDADQMRAAHGLAREMGLGPVVAALK*
Ga0132255_1056709551	3300015374	Arabidopsis Rhizosphere	QRVASAARPLIAVLDFRQLQAASGLANQMGLGPVVAALR*
Ga0182041_117893601	3300016294	Soil	SQRVVSIALNSATIARLASAARPLVAVLDEQQKRPAGQLAQEMGLGEVVMAVLN
Ga0182035_115312532	3300016341	Soil	VLNSAAVHRLAVAARPLIATLDADQLRAAHGLAQEMGLGPVVAALK
Ga0182039_102423973	3300016422	Soil	SIALNSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN
Ga0187775_101618531	3300017939	Tropical Peatland	KLAVAARPLIGVLDAEQMRTAHGLAQEMGLGPVVAALR
Ga0187786_102660822	3300017944	Tropical Peatland	AAVQRLAASARPLISKLDEDQMRAAHGLAAEMGLGPVVAALK
Ga0187778_100098729	3300017961	Tropical Peatland	AAAARPLIGVLDAQQMQTAHGLAQEMGLGPVVAALR
Ga0187787_103014151	3300018029	Tropical Peatland	ISQRVVSIALNSAAVARLAAAARPLVAVLDDDQKRAAGQLAQEMGLSEVVMAALN
Ga0187788_104640752	3300018032	Tropical Peatland	DGAAVQRLAFAARPLVAVLDDEQKRTALALAQQIGLGPVLAALN
Ga0187765_113775771	3300018060	Tropical Peatland	RRLVQIVLDSAAVERLAVAARPLIARLTDRQKQAAGELAQEMGLGPVVMAALN
Ga0184624_104880371	3300018073	Groundwater Sediment	SAAVHRLAAAARPLIGTLDADQMRAAHGLAQEMGLGPVVAALR
Ga0193723_11181532	3300019879	Soil	LAVSARPLIAMLDADQMRAAHGLAREMGLGPVVAALK
Ga0210381_103346571	3300021078	Groundwater Sediment	LAIAARPLVASLDHEQMRAAQGLAQEMGLGPVVAALR
Ga0247753_10010481	3300022892	Soil	VAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK
Ga0247743_10348301	3300023067	Soil	TVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK
Ga0247754_10016225	3300023102	Soil	ATVHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGSVVAALK
Ga0207656_106666191	3300025321	Corn Rhizosphere	AAARPLAAVLDQEQMQAASGLASEMGLGPVVAALR
Ga0208478_11008681	3300025475	Arctic Peat Soil	SIVLNSAAVERLVVAARPLIAKLDDQQKQAAGQLAQEMGLGSVVMAALN
Ga0207932_10995091	3300025495	Arctic Peat Soil	ISIVLNSAAVERLVVAARPLIAKLNDEQKQAAGQLAQEMGLGSVVMAALN
Ga0208078_10673532	3300025544	Arctic Peat Soil	NSAAVERLAVAARPLIARLDDGQKQAAGQLAQEMGLGPVVMAALN
Ga0207701_110852822	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	VRRVSKRAVQIALNSATIHRLAAAARPLVKTFDEHQMQTAQGLAQQMGLGPVVAALK
Ga0207668_100661644	3300025972	Switchgrass Rhizosphere	VLNSSAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR
Ga0208909_10306282	3300026031	Natural And Restored Wetlands	AIAARPLIAALRDDQKQMALGLAQEMGLGPVLAALN
Ga0207641_107791701	3300026088	Switchgrass Rhizosphere	RVVQIALNSATVHRLVAAARPLVKTFDEQQMQTAHGLAQEMGLGPVVAAMK
Ga0207527_1004101	3300026759	Soil	SKRVVQIALNSATVHRLVAAARPLVKTFDEHQMQTAHGLAQEMGLGPVVAALK
Ga0207775_1188771	3300026817	Tropical Forest Soil	LASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN
Ga0207723_1004271	3300026824	Tropical Forest Soil	SATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN
Ga0207802_10015011	3300026847	Tropical Forest Soil	AARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN
Ga0207729_1040641	3300026858	Tropical Forest Soil	VSQRVVSIALNSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN
Ga0207786_1007513	3300026866	Tropical Forest Soil	VSIALNSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN
Ga0207475_10007132	3300026867	Soil	KRVVQIALNSATVHRLVAAARPLVKTFDEHQMQTAHGLAQEMGLGPVVAALK
Ga0207840_10081431	3300026910	Tropical Forest Soil	RLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN
Ga0207553_10094771	3300027435	Soil	LVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK
Ga0207981_10592302	3300027560	Soil	QRLAVAARPLIGTLDPEQMRAAQGLAQEMGLGPVVAALR
Ga0207826_10063845	3300027680	Tropical Forest Soil	SATVARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN
Ga0207862_10169341	3300027703	Tropical Forest Soil	FVHRVSQRVVSIALNSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN
Ga0209177_100204941	3300027775	Agricultural Soil	AVAARPLIAILDPEQMRAAHSLAQEMGLGPVVAALK
Ga0209514_104035271	3300027819	Groundwater	AVAARPLIAVLDDDQKRVASGLAQEMGLGAVVTAALK
Ga0209583_107572822	3300027910	Watersheds	NSAAVQRLAVAARPLIAKLDEDQMRAAHGLAAEMGLGPVVAALR
Ga0265337_11937742	3300028556	Rhizosphere	QVVSVVLNSAAVERLAVAARPLIAKLDQEQIRAASGLAQEMGLGPVVMAALR
Ga0247818_102247191	3300028589	Soil	HRLVAAARPLVKTFDEHQMQTAHGLAQEMGLGPVVAALK
Ga0307313_101177492	3300028715	Soil	NSAAVHRLAAAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR
Ga0307286_103270481	3300028876	Soil	AAAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR
Ga0311362_105349571	3300029913	Bog	VLNSAAVERLAVAARPLVAMLNDEQMHSASGLAQEMGLGPVVLAALR
Ga0265313_100258174	3300031595	Rhizosphere	VAARPLIAKLDDEQMRAAHGLAAEMGLGPVVAALR
Ga0315550_11442612	3300031653	Salt Marsh Sediment	HRVVSVVLDSVAIKRLVAAARPLVATLRDDQKQTALGLAQEMGLGPVLAALN
Ga0318521_104524772	3300031770	Soil	VLVVLNSAAVQRLAVAARPLIGMLDAEQMRAAHGLAQEMGLGPVVAALK
Ga0318566_105376712	3300031779	Soil	AKPCAARPLIGMLDAEQMRAAHGLAQEMGLGPVVAALK
Ga0318529_103486711	3300031792	Soil	VSVVLNSAAVQRLAVAARPLIGMLDAEQMRAAHGLAQEMGLGPVVAALK
Ga0310907_105000381	3300031847	Soil	VVQVALNSATIHRLTAAVRPLVKTFDEHQMQTAHGLAQEMGLGPVVAALK
Ga0310891_100894461	3300031913	Soil	VAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK
Ga0310891_102381842	3300031913	Soil	SSAVQRLAVAARPLIGTLDAEQMRAAQGLAQEMGLGPVVAALR
Ga0310910_102475361	3300031946	Soil	SVVLNSAAVQRLAVAARPLIGMLDAEQMRAAHGLAQEMGLGPVVAALK
Ga0306922_101793451	3300032001	Soil	TIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN
Ga0306924_111314722	3300032076	Soil	NSATIARLASAARPLVAVLDEQQKRAAGQLAQEMGLGEVVMAALN
Ga0335085_104225951	3300032770	Soil	LDGAAVHRLAVAARPLIAVLRDDQKQSALALAQEMGLAPVLAALN
Ga0335080_109622751	3300032828	Soil	AVVLDSAAVERLAVSARPLVAVLDDDQKRTAMAMAQQMGLGPVLAALN
Ga0326726_109290711	3300033433	Peat Soil	TQRVVSIVLNSAAVERLAVAARPLIARLDDGQKQAAGQLAQEMGLGPVVMAALN
Ga0314870_021249_2_136	3300033760	Peatland	SSSAVQRLAVAARPLIAKLDEDQVRAAHGLAQEMGLGPVVAALR
Ga0373948_0044229_1_123	3300034817	Rhizosphere Soil	VHRLVAAARPLAKTLDEQQMRTAHGLAQEMGFGPVVAALK

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign