Basic Information | |
---|---|
Family ID | F069398 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 46 residues |
Representative Sequence | MTTRIPLLELGSLQSRLPELIAKKGEPPWSEALVLTDDIQAFLIC |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 95.97 % |
% of genes near scaffold ends (potentially truncated) | 94.35 % |
% of genes from short scaffolds (< 2000 bps) | 91.94 % |
Associated GOLD sequencing projects | 119 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.161 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.710 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.645 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.290 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.66% β-sheet: 19.18% Coil/Unstructured: 56.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF02653 | BPD_transp_2 | 41.13 |
PF00496 | SBP_bac_5 | 8.87 |
PF13632 | Glyco_trans_2_3 | 8.87 |
PF01717 | Meth_synt_2 | 5.65 |
PF01042 | Ribonuc_L-PSP | 3.23 |
PF07690 | MFS_1 | 3.23 |
PF08240 | ADH_N | 2.42 |
PF13641 | Glyco_tranf_2_3 | 1.61 |
PF03952 | Enolase_N | 1.61 |
PF07152 | YaeQ | 0.81 |
PF06325 | PrmA | 0.81 |
PF08028 | Acyl-CoA_dh_2 | 0.81 |
PF14907 | NTP_transf_5 | 0.81 |
PF13594 | Obsolete Pfam Family | 0.81 |
PF00005 | ABC_tran | 0.81 |
PF03069 | FmdA_AmdA | 0.81 |
PF00079 | Serpin | 0.81 |
PF04321 | RmlD_sub_bind | 0.81 |
PF02558 | ApbA | 0.81 |
PF01039 | Carboxyl_trans | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 5.65 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 3.23 |
COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 1.61 |
COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.61 |
COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.81 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.81 |
COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.81 |
COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.81 |
COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.81 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG4681 | Uncharacterized conserved protein YaeQ, suppresses RfaH defect | Function unknown [S] | 0.81 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.81 |
COG4826 | Serine protease inhibitor | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.16 % |
Unclassified | root | N/A | 4.84 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000443|F12B_10352288 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300003994|Ga0055435_10075459 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 857 | Open in IMG/M |
3300004009|Ga0055437_10037375 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300004024|Ga0055436_10036172 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300004463|Ga0063356_102731210 | Not Available | 760 | Open in IMG/M |
3300005186|Ga0066676_10442373 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 880 | Open in IMG/M |
3300005204|Ga0068997_10003765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1841 | Open in IMG/M |
3300005206|Ga0068995_10094666 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300005332|Ga0066388_102433229 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 950 | Open in IMG/M |
3300005336|Ga0070680_100333201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1289 | Open in IMG/M |
3300005343|Ga0070687_100624894 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 743 | Open in IMG/M |
3300005353|Ga0070669_101828800 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005363|Ga0008090_14593958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
3300005367|Ga0070667_101734300 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300005406|Ga0070703_10353762 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300005457|Ga0070662_101930924 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300005536|Ga0070697_100155071 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
3300005544|Ga0070686_100831889 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 746 | Open in IMG/M |
3300005545|Ga0070695_100489150 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300005575|Ga0066702_10736766 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300005616|Ga0068852_102354247 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005713|Ga0066905_102072404 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 529 | Open in IMG/M |
3300005764|Ga0066903_102960104 | Not Available | 920 | Open in IMG/M |
3300006046|Ga0066652_101394039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 656 | Open in IMG/M |
3300006163|Ga0070715_10131838 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300006800|Ga0066660_10133555 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
3300006845|Ga0075421_100073685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4308 | Open in IMG/M |
3300006847|Ga0075431_101919158 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300007004|Ga0079218_12925478 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300009078|Ga0105106_10577239 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300009101|Ga0105247_10879968 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 690 | Open in IMG/M |
3300009143|Ga0099792_10806691 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300009148|Ga0105243_11452788 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 708 | Open in IMG/M |
3300009148|Ga0105243_12572529 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300009171|Ga0105101_10217483 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300009553|Ga0105249_10665493 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300009610|Ga0105340_1578463 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300009792|Ga0126374_10845077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 704 | Open in IMG/M |
3300010046|Ga0126384_12327192 | Not Available | 517 | Open in IMG/M |
3300010362|Ga0126377_12303545 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300010366|Ga0126379_10432068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1373 | Open in IMG/M |
3300010376|Ga0126381_100530387 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1665 | Open in IMG/M |
3300010398|Ga0126383_11183582 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 854 | Open in IMG/M |
3300010398|Ga0126383_11394848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 790 | Open in IMG/M |
3300010399|Ga0134127_10123336 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
3300011425|Ga0137441_1132111 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 617 | Open in IMG/M |
3300011429|Ga0137455_1149793 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300012096|Ga0137389_10400401 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300012199|Ga0137383_10558185 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 838 | Open in IMG/M |
3300012202|Ga0137363_11065129 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300012353|Ga0137367_10320879 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1106 | Open in IMG/M |
3300012357|Ga0137384_10929896 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 700 | Open in IMG/M |
3300012357|Ga0137384_11008365 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300012362|Ga0137361_11525316 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300012532|Ga0137373_10015373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7794 | Open in IMG/M |
3300012582|Ga0137358_10885089 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300012895|Ga0157309_10281656 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300012923|Ga0137359_11172532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 656 | Open in IMG/M |
3300012927|Ga0137416_11956245 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 537 | Open in IMG/M |
3300012948|Ga0126375_10236614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1227 | Open in IMG/M |
3300013297|Ga0157378_10813675 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 961 | Open in IMG/M |
3300014326|Ga0157380_11561359 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 715 | Open in IMG/M |
3300014885|Ga0180063_1267811 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300015052|Ga0137411_1120705 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300015077|Ga0173483_10954011 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
3300015262|Ga0182007_10036666 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
3300015373|Ga0132257_100325751 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
3300017657|Ga0134074_1279473 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300018000|Ga0184604_10320614 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300018075|Ga0184632_10221995 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300018422|Ga0190265_10737986 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300018429|Ga0190272_12504475 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300018469|Ga0190270_13356114 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300020579|Ga0210407_10186664 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
3300020580|Ga0210403_10487041 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300020581|Ga0210399_10332113 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300021073|Ga0210378_10115078 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300021170|Ga0210400_11574910 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
3300021560|Ga0126371_12970299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 574 | Open in IMG/M |
3300022726|Ga0242654_10319992 | Not Available | 576 | Open in IMG/M |
3300025899|Ga0207642_10338412 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300025910|Ga0207684_10359503 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300025915|Ga0207693_11402630 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300025931|Ga0207644_10435053 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300025933|Ga0207706_11707665 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
3300026361|Ga0257176_1021074 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300026369|Ga0257152_1025001 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
3300026371|Ga0257179_1044997 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300026377|Ga0257171_1070159 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
3300026482|Ga0257172_1033018 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300026530|Ga0209807_1140539 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300026551|Ga0209648_10606361 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300027181|Ga0208997_1041563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 678 | Open in IMG/M |
3300027577|Ga0209874_1151480 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300027617|Ga0210002_1069742 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300027722|Ga0209819_10171376 | Not Available | 758 | Open in IMG/M |
3300027765|Ga0209073_10008786 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
3300027787|Ga0209074_10205745 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300027954|Ga0209859_1030327 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300028381|Ga0268264_11828006 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 617 | Open in IMG/M |
3300028673|Ga0257175_1037509 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300028803|Ga0307281_10275040 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 623 | Open in IMG/M |
3300028811|Ga0307292_10234491 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300028812|Ga0247825_10587908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 797 | Open in IMG/M |
3300028885|Ga0307304_10315968 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
3300030336|Ga0247826_11097771 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1022000 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1010021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2256 | Open in IMG/M |
3300031455|Ga0307505_10466357 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300031564|Ga0318573_10032088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2465 | Open in IMG/M |
3300031720|Ga0307469_10770903 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300031740|Ga0307468_102179707 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300031751|Ga0318494_10015618 | All Organisms → cellular organisms → Bacteria | 3681 | Open in IMG/M |
3300031819|Ga0318568_10012941 | All Organisms → cellular organisms → Bacteria | 4369 | Open in IMG/M |
3300031847|Ga0310907_10535540 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300031893|Ga0318536_10179472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1077 | Open in IMG/M |
3300031897|Ga0318520_10169589 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1275 | Open in IMG/M |
3300032063|Ga0318504_10199371 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 934 | Open in IMG/M |
3300032261|Ga0306920_103252085 | Not Available | 607 | Open in IMG/M |
3300033004|Ga0335084_10053891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4152 | Open in IMG/M |
3300033004|Ga0335084_10174827 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2232 | Open in IMG/M |
3300033551|Ga0247830_10422189 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300033813|Ga0364928_0056746 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300034818|Ga0373950_0025919 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.26% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.84% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.03% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.23% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.42% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.42% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.61% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.61% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.61% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.61% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.61% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.61% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.81% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011425 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2 | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
F12B_103522882 | 3300000443 | Soil | MTTTRIPLLEIGSLQSRLPDLIAKKGELPWSEAVVLTDDIQAFLICHPPGQP |
Ga0055435_100754592 | 3300003994 | Natural And Restored Wetlands | MADRIPLMEIGKLQARVSELKAKKGPPPWSEALVMTDDVQ |
Ga0055437_100373751 | 3300004009 | Natural And Restored Wetlands | MTTPPRIPLLQLGSLQSRLPDLIAKKGAPPWSEPLVLTDDIQAFLICHPPGQPNDTH |
Ga0055436_100361721 | 3300004024 | Natural And Restored Wetlands | MTTPPRIPLLQLGSLQSRLPDLIAKKGAPPWSEPLVLTDDIQAFLICHPPGQPNDT |
Ga0063356_1027312103 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTDRVPLLEVGKLLAGLEELKAKKGEPPWSDAVVLTDDIQ |
Ga0066676_104423731 | 3300005186 | Soil | MADRVPLMEIGSLQARLEDLKEKKGPPPWSEAMVMTDDIQAFIICHAP |
Ga0068997_100037653 | 3300005204 | Natural And Restored Wetlands | MTDRIPLLQLGSLQSRLPELIAKKGAPPWSEAVVLTDDIQAF |
Ga0068995_100946662 | 3300005206 | Natural And Restored Wetlands | MTDRIPLLQLGSLQSRLPELIAKKGAPPWSEAVVLTDDIQAFLICHPPGQ |
Ga0066388_1024332291 | 3300005332 | Tropical Forest Soil | MADRVPLLEIGKLHARVSELKAKKGAPPWSEAVVLTDDIQ |
Ga0070680_1003332013 | 3300005336 | Corn Rhizosphere | VARAPTGSLNDLTDRIPLLQLGSLRSRLPELIAKKGAPPWSEAVVLTDDIQAFLICHPPGQPND |
Ga0070687_1006248942 | 3300005343 | Switchgrass Rhizosphere | MTTTRIPLLELGSLQSRLPDLIAKKGKPPWSEALVLTDDIQAFLICHPPG |
Ga0070669_1018288002 | 3300005353 | Switchgrass Rhizosphere | MTERIPLLQLGSLQSRLPELIAKKGAPPWSEAVVLTDDIQAFLICHPPGQPNDTHYHH |
Ga0008090_145939582 | 3300005363 | Tropical Rainforest Soil | MPERVPLLEVGKLLASLEDLKAKKGEPPWSDAVVLTDDIQAFIIC |
Ga0070667_1017343002 | 3300005367 | Switchgrass Rhizosphere | MTTTRIPLLELGSLQSRLPDLIAKKGKPPWSEALVLTDDI |
Ga0070703_103537621 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRIPLLELGSRQSCLPDLIAKKGEPPWSEALVLTDDIQAFLICHP |
Ga0070662_1019309241 | 3300005457 | Corn Rhizosphere | MTERIPLLQLGSLQSRLPELIAKKGAPPWSEAVVLTDDIQAFLICH |
Ga0070697_1001550711 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRVPLLELGSLQSRLPDLIAKKGEPPWSEALVLTDDIQ |
Ga0070686_1008318892 | 3300005544 | Switchgrass Rhizosphere | MTTTRIPLLELGSLQSRLPDLIAKKGKPPWSEALVLTDDIQAFLICHP |
Ga0070695_1004891502 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MTERIPLLQLGSLQSRLPELIAKKGAPPWSEAVVLTDDIQAFLICHPPGQPNDTHYHHHD |
Ga0066702_107367662 | 3300005575 | Soil | MADRMPLLDIGKLRARVDELRARKGPPPWSDTLVMTDD |
Ga0068852_1023542471 | 3300005616 | Corn Rhizosphere | MTTTRIPLLELGSLQSRLPDLIAKKGKPPWSEALVLTDDIQAFLICHPPGQPN |
Ga0066905_1020724041 | 3300005713 | Tropical Forest Soil | MPDRIPLLEIGSLQARLEDLKEKKGPPPWSEAMVMTDDIQAFIICH |
Ga0066903_1029601041 | 3300005764 | Tropical Forest Soil | MTERMPLLEIGKLLASIHDLEAKHGEPPWSDPVVLTDDIQAFIIC |
Ga0066652_1013940392 | 3300006046 | Soil | MADRVPLMEIGSLQARLEDLKEKKGPPPWSEAMVMTDDIQAFIICH |
Ga0070715_101318382 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRIPRLELGSLQSRLPDLIAKKGEPPWSEALVLTDDIQAFLIFGPKHL* |
Ga0066660_101335553 | 3300006800 | Soil | MADRMPLLDIGKLRARVDELRARKGPPPWSDTLVMTD |
Ga0075421_1000736855 | 3300006845 | Populus Rhizosphere | MAVRVPLMETGRLRARVDELRARKGPPPWSDCLVLTDDIQAF |
Ga0075431_1019191581 | 3300006847 | Populus Rhizosphere | MTERVPLLEVGALLARLDDLKAKKGEPPWSDALVLTDDIQAFIICH |
Ga0079218_129254781 | 3300007004 | Agricultural Soil | MTERIPLLQIGSLQSRLPELIARKGAPPWSEAVVLTDDIQA |
Ga0105106_105772391 | 3300009078 | Freshwater Sediment | MTERVPLLQLGSLQSRLPELIAKKGTPPWSEAVVLTDDIQAFLICHPPGQPNDTHYHHHD |
Ga0105247_108799681 | 3300009101 | Switchgrass Rhizosphere | MTTTRIPLLELGSLQSRLPDPIAKKGEPPWSEALVLTDDIQAFLI |
Ga0099792_108066912 | 3300009143 | Vadose Zone Soil | MPLLDIGKLRARVDELRARKGPPPWSDTLVMTDDIQAFIICH |
Ga0105243_114527881 | 3300009148 | Miscanthus Rhizosphere | MTERIPLLQLGSLQSRLPELIAKKGAPPWSEAVVLTDDIQAFLICHPP |
Ga0105243_125725292 | 3300009148 | Miscanthus Rhizosphere | MTTRVPLLELGSLQSRLPDLIAKKGEPPWSEALVMTDDIQAFIICHAPGHAND |
Ga0105101_102174831 | 3300009171 | Freshwater Sediment | MTERVPLLQLGSLQSRLPELIAKKGTPPWSEAVVLTDDIQAFLICHPPG |
Ga0105249_106654932 | 3300009553 | Switchgrass Rhizosphere | MAVRMPLLETGRLWTRVDELRARNGPAPWSEALVLTDDIQAFIICHPPGH |
Ga0105340_15784632 | 3300009610 | Soil | MAIRVPLLETGRLWTRVEELRARKGAAPWSEALVLTD |
Ga0126374_108450771 | 3300009792 | Tropical Forest Soil | MADRAPLMEIGKLHARVSELKAKKGAPPWSEAVVLTDDIQAFIICHPPGQPNDTH |
Ga0126384_123271922 | 3300010046 | Tropical Forest Soil | MTERVPLLEVGKLLASVHDLEAKHGEPPWSHPVVLTDDIQAFIICHA |
Ga0126377_123035452 | 3300010362 | Tropical Forest Soil | METGRLRARVDELRARKGPPPWSDVLVLTDDIQAFVICHPPGQP |
Ga0126379_104320681 | 3300010366 | Tropical Forest Soil | MTERMPLLEIGKLLASVHDLEAKHGEPPWSDPVVLTDDIQAFIICHPPGHPNDT |
Ga0126381_1005303871 | 3300010376 | Tropical Forest Soil | MTERVPLLEVGQLLAGPADLKAKHGEPPWSHPVVLTDDIQAFIICH |
Ga0126383_111835822 | 3300010398 | Tropical Forest Soil | MADRVPLLEIGKLHARVSELKATKGAPPWSEAVVLTDDIQAFIICHLPG |
Ga0126383_113948482 | 3300010398 | Tropical Forest Soil | MVDRVPLLEIGKLHARVSELKAKKGAPPWSEAVVL |
Ga0134127_101233364 | 3300010399 | Terrestrial Soil | LTDRIPLLQLGSLRSRLPELIAKKGAPPWSEAVVLTDDIQAFLICHPPGQPNDTHY |
Ga0137441_11321112 | 3300011425 | Soil | MTERIPLLQLGSLQSRLPDLIAKKGAPPWSEAVVLTD |
Ga0137455_11497931 | 3300011429 | Soil | MAIRVPLMETGRLWTRVEELRARKGAAPWSEALVLTDDIQAFIICHPP |
Ga0137389_104004012 | 3300012096 | Vadose Zone Soil | MTTRIPLLELGSLQSRLPELIAKKGEPPWSEALVLTDDIQAFLICHPPGQPNDT |
Ga0137383_105581851 | 3300012199 | Vadose Zone Soil | MADRIPLMEIGKLQMRVSELKTKKGAAPWSEALVMTDDTQAFIICQAP |
Ga0137363_110651291 | 3300012202 | Vadose Zone Soil | LDVGKLRARVEELRARKGAPPWSDTLVMTDDIQAFIICHLPGHPN |
Ga0137367_103208792 | 3300012353 | Vadose Zone Soil | MADRIPLMEIGKLQMRVSELKTKKGAAPWSEALVMTD |
Ga0137384_109298962 | 3300012357 | Vadose Zone Soil | MADRIPLMEIGKLQMRVSELKTKKGAAHWSEALVMTDNTQAFIICQAPGHP |
Ga0137384_110083652 | 3300012357 | Vadose Zone Soil | MTTRIPLLELGSLQSRLPELIAKKGEPPWSEALVLTDDIQAFLICHPP |
Ga0137361_115253161 | 3300012362 | Vadose Zone Soil | MADRLPLLDIGKLRAPVEDLRARKGAPPWSDTLVMTDDIQA |
Ga0137373_100153731 | 3300012532 | Vadose Zone Soil | MAVRIPCLEVGRLQSRLDEIKRSKGQPPWSETLVMTDDIQAFVICHPAGQPNDTHYHLHD |
Ga0137358_108850892 | 3300012582 | Vadose Zone Soil | MTDRIPLLQLGSLQSRLPELIAKKGAPPWSEPVVLTDDIQAFLICHPPGQPNDTHYHHHDERWVV |
Ga0157309_102816561 | 3300012895 | Soil | MTTTRIPLLEIGSLQSRLPDLIAKKGEPPWSEAVVLTDDIQAFLICHSP |
Ga0137359_111725322 | 3300012923 | Vadose Zone Soil | MTTRIPLLELGSLQSRLPELIAKKGEPPWSEALVLTDDIQAFLICHPPG* |
Ga0137416_119562452 | 3300012927 | Vadose Zone Soil | MADHVPLMEIGSLQVRLEDLKEKKGPPPWSEAMVMTDDIQAFIICHAP |
Ga0126375_102366141 | 3300012948 | Tropical Forest Soil | MTERMPLLEVGKLLASVHDLEAKHGEPPWSHPVVLTDDIQAFTICHA |
Ga0157378_108136752 | 3300013297 | Miscanthus Rhizosphere | MADRIPLMEMGKLQMRMSELKTKKGTAPWSEALVMTD |
Ga0157380_115613592 | 3300014326 | Switchgrass Rhizosphere | MSERVPLLEVGKLLAGLEDLKAKKGEPPWSDAVVLTDDIQAFIIC |
Ga0180063_12678112 | 3300014885 | Soil | MTTPRIPLLQLGSLQSRLPELIAKRGAPPWSEAVVLTDDIQAF |
Ga0137411_11207051 | 3300015052 | Vadose Zone Soil | MTDRIPLLQLGSLQSRLPELIAKKSAPPWSEPVVLTDDISRPS* |
Ga0173483_109540112 | 3300015077 | Soil | MTTTRIPLLEIGSLQSRLPDLIAKKGEPPWSEAVVLTDDIQAFLIC |
Ga0182007_100366661 | 3300015262 | Rhizosphere | MTTTRIPLLELGSLQSRPPDLIAKKGKPPWSEALV |
Ga0132257_1003257511 | 3300015373 | Arabidopsis Rhizosphere | MTERVPLLEVGKLLAGLEDLNAKHGEPPWSHPVVLTDDIQAFIICHAPGHAN |
Ga0134074_12794731 | 3300017657 | Grasslands Soil | MADRMPLLDIGKLRARVDELHAHKGPPPWSDTLVMTDDIQAFII |
Ga0184604_103206141 | 3300018000 | Groundwater Sediment | MAVRVPLLETGRLWTRVEELRARKGAPPWSEALVLTDDIQ |
Ga0184632_102219951 | 3300018075 | Groundwater Sediment | VADRMPLLDVGKLRARVDELRGRKGAPPWSDTLVMTD |
Ga0190265_107379862 | 3300018422 | Soil | MAVRVPLLETGRLWTRVEELRARKGTPPWSEALVLTDDIQAFIICQPP |
Ga0190272_125044752 | 3300018429 | Soil | MAVRVPLLETGRLWTRVEELRARKGTPPWSEALVLTDDIQAFIICQPPGHPN |
Ga0190270_133561142 | 3300018469 | Soil | MAVRAPLLETGRLWTRAEELRARKGPAPWSEALILTDDIQAFIICHPPGHPNDTH |
Ga0210407_101866643 | 3300020579 | Soil | MTTRVPLLELGSLQSRLPDLIAKKGEPPWSEALVLTDDIQAFLIFGPKHL |
Ga0210403_104870412 | 3300020580 | Soil | MTTRIPLLELGSLQSRLPDLIAKKGEPPWSETLVLTDDIQAFLICQG |
Ga0210399_103321131 | 3300020581 | Soil | MTTRIPLLELGSLQSRLPDLIAKKGEPPWSETLVLT |
Ga0210378_101150782 | 3300021073 | Groundwater Sediment | MTERNPLLQLGSLQSRLPELIARKGAPPWSEAVVLTDDIQAFVICHPPGQAN |
Ga0210400_115749101 | 3300021170 | Soil | MTTRIPLLELGSLQSRLPDLIAKKGEPPWSETLVLTDDIQAFLI |
Ga0126371_129702991 | 3300021560 | Tropical Forest Soil | MADRAPLMEIGKLHARVSELKAKWGAPPWSEPVVLT |
Ga0242654_103199922 | 3300022726 | Soil | AATEGPPPWSDDMTTRIPRLELGSLQSRLPDLIAKKGEPPWSEALVLTDDIQAFLIFGPKHL |
Ga0207642_103384121 | 3300025899 | Miscanthus Rhizosphere | MAVRMPLLETGRLWTRVDELRARKGPAPWSEALVLTDDIQAFI |
Ga0207684_103595031 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVRLPLLETGRLWTRVDELRARKGPAPWSEALVLT |
Ga0207693_114026302 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRIPLLELGSLQSRLPDLIAKKGEPPWSEALVLTDDIQAFLIFGPKHL |
Ga0207644_104350532 | 3300025931 | Switchgrass Rhizosphere | MTTTRIPLLELGSLQSRLPDLIAKKGEPPWSEALVLTDDIQAFLICHP |
Ga0207706_117076651 | 3300025933 | Corn Rhizosphere | MSERVPLLEVGKLLAGLEDLKAKKGEPPWSDPVVLTD |
Ga0257176_10210742 | 3300026361 | Soil | VADPMPLLDVGKLRARVEDLRARKGAPPWSDALVMTDDIQAFIICHLLGH |
Ga0257152_10250011 | 3300026369 | Soil | MTTRVPLLELGSLQSRLPELIAKKGEPPWSEALVLTD |
Ga0257179_10449972 | 3300026371 | Soil | MTTRVPLLELGSLQSRLPELIARKGEPPWSEALVLTDDIQAFLICHP |
Ga0257171_10701591 | 3300026377 | Soil | MTTRVPLLELGSLQSRLPELIAKKGEPPWSEALVLTDDIQ |
Ga0257172_10330182 | 3300026482 | Soil | MTTRVPLLELGSLQSRLPELIARKGEPPWSEALVLTDDI |
Ga0209807_11405391 | 3300026530 | Soil | MADRMPLLDIGKLRARVDELRAHKGPPPWSDTLVMTDDIQAFIICHLPGHLNDT |
Ga0209648_106063611 | 3300026551 | Grasslands Soil | MTTRIPLLELGSLQSRLPELIAKKGEPPWSEALVLTDDIQAFLIC |
Ga0208997_10415631 | 3300027181 | Forest Soil | MTDRIPLLQLGSLQSRLPELIARKGAPPWSEPVVLTDDIQAFLICHPPGQPNDT |
Ga0209874_11514802 | 3300027577 | Groundwater Sand | MTTRIPLLELGSLWSRLPDLIAKKGEPPWSEALVLTDDIQA |
Ga0210002_10697421 | 3300027617 | Arabidopsis Thaliana Rhizosphere | MTTTRIPLLEIGSLQSRLPDLIAKKGEPPWSEAVVLTDDIQAFLICHSPGQPNDTH |
Ga0209819_101713762 | 3300027722 | Freshwater Sediment | MTDRVPLLEVGKLLAGLEELKAKKGEPPWSDAVVLTDDI |
Ga0209073_100087864 | 3300027765 | Agricultural Soil | MTTTRIPLLELGSLQSRLPDLIAKKGEPPWSEALVLTDDIQAFLICHTPG |
Ga0209074_102057452 | 3300027787 | Agricultural Soil | MTTTRIPLLELGSLQSRLPDLIAKKGKPPWSEALVLT |
Ga0209859_10303271 | 3300027954 | Groundwater Sand | MTTRIPLLELGSLWSRLPDLIAKKGEPPWSEALVLTDDIQAF |
Ga0268264_118280062 | 3300028381 | Switchgrass Rhizosphere | MSERVPLLEVGKLLAGLEDLKAKKGEPPWSDAVVLTDDI |
Ga0257175_10375091 | 3300028673 | Soil | VADPMPLLDVGKLRARVEDLRARKGAPPWSDTLVMTDDIQAFIICHLPGHPN |
Ga0307281_102750402 | 3300028803 | Soil | MTTRNPLLQLGSLQSRLPELIAKKGAPPWSEAVVLTDDIQAFVI |
Ga0307292_102344911 | 3300028811 | Soil | MTDRIPLLQLGSLQSRLPELIAKKGAPPWSEPVVLTDDIQAFLICHPPG |
Ga0247825_105879081 | 3300028812 | Soil | MATQATAPAPARIPLLDPGTLQARLETIKAKRATPPWSEAIVLTDDIQAFLICHAPGQPNDTHYHLHDEWW |
Ga0307304_103159681 | 3300028885 | Soil | MTTRIPLLELGSLQSRLPELIAKTGEPPWSDALVLTDDI |
Ga0247826_110977711 | 3300030336 | Soil | MTDRIPLLQLGSLQSRLPELIAKKGAPPWSEAVVLTDDIQAFLICHPPGQPNDTHYHH |
(restricted) Ga0255311_10220001 | 3300031150 | Sandy Soil | MTDRIPLLQLGTLQSRLPELIAKKGAPPWSEAVVLTDDIQAFLICH |
(restricted) Ga0255312_10100213 | 3300031248 | Sandy Soil | MSTPPRIPLLQLGSLQSRLPELIARKGAPPWSEAV |
Ga0307505_104663571 | 3300031455 | Soil | MTERIPLLQLGSLQSRLPELIARKGAPPWSEAVVLTDDIQAFLICHP |
Ga0318573_100320884 | 3300031564 | Soil | MADRVPLLEIGKLHARVRELKATKGAPPWSEAVVLTDDI |
Ga0307469_107709033 | 3300031720 | Hardwood Forest Soil | LELGSLQSRLPDLIAKKGEPPWSEALVLTDDIQAFLIFGPKHL |
Ga0307468_1021797072 | 3300031740 | Hardwood Forest Soil | MTTRIPRLELGSLQSRLPDLIAKKGEPPWSETLVLTDDIQAFLIFGPKHL |
Ga0318494_100156181 | 3300031751 | Soil | MADRVPLLEIGKLHARVRELKATKGAPPWSEAVVLT |
Ga0318568_100129411 | 3300031819 | Soil | MADRVPLLEIGKLHARVRELKATKGAPPWSEAVVLTDDIQAFIICHLPG |
Ga0310907_105355401 | 3300031847 | Soil | MTTRVPLLELGSLQSRLPDLIAKKGEPPWSEALVL |
Ga0318536_101794721 | 3300031893 | Soil | MADRVPLLEIGKLHARVRELKATKGAPPWSEAVVLTDDIQAFIICHLPGQ |
Ga0318520_101695891 | 3300031897 | Soil | MADRVPLLEIGKLHARVRELKATKGAPPWSEAVVLTDDIQAFIICHLPGQPN |
Ga0318504_101993711 | 3300032063 | Soil | MADRVPLLEIGKLHARVRELKATKGAPPWSEAVVL |
Ga0306920_1032520852 | 3300032261 | Soil | MTERVPLLEVGKLLAGLEDLNAKHGESPWSHPVVLTDDI |
Ga0335084_100538912 | 3300033004 | Soil | MTTTRIPLLEIGSLQSRLPDLIAKKGEPPWSVLTDDIL |
Ga0335084_101748274 | 3300033004 | Soil | MADRIPLLEIGKLQARVSELREKKGEPPWSEALVMTDDIQAFIIC |
Ga0247830_104221891 | 3300033551 | Soil | MTTTRIPLLELGSLQSRLPDLIAKKGEPPWSEALVLTDDI |
Ga0364928_0056746_1_156 | 3300033813 | Sediment | LTERIPLLQLGSLQSRLPELIAKKGAPPWSEAVVLTDDIQAFLICHPPGQPN |
Ga0373950_0025919_936_1061 | 3300034818 | Rhizosphere Soil | MTTRVPLLELGSLQSRLPDLIAKKGEPPWSEALVLTDDIQAF |
⦗Top⦘ |