Basic Information | |
---|---|
Family ID | F069431 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 42 residues |
Representative Sequence | PPAGCRALLDWLAGIVGPIDGDRPFGEDLERLIEAPWPPA |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.39 % |
% of genes from short scaffolds (< 2000 bps) | 87.90 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.677 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.839 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.419 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.613 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.88% β-sheet: 0.00% Coil/Unstructured: 69.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF01479 | S4 | 5.65 |
PF00710 | Asparaginase | 5.65 |
PF01420 | Methylase_S | 3.23 |
PF00583 | Acetyltransf_1 | 3.23 |
PF07690 | MFS_1 | 2.42 |
PF00441 | Acyl-CoA_dh_1 | 2.42 |
PF00440 | TetR_N | 1.61 |
PF01494 | FAD_binding_3 | 1.61 |
PF02371 | Transposase_20 | 1.61 |
PF11017 | DUF2855 | 1.61 |
PF00528 | BPD_transp_1 | 1.61 |
PF07592 | DDE_Tnp_ISAZ013 | 1.61 |
PF13673 | Acetyltransf_10 | 1.61 |
PF06441 | EHN | 1.61 |
PF02952 | Fucose_iso_C | 0.81 |
PF00106 | adh_short | 0.81 |
PF07729 | FCD | 0.81 |
PF08281 | Sigma70_r4_2 | 0.81 |
PF13439 | Glyco_transf_4 | 0.81 |
PF13459 | Fer4_15 | 0.81 |
PF02615 | Ldh_2 | 0.81 |
PF00135 | COesterase | 0.81 |
PF00392 | GntR | 0.81 |
PF08450 | SGL | 0.81 |
PF07969 | Amidohydro_3 | 0.81 |
PF00916 | Sulfate_transp | 0.81 |
PF12681 | Glyoxalase_2 | 0.81 |
PF08241 | Methyltransf_11 | 0.81 |
PF03984 | DUF346 | 0.81 |
PF08734 | GYD | 0.81 |
PF10604 | Polyketide_cyc2 | 0.81 |
PF00561 | Abhydrolase_1 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 11.29 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.23 |
COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 3.23 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.42 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.61 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 1.61 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.61 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.61 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.61 |
COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.81 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.81 |
COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.81 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.81 |
COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.81 |
COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.81 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.81 |
COG2407 | L-fucose isomerase or related protein | Carbohydrate transport and metabolism [G] | 0.81 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.81 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.81 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.48 % |
Unclassified | root | N/A | 14.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_107061353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1004 | Open in IMG/M |
3300001593|JGI12635J15846_10546180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 679 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100148149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 2217 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10034924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1850 | Open in IMG/M |
3300004082|Ga0062384_100248069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 1078 | Open in IMG/M |
3300004092|Ga0062389_101796661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 793 | Open in IMG/M |
3300004157|Ga0062590_103036259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
3300005344|Ga0070661_100175703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1628 | Open in IMG/M |
3300005435|Ga0070714_101703984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
3300005441|Ga0070700_100735962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 788 | Open in IMG/M |
3300005467|Ga0070706_101715932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
3300005537|Ga0070730_11013262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
3300005538|Ga0070731_10704146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 671 | Open in IMG/M |
3300005591|Ga0070761_10518129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 737 | Open in IMG/M |
3300005602|Ga0070762_11260949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
3300006028|Ga0070717_10507338 | Not Available | 1090 | Open in IMG/M |
3300006028|Ga0070717_10960028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
3300006059|Ga0075017_100957660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
3300009137|Ga0066709_103638172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus amargosae | 559 | Open in IMG/M |
3300009521|Ga0116222_1276712 | Not Available | 724 | Open in IMG/M |
3300009553|Ga0105249_10353157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1490 | Open in IMG/M |
3300009672|Ga0116215_1033745 | Not Available | 2352 | Open in IMG/M |
3300009698|Ga0116216_10083621 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
3300009700|Ga0116217_10430496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
3300010152|Ga0126318_10070691 | Not Available | 556 | Open in IMG/M |
3300010359|Ga0126376_13160472 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300010360|Ga0126372_10848816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 910 | Open in IMG/M |
3300010360|Ga0126372_11102871 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300010371|Ga0134125_11474881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
3300010371|Ga0134125_12619459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
3300010371|Ga0134125_12662446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
3300010376|Ga0126381_104321989 | Not Available | 550 | Open in IMG/M |
3300010379|Ga0136449_104368851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 522 | Open in IMG/M |
3300010396|Ga0134126_11017119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 927 | Open in IMG/M |
3300010398|Ga0126383_12088194 | Not Available | 654 | Open in IMG/M |
3300010876|Ga0126361_10561522 | Not Available | 1670 | Open in IMG/M |
3300010876|Ga0126361_10885090 | Not Available | 1592 | Open in IMG/M |
3300010880|Ga0126350_11639530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 833 | Open in IMG/M |
3300011120|Ga0150983_14974807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 711 | Open in IMG/M |
3300012205|Ga0137362_11106098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 673 | Open in IMG/M |
3300012944|Ga0137410_10548832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 949 | Open in IMG/M |
3300013104|Ga0157370_10267071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1581 | Open in IMG/M |
3300013105|Ga0157369_10952162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
3300013307|Ga0157372_11422447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
3300016387|Ga0182040_11509605 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300017657|Ga0134074_1331069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
3300017926|Ga0187807_1019510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2089 | Open in IMG/M |
3300017926|Ga0187807_1179136 | Not Available | 683 | Open in IMG/M |
3300017937|Ga0187809_10210153 | Not Available | 693 | Open in IMG/M |
3300017972|Ga0187781_10086531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia | 2167 | Open in IMG/M |
3300017974|Ga0187777_11011187 | Not Available | 602 | Open in IMG/M |
3300018001|Ga0187815_10077230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1399 | Open in IMG/M |
3300018001|Ga0187815_10495679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 523 | Open in IMG/M |
3300018006|Ga0187804_10454140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300018037|Ga0187883_10497185 | Not Available | 628 | Open in IMG/M |
3300018086|Ga0187769_11057138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces lunaelactis | 614 | Open in IMG/M |
3300020579|Ga0210407_10556127 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 895 | Open in IMG/M |
3300020582|Ga0210395_10038651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3498 | Open in IMG/M |
3300021180|Ga0210396_10826906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
3300021181|Ga0210388_10418243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1178 | Open in IMG/M |
3300021402|Ga0210385_11089506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
3300021403|Ga0210397_10010998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5459 | Open in IMG/M |
3300021405|Ga0210387_10146004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2020 | Open in IMG/M |
3300021405|Ga0210387_10590735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 987 | Open in IMG/M |
3300021476|Ga0187846_10445723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 530 | Open in IMG/M |
3300021479|Ga0210410_10480056 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1111 | Open in IMG/M |
3300024222|Ga0247691_1043319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
3300025134|Ga0207416_1079351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1242 | Open in IMG/M |
3300025909|Ga0207705_10526897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 918 | Open in IMG/M |
3300025917|Ga0207660_10147345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1805 | Open in IMG/M |
3300026557|Ga0179587_10784580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
3300027676|Ga0209333_1203874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 521 | Open in IMG/M |
3300027768|Ga0209772_10308322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 502 | Open in IMG/M |
3300027853|Ga0209274_10128206 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300027853|Ga0209274_10376190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 733 | Open in IMG/M |
3300027867|Ga0209167_10230634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 991 | Open in IMG/M |
3300028718|Ga0307307_10030617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus | 1527 | Open in IMG/M |
3300028747|Ga0302219_10099432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1099 | Open in IMG/M |
3300028775|Ga0302231_10527215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 500 | Open in IMG/M |
3300028819|Ga0307296_10609702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
3300028906|Ga0308309_10252323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1477 | Open in IMG/M |
3300030007|Ga0311338_10225117 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
3300031549|Ga0318571_10017735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1817 | Open in IMG/M |
3300031564|Ga0318573_10245347 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300031564|Ga0318573_10529290 | Not Available | 635 | Open in IMG/M |
3300031640|Ga0318555_10435454 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300031723|Ga0318493_10529703 | Not Available | 653 | Open in IMG/M |
3300031747|Ga0318502_10698796 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300031748|Ga0318492_10071780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1658 | Open in IMG/M |
3300031770|Ga0318521_10308835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 932 | Open in IMG/M |
3300031781|Ga0318547_10075777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1874 | Open in IMG/M |
3300031782|Ga0318552_10743876 | Not Available | 500 | Open in IMG/M |
3300031792|Ga0318529_10484038 | Not Available | 575 | Open in IMG/M |
3300031845|Ga0318511_10072196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1428 | Open in IMG/M |
3300031860|Ga0318495_10136673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1104 | Open in IMG/M |
3300031880|Ga0318544_10229911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 717 | Open in IMG/M |
3300031954|Ga0306926_12077191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
3300031962|Ga0307479_11880889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
3300032008|Ga0318562_10316785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces lunaelactis | 907 | Open in IMG/M |
3300032008|Ga0318562_10572719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces lunaelactis | 653 | Open in IMG/M |
3300032010|Ga0318569_10008776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3715 | Open in IMG/M |
3300032010|Ga0318569_10166394 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300032044|Ga0318558_10442237 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300032052|Ga0318506_10169557 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Gordonia | 959 | Open in IMG/M |
3300032060|Ga0318505_10080651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1448 | Open in IMG/M |
3300032065|Ga0318513_10363360 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300032066|Ga0318514_10234582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
3300032067|Ga0318524_10791956 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300032076|Ga0306924_10180473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2422 | Open in IMG/M |
3300032160|Ga0311301_10339305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 2362 | Open in IMG/M |
3300032160|Ga0311301_11305589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 916 | Open in IMG/M |
3300032205|Ga0307472_100068988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2296 | Open in IMG/M |
3300032261|Ga0306920_100106151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4160 | Open in IMG/M |
3300032261|Ga0306920_100882690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1308 | Open in IMG/M |
3300032261|Ga0306920_101176655 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300032770|Ga0335085_10931412 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300032782|Ga0335082_10511245 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300032896|Ga0335075_10365978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1557 | Open in IMG/M |
3300032896|Ga0335075_10386167 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
3300032896|Ga0335075_11665089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300033289|Ga0310914_10177195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1895 | Open in IMG/M |
3300033289|Ga0310914_11258173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. TF02-9 | 642 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.84% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.03% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.03% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.03% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.03% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.23% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.42% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.42% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.42% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.42% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.42% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.81% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1070613533 | 3300000955 | Soil | LLLDWLAGIVDPIEEDRPFGEDIERLIGAPWPPA* |
JGI12635J15846_105461803 | 3300001593 | Forest Soil | PVRTLLDWLAGIIAPIDDDRPFGEDLQHLIEAPVTCFP* |
JGIcombinedJ26739_1001481491 | 3300002245 | Forest Soil | RALLDWLAGIVGPIDGDRPFGEDLQHLIETPWPPA* |
JGIcombinedJ51221_100349243 | 3300003505 | Forest Soil | SGLGGRAPTDRCAALLDWLAGIIGPIDGDRTFGEDIERLINAPWPPA* |
Ga0062384_1002480692 | 3300004082 | Bog Forest Soil | DRPPPAGSRALLAWLAGIIAPIDGDRPFGEDLQRLIEATWPPAQTT* |
Ga0062389_1017966612 | 3300004092 | Bog Forest Soil | PAGSRALLAWLAGIIAPIDGDRPFGEDLQRLIEATWPPAQTT* |
Ga0062590_1030362592 | 3300004157 | Soil | GFQAAALSGPPPPAGSRVLLDWLAGIVDPIEEDRPFGEDIERLIGAPWPPA* |
Ga0070661_1001757034 | 3300005344 | Corn Rhizosphere | QAAALSGPPPAGSRVLLDWLAGIVDPIVEDRPFGEDIERLIGAPWPPA* |
Ga0070714_1017039842 | 3300005435 | Agricultural Soil | GYQATALSGRPPAAGCRALLDWLAGIVGVIDDDRPFGEDLQHLIEAPWPPA* |
Ga0070700_1007359621 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | PPPAGSRVLLDWLAGIVDPIEEDRPFGEDIERLIGAPWPPA* |
Ga0070706_1017159322 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SGQPAPAGSRALLDWLGGLVDPIEDDRPFGEDIERLTGASWPPA* |
Ga0070730_110132621 | 3300005537 | Surface Soil | GCRALLDWLAGIVGVIDDDRPFGEDLQHLIEAPWPPAL* |
Ga0070731_107041463 | 3300005538 | Surface Soil | GSRALLEWLAGIVAPIDGDRPFGEDLQHLIEAPWPPA* |
Ga0070761_105181293 | 3300005591 | Soil | RALLDWLAGIIAPIDGDRPFGEDLQHLIEASWPPA* |
Ga0070762_112609492 | 3300005602 | Soil | ALSGRPQPAGSRLLLDWLAGIVDPIEEDRPFGEDIERLITAPWPPA* |
Ga0070717_105073384 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VDWLAGVIGPIEDDRPFGEDLERLTEASFTPPATA* |
Ga0070717_109600283 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LSGPPPPAGSRVLLDWLAGIVDPIEEDRPFGEDIERLIGAPWPPA* |
Ga0075017_1009576602 | 3300006059 | Watersheds | CRALLDWMAVIVGPIDGDRPFGEDIERLIQAPWPPA* |
Ga0066709_1036381722 | 3300009137 | Grasslands Soil | AGFEAAALSGRLPPAGSRVLLDWLGGIVGPIEEDRPFGEDIERLAGAPWRPA* |
Ga0116222_12767123 | 3300009521 | Peatlands Soil | RPPPPGCRTLLDWMAVIVGPIDGDRPFGEDIERLVQAPWPPV* |
Ga0105249_103531573 | 3300009553 | Switchgrass Rhizosphere | LLDWLAGIVDPIEEDRPFGEDIERLIGAPWPPSDQPAA* |
Ga0116215_10337451 | 3300009672 | Peatlands Soil | RTLLDWMAVIVGPIDGDRPFGEDIERLVQAPWPPV* |
Ga0116216_100836213 | 3300009698 | Peatlands Soil | SRALLDWLAGIIGPIEGDRPFGEDLERLIGAPWPPS* |
Ga0116217_104304962 | 3300009700 | Peatlands Soil | LAERPPPPGCRALLDWLTVIIGPIDGDRTFGEDIERLIQAPWPPVAG* |
Ga0126318_100706911 | 3300010152 | Soil | QAAALSGQPPPDGCRALLDWLSGIVDPIDHDRPFGEDLERLIGAPWPPA* |
Ga0126376_131604722 | 3300010359 | Tropical Forest Soil | RALLGWLAGIIPPIEEDRLFGEDIERLIQAPWPPA* |
Ga0126372_108488164 | 3300010360 | Tropical Forest Soil | RPPSAGSRALLDWLSGIVDPIDGDRPFGEDLERLIGAPWPPD* |
Ga0126372_111028712 | 3300010360 | Tropical Forest Soil | PSAGSRALLDWLSGIVDPIDGDRPFGEDLERLIDAPWPPD* |
Ga0134125_114748813 | 3300010371 | Terrestrial Soil | ALSGPPPPAGSRVLLDWLAGIVDPIEEDRPFGEDIERLIGAPWPPA* |
Ga0134125_126194592 | 3300010371 | Terrestrial Soil | GSRVLLDWLAGIVDPIEEDRPFGEDIERLIAAPWPV* |
Ga0134125_126624461 | 3300010371 | Terrestrial Soil | RVLLDWLAGIVDPIEEDRPFGEDIERLIGAPWPPA* |
Ga0126381_1043219891 | 3300010376 | Tropical Forest Soil | AGSRALLDWLGDIVGLIDGDRPFGVDLERLIEAPWPPA* |
Ga0136449_1043688512 | 3300010379 | Peatlands Soil | ERPPTDPARALLEWLAGIIAPIDGDRPFGEDLQRLIEAPWPPA* |
Ga0134126_110171192 | 3300010396 | Terrestrial Soil | SRLLLDWLAGIVDPIEEDRPFGEDIERLIATPWPPD* |
Ga0126383_120881942 | 3300010398 | Tropical Forest Soil | AGRAPTGRIGALLDWLAGIITPIDGDRPFGEDLERLIAAPGPPG* |
Ga0126361_105615221 | 3300010876 | Boreal Forest Soil | ALSERAPPPGCRALLDWLAVIVGPIDGDRPFGEDIERLIQAPWPPAAG* |
Ga0126361_108850901 | 3300010876 | Boreal Forest Soil | AALSGREPPAGGRPVLDWLAGLVAPIEADRPFGEDIQRLIEAPWPRA* |
Ga0126350_116395303 | 3300010880 | Boreal Forest Soil | PPAGSRALLDWLAGIIAPIDGDRPFGEDLQHLIEAPWPPA* |
Ga0150983_149748071 | 3300011120 | Forest Soil | ERPPTDRARALLDWLAGIVAPIDGDRPFGEDLQHLIEAPWPPA* |
Ga0137362_111060981 | 3300012205 | Vadose Zone Soil | AAALSGRPAPAGSRALLDWLTGIIAPIDGDRPFGEDLQHLIDTPWPPA* |
Ga0137410_105488322 | 3300012944 | Vadose Zone Soil | AAALSGRPPPAGSRLLLDWLAGIVDPIEEDRPFGEDIEHLIAAPWPPA* |
Ga0157370_102670711 | 3300013104 | Corn Rhizosphere | PAGSRVLLDWLAGIVDPIEEDRPFGEDIERLIGAPWPPA* |
Ga0157369_109521621 | 3300013105 | Corn Rhizosphere | AGSRVLLDWLAGIVDPIVEDRPFGEDIERLIGAPWPPA* |
Ga0157372_114224472 | 3300013307 | Corn Rhizosphere | SAGSRVLLDWLAGIGDPIEEDRPFGEDIERLIGAPWPPSDQPAA* |
Ga0182040_115096052 | 3300016387 | Soil | PPAGCRPLLDWLSGIVDPIADDRPFGEDLERLIVAPWPPA |
Ga0134074_13310691 | 3300017657 | Grasslands Soil | QAAALSGRPPPAGSRLLLDWLAGIVDPIEEDRPFGEDIERLAGAPWPPA |
Ga0187807_10195104 | 3300017926 | Freshwater Sediment | RALLDWLAGIIGPIEGDRPFGEDLERLIAAPWLPGTPATG |
Ga0187807_11791362 | 3300017926 | Freshwater Sediment | PPAGSRALLEWLAGIVAPIDGDRPFGEDLQRLIEAPWPPA |
Ga0187809_102101531 | 3300017937 | Freshwater Sediment | SRALLDWLAGIIAPIDGDRPFGEDLQRLIEAPWPAV |
Ga0187781_100865314 | 3300017972 | Tropical Peatland | AAALSERPPPPTCAALLDWLAGIIDPIEGDRPFGEDIERLISASWPSP |
Ga0187777_110111871 | 3300017974 | Tropical Peatland | RALLDWLAGLVPPIDEDRAFGEDLERLIQAPWPPA |
Ga0187815_100772303 | 3300018001 | Freshwater Sediment | RPPPPGCRTLLDWMAVIVGPTDGDCPFGEDIERLIQAPWPPA |
Ga0187815_104956791 | 3300018001 | Freshwater Sediment | PPPTGSRALLGWLAGIIGPIDGDRPFGEDIERLIGAPWSSA |
Ga0187804_104541401 | 3300018006 | Freshwater Sediment | LLDWLAGLIGPIEGDRPFGEDLERLIAAPWPPPTAS |
Ga0187883_104971852 | 3300018037 | Peatland | LAGLSGRAPTEPSRALLDWLSGIIAPIDGDRPFGEDLERIVSASWPPA |
Ga0187769_110571382 | 3300018086 | Tropical Peatland | DWLAGIVGPIDGDRPFGEDIERLARTPWPGPDQAAGA |
Ga0210407_105561271 | 3300020579 | Soil | PPGGCRPLLDWLAGIVDPIGEDRPFGEDIERLIAAPWTRPD |
Ga0210395_100386517 | 3300020582 | Soil | PTDPARALLDWLAGIIAPIDGDRPFGEDLQHLIEASWPPA |
Ga0210396_108269061 | 3300021180 | Soil | PPGCQPLLDWLAVIVGPIEDDRPFGEDIERLIQAPWPPA |
Ga0210388_104182431 | 3300021181 | Soil | PPAGCQPLLDWLAVIVGPIDDDRPFGEDIERLIQAPWPPA |
Ga0210385_110895062 | 3300021402 | Soil | GCRALLDWLAEIVGPIDDDRPFGEDIERLIQAPWPPA |
Ga0210397_100109988 | 3300021403 | Soil | YQTAALSRQPPPAGCRALLDWLSGIVDPIDGDRPFGEDLERLIGAPWPPA |
Ga0210387_101460041 | 3300021405 | Soil | AGCRELLDWLAVIVGRIDGDRPFGVDIEHLIQAPWPPA |
Ga0210387_105907352 | 3300021405 | Soil | GYQAAALSGRPAPSGCQALLDWLAEIVGPIDGDRPFGQDIERLVQALWLSDQPAPRRPRT |
Ga0187846_104457233 | 3300021476 | Biofilm | AAGSRQLLEWLASIVGPIEGDRPFGEDIERLIHAPWPPA |
Ga0210410_104800562 | 3300021479 | Soil | GCRPLLDWLAGIVDPIGEDRPFGEDIERLIAAPWTRPD |
Ga0247691_10433193 | 3300024222 | Soil | GSRVLLDWLAGIVDPIVEDRPFGEDIERLIGAPWPPA |
Ga0207416_10793511 | 3300025134 | Iron-Sulfur Acid Spring | LSGFSGHPPAGSRALLDWLAGIIAPIDGDRPFGEDLQHLIEAPWPPGP |
Ga0207705_105268973 | 3300025909 | Corn Rhizosphere | AALSGPPPAGSRVLLDWLAGIVDPIVEDRPFGEDIERLIGAPWPPA |
Ga0207660_101473454 | 3300025917 | Corn Rhizosphere | AAALSGPPPPAGSRVLLDWLAGIVDPIEEDRPFGEDIERLIGAPWPPA |
Ga0179587_107845801 | 3300026557 | Vadose Zone Soil | GYQAAALSGRPPPAGSRLLLDWLAGIVDPIEEDRPFGEDIEHLIAAPWPPA |
Ga0209333_12038742 | 3300027676 | Forest Soil | DPVRTLLDWLAGIIAPIDDDRPFGEDLQHLIEAPWPPGVTCFP |
Ga0209772_103083221 | 3300027768 | Bog Forest Soil | ALSWFSERPPTDPARALLDWLAGIIAPIDGDRPFGEDLQHLIEAPWPQA |
Ga0209274_101282064 | 3300027853 | Soil | PPGCAALLDWLGGIVPPIEGDRPFGEDIERLIRGPWPHP |
Ga0209274_103761901 | 3300027853 | Soil | LAGYQAAALSGFPERPPTDPARALLDWLAGIIAPIDGDRPFGEDLQHLIEAAWPPA |
Ga0209167_102306343 | 3300027867 | Surface Soil | AGCPPSADGPLPAGCRALLDWLAGIIGVIDGDRPFGEDLEDLIEAPWPPA |
Ga0307307_100306171 | 3300028718 | Soil | AGSRVLLDWLAGIVDPIEEDRPFGEDIERLIAAPWPPA |
Ga0302219_100994322 | 3300028747 | Palsa | GCRALLDWLSVIIGPIDGDRPFGEDIERLIQAPWPGL |
Ga0302231_105272151 | 3300028775 | Palsa | PPPGCRALLDWLSVIIGPIDGDRPFGEDIERLIQAPWPGL |
Ga0307296_106097022 | 3300028819 | Soil | PPAGSRVLLDWLAGIVDPIEEDRPFGEDIERLIAAPWPPA |
Ga0308309_102523231 | 3300028906 | Soil | QPAGSRLLLDWLAGIVDPIEEDRPFGEDIERLITAPWPPA |
Ga0311338_102251171 | 3300030007 | Palsa | RELLEWLAGIIAPIAGDRPFGEDIERVIEAGPVSWLPAAV |
Ga0318571_100177352 | 3300031549 | Soil | ALSGRPPPAGSRALLDWLSGIVDPIDGDRPFGEDLERLISTPWPPA |
Ga0318573_102453471 | 3300031564 | Soil | SPAGSRALLDWLSAIVDPIEADRPFGEDLERLIGAPWPPA |
Ga0318573_105292902 | 3300031564 | Soil | APPPPGSRALLDWLTDIVGPIDGDRPFGEDLERLIAAPWPPA |
Ga0318555_104354542 | 3300031640 | Soil | SRSGRPPPPGGRALLDWLAGIIGPIEGDRTFGEDIEHVIGAGWPPTPG |
Ga0318493_105297032 | 3300031723 | Soil | LSGRPPPAGCQALLDWLGGIVDPIDGDRPFGEDLERLIDAPWPPH |
Ga0318502_106987961 | 3300031747 | Soil | YQAAALSGQPPPAGCRPLLDWLSGIVDPIADDRPFGEDLERLIVAPWPPA |
Ga0318492_100717804 | 3300031748 | Soil | ALSGQSPPVGSRALLDWVSEIVDPIDGDRPFGEDLERLISAPWPPD |
Ga0318521_103088352 | 3300031770 | Soil | SDRPPPAGCRVLLDWLTGIVGAIEGDRPFGEDLQRLIDAPWPPA |
Ga0318547_100757773 | 3300031781 | Soil | SDRPPPAGCRALLDWLAGIVGPIDGDRPFGEDLERLIEAPWPPA |
Ga0318552_107438762 | 3300031782 | Soil | AALSDRPPPAGCRVLLDWLTGIVGAIEGDRPFGEDLQRLIDAPWPPA |
Ga0318529_104840382 | 3300031792 | Soil | GRPPPAGCRALLDWLAGLVGPIDGDRPFGEDLDHLIEAPWPLA |
Ga0318511_100410441 | 3300031845 | Soil | TALSGRPPPPGGRALLDWLAGIIGPIEGDRTFGEDIEHVIGAGWPPTPG |
Ga0318511_100721961 | 3300031845 | Soil | RALLDWLAGLVGPIDGDRPFGEDLDHLIEAPWPLA |
Ga0318495_101366732 | 3300031860 | Soil | CGRPPPAGSRALLDWLAGIIGPIDGDRPFGEDLERLIGTEWPPGVTPP |
Ga0318544_102299111 | 3300031880 | Soil | SGRPPPAGSRALLDWLSGIVDPIDGDRPFGEDLERLISTPWPPA |
Ga0306923_123067441 | 3300031910 | Soil | QATALSGRPPPPGGRALLDWLAGIIGPIEGDRTFGEDIEHVIGAGWPPTPG |
Ga0306926_120771912 | 3300031954 | Soil | AALSAQPPPAGCRALLDWLSGLVEPIDADRPFGEDLERLIGAPWPPA |
Ga0307479_118808892 | 3300031962 | Hardwood Forest Soil | YQATALSGRPPAAGCRALLDWLAGIVGVIDDDRPFGEDLQHLIEAPWPPALWPPGALPPA |
Ga0318562_103167851 | 3300032008 | Soil | PLLDWLAGLIGPIDGDRPFGEDIERLVLAPWPGPDQAGGG |
Ga0318562_105727191 | 3300032008 | Soil | AALSGTPPPAGCRPLLDWLAGIIGPIDGDRPFGEDIERLVRTPWPGPDQAAGA |
Ga0318569_100087761 | 3300032010 | Soil | DSLAAVIGPIEADRPFGEDIERLAAASWPGAAAPE |
Ga0318569_101663942 | 3300032010 | Soil | SGRPPPAGSRALLGWLAGIVGPIDGDRPFGEDLERLIGTPWPPDVTPM |
Ga0318558_104422371 | 3300032044 | Soil | SDRPPPAGCRALLEWLACIVGPIDGDRPFGEDLERLIEAPWPPA |
Ga0318506_101695571 | 3300032052 | Soil | LSGRPPPPGGRALLDWLAGIIGPIEGDRTFGEDIEHVIGAGWPPTPG |
Ga0318505_100806513 | 3300032060 | Soil | PPAGCRALLDWLAGIVGPIDGDRPFGEDLERLIEAPWPPA |
Ga0318513_103633601 | 3300032065 | Soil | LAGRPPPAGSWALLDWLSAIVDPIEADRPFGEDLERLIGAPWPPA |
Ga0318514_102345821 | 3300032066 | Soil | RPAGSWALLDWLSAIVDPIDADRPFGEDLERLIGAPWPPT |
Ga0318524_107919561 | 3300032067 | Soil | PPAGSRALLDWVSEIVDPIDGDRPFGEDLERLISAPWPPD |
Ga0306924_101804731 | 3300032076 | Soil | AGSRALLDWLSAIVDPIDADRPFGEDLERLIGAPWPPA |
Ga0311301_103393057 | 3300032160 | Peatlands Soil | ALLDWLTVIIGPIDGDRTFGEDIERLIQAPWPPAAG |
Ga0311301_113055893 | 3300032160 | Peatlands Soil | PGCRTLLDWMAVIVGPIDGDRPFGEDIERLIQAPWPPA |
Ga0307472_1000689884 | 3300032205 | Hardwood Forest Soil | SGRPPPAGSRVLLDWLAGIVDPIEEDRPFGEDIERLIGAPWPPSDQPAA |
Ga0306920_1001061511 | 3300032261 | Soil | RALLDWLSAIVDPIDADRPFGEDLERLIGAPWPPA |
Ga0306920_1008826903 | 3300032261 | Soil | RALLDWLAGIVGPIDGDRPFGEDLERLIEAPWPPA |
Ga0306920_1011766552 | 3300032261 | Soil | GWLAGIVGPIDGDRPFGEDLERLIGTPWPPDVTPM |
Ga0335085_109314121 | 3300032770 | Soil | SGRPPAGSRVLLDWLSGIVDPIDGDRPFGEDLERLIGAPWPPD |
Ga0335082_105112451 | 3300032782 | Soil | RPPPAGSRALLDWVSGIVGPIDGDRPFGEDLERLIGAPWPPA |
Ga0335075_103659783 | 3300032896 | Soil | SLFAGCRGLLDWLAGIVGPIDGDRPFGEDIQHLIEAPWPPT |
Ga0335075_103861671 | 3300032896 | Soil | SDRSLFAGCQGLLDWLAGIVGPIDGDRPFGEDIQHLIEAPWPPT |
Ga0335075_116650892 | 3300032896 | Soil | GYQAMALSGSPPPTGCAALLDWLAGIIGPIDGDRPFGEDIERLIRAPWLPA |
Ga0310914_101771951 | 3300033289 | Soil | AGSRALLDWLSGIVDPIDGDRPFGEDLERLISTPWPPA |
Ga0310914_112581731 | 3300033289 | Soil | GCRALLDWLSGIVDPIDGDRPFGEDLERLIGAPWPPA |
⦗Top⦘ |