NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F069346

Metagenome Family F069346

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069346
Family Type Metagenome
Number of Sequences 124
Average Sequence Length 58 residues
Representative Sequence VEIKKDQKENEKQKIFRGSPVKYCLKCGKKKWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Number of Associated Samples 95
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.23 %
% of genes near scaffold ends (potentially truncated) 58.87 %
% of genes from short scaffolds (< 2000 bps) 90.32 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (50.806 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(29.839 % of family members)
Environment Ontology (ENVO) Unclassified
(82.258 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.742 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.23%    β-sheet: 2.27%    Coil/Unstructured: 62.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF136402OG-FeII_Oxy_3 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.16 %
UnclassifiedrootN/A29.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10181426All Organisms → Viruses690Open in IMG/M
3300001346|JGI20151J14362_10046401Not Available1937Open in IMG/M
3300001349|JGI20160J14292_10240740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.504Open in IMG/M
3300001460|JGI24003J15210_10085494Not Available941Open in IMG/M
3300001472|JGI24004J15324_10033820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1635Open in IMG/M
3300002242|KVWGV2_10662207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.515Open in IMG/M
3300004097|Ga0055584_102229899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.558Open in IMG/M
3300004461|Ga0066223_1019835Not Available747Open in IMG/M
3300005613|Ga0074649_1153600Not Available739Open in IMG/M
3300006026|Ga0075478_10096344All Organisms → cellular organisms → Bacteria → Proteobacteria947Open in IMG/M
3300006164|Ga0075441_10189781All Organisms → cellular organisms → Bacteria → Proteobacteria767Open in IMG/M
3300006735|Ga0098038_1032708Not Available1935Open in IMG/M
3300006735|Ga0098038_1050800Not Available1498Open in IMG/M
3300006737|Ga0098037_1199928Not Available654Open in IMG/M
3300006749|Ga0098042_1059715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1018Open in IMG/M
3300006789|Ga0098054_1098239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1097Open in IMG/M
3300006803|Ga0075467_10113418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1599Open in IMG/M
3300006810|Ga0070754_10047007All Organisms → Viruses2304Open in IMG/M
3300006867|Ga0075476_10144871All Organisms → cellular organisms → Bacteria → Proteobacteria890Open in IMG/M
3300006867|Ga0075476_10233379Not Available661Open in IMG/M
3300006919|Ga0070746_10068146All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1821Open in IMG/M
3300006924|Ga0098051_1028138Not Available1601Open in IMG/M
3300006924|Ga0098051_1150822Not Available614Open in IMG/M
3300006929|Ga0098036_1179634All Organisms → Viruses644Open in IMG/M
3300006929|Ga0098036_1189014All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300009002|Ga0102810_1092048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.947Open in IMG/M
3300009423|Ga0115548_1011673All Organisms → Viruses → Predicted Viral3796Open in IMG/M
3300009442|Ga0115563_1142346Not Available972Open in IMG/M
3300009512|Ga0115003_10687322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp.596Open in IMG/M
3300009593|Ga0115011_10097068All Organisms → cellular organisms → Bacteria2078Open in IMG/M
3300009605|Ga0114906_1229141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.613Open in IMG/M
3300010153|Ga0098059_1100848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1147Open in IMG/M
3300010368|Ga0129324_10100260Not Available1250Open in IMG/M
3300010368|Ga0129324_10140245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1014Open in IMG/M
3300011258|Ga0151677_1017603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1152Open in IMG/M
3300017706|Ga0181377_1025896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1246Open in IMG/M
3300017708|Ga0181369_1013483All Organisms → Viruses2057Open in IMG/M
3300017708|Ga0181369_1101110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.599Open in IMG/M
3300017714|Ga0181412_1157955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.508Open in IMG/M
3300017717|Ga0181404_1133685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.602Open in IMG/M
3300017725|Ga0181398_1071792All Organisms → cellular organisms → Bacteria → Proteobacteria831Open in IMG/M
3300017725|Ga0181398_1079389All Organisms → cellular organisms → Bacteria → Proteobacteria786Open in IMG/M
3300017725|Ga0181398_1145342Not Available563Open in IMG/M
3300017726|Ga0181381_1028837Not Available1250Open in IMG/M
3300017731|Ga0181416_1041149All Organisms → cellular organisms → Bacteria → Proteobacteria1086Open in IMG/M
3300017731|Ga0181416_1048494All Organisms → cellular organisms → Bacteria → Proteobacteria1000Open in IMG/M
3300017734|Ga0187222_1031847All Organisms → cellular organisms → Bacteria → Proteobacteria1257Open in IMG/M
3300017734|Ga0187222_1145010All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300017735|Ga0181431_1000327All Organisms → cellular organisms → Bacteria → Proteobacteria15486Open in IMG/M
3300017737|Ga0187218_1013182All Organisms → Viruses2201Open in IMG/M
3300017737|Ga0187218_1134293All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300017739|Ga0181433_1017605Not Available1917Open in IMG/M
3300017744|Ga0181397_1033492Not Available1466Open in IMG/M
3300017746|Ga0181389_1015895Not Available2411Open in IMG/M
3300017746|Ga0181389_1189982Not Available533Open in IMG/M
3300017746|Ga0181389_1191328All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300017750|Ga0181405_1034485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1367Open in IMG/M
3300017750|Ga0181405_1168138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.537Open in IMG/M
3300017753|Ga0181407_1050233Not Available1092Open in IMG/M
3300017753|Ga0181407_1177640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.520Open in IMG/M
3300017755|Ga0181411_1037790All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1516Open in IMG/M
3300017755|Ga0181411_1099744All Organisms → cellular organisms → Bacteria → Proteobacteria859Open in IMG/M
3300017755|Ga0181411_1122011Not Available761Open in IMG/M
3300017759|Ga0181414_1113460All Organisms → Viruses712Open in IMG/M
3300017763|Ga0181410_1071569Not Available1033Open in IMG/M
3300017767|Ga0181406_1074892All Organisms → cellular organisms → Bacteria → Proteobacteria1034Open in IMG/M
3300017769|Ga0187221_1009667Not Available3686Open in IMG/M
3300017769|Ga0187221_1040619Not Available1531Open in IMG/M
3300017769|Ga0187221_1094874All Organisms → cellular organisms → Bacteria → Proteobacteria916Open in IMG/M
3300017771|Ga0181425_1262886All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300017776|Ga0181394_1210027All Organisms → Viruses591Open in IMG/M
3300017779|Ga0181395_1061813Not Available1223Open in IMG/M
3300017779|Ga0181395_1142542All Organisms → Viruses757Open in IMG/M
3300017782|Ga0181380_1270257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.561Open in IMG/M
3300017818|Ga0181565_10210392Not Available1334Open in IMG/M
3300020207|Ga0181570_10317094Not Available775Open in IMG/M
3300020349|Ga0211511_1129972All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300020404|Ga0211659_10102232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1320Open in IMG/M
3300020469|Ga0211577_10090243Not Available2143Open in IMG/M
3300020469|Ga0211577_10352371All Organisms → cellular organisms → Bacteria → Proteobacteria920Open in IMG/M
3300021335|Ga0213867_1280629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.530Open in IMG/M
3300021365|Ga0206123_10381911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.583Open in IMG/M
3300021389|Ga0213868_10455174Not Available696Open in IMG/M
3300022053|Ga0212030_1068650All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300022072|Ga0196889_1009338All Organisms → Viruses → Predicted Viral2178Open in IMG/M
3300022074|Ga0224906_1115150All Organisms → cellular organisms → Bacteria → Proteobacteria782Open in IMG/M
3300024236|Ga0228655_1117318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.555Open in IMG/M
(restricted) 3300024264|Ga0233444_10207060All Organisms → cellular organisms → Bacteria → Proteobacteria901Open in IMG/M
3300025083|Ga0208791_1047867Not Available753Open in IMG/M
3300025098|Ga0208434_1012748All Organisms → Viruses2266Open in IMG/M
3300025098|Ga0208434_1039695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1070Open in IMG/M
3300025099|Ga0208669_1003467Not Available5177Open in IMG/M
3300025099|Ga0208669_1096603All Organisms → cellular organisms → Bacteria → Proteobacteria620Open in IMG/M
3300025101|Ga0208159_1039467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1027Open in IMG/M
3300025102|Ga0208666_1036635All Organisms → Viruses1449Open in IMG/M
3300025102|Ga0208666_1089984All Organisms → cellular organisms → Bacteria → Proteobacteria774Open in IMG/M
3300025102|Ga0208666_1102491Not Available703Open in IMG/M
3300025120|Ga0209535_1125041All Organisms → cellular organisms → Bacteria → Proteobacteria866Open in IMG/M
3300025127|Ga0209348_1156772All Organisms → Viruses665Open in IMG/M
3300025137|Ga0209336_10072334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1020Open in IMG/M
3300025137|Ga0209336_10142712Not Available639Open in IMG/M
3300025138|Ga0209634_1249611All Organisms → Viruses643Open in IMG/M
3300025168|Ga0209337_1224204All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.742Open in IMG/M
3300025543|Ga0208303_1025907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1609Open in IMG/M
3300025577|Ga0209304_1113300All Organisms → cellular organisms → Bacteria → Proteobacteria599Open in IMG/M
3300025590|Ga0209195_1098331All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300025674|Ga0208162_1038273All Organisms → Viruses1693Open in IMG/M
3300025674|Ga0208162_1061445All Organisms → Viruses1219Open in IMG/M
3300025674|Ga0208162_1168086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.585Open in IMG/M
3300025889|Ga0208644_1381398All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300027668|Ga0209482_1154932All Organisms → cellular organisms → Bacteria → Proteobacteria672Open in IMG/M
3300027704|Ga0209816_1261006All Organisms → cellular organisms → Bacteria → Proteobacteria541Open in IMG/M
3300027752|Ga0209192_10294867Not Available586Open in IMG/M
3300027780|Ga0209502_10372735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.593Open in IMG/M
3300027788|Ga0209711_10319983Not Available663Open in IMG/M
3300027859|Ga0209503_10403536Not Available673Open in IMG/M
3300027906|Ga0209404_10411112Not Available883Open in IMG/M
3300028125|Ga0256368_1040693All Organisms → cellular organisms → Bacteria → Proteobacteria826Open in IMG/M
3300028127|Ga0233401_1133551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.550Open in IMG/M
3300031519|Ga0307488_10783756All Organisms → Viruses529Open in IMG/M
3300032274|Ga0316203_1141260All Organisms → Viruses671Open in IMG/M
3300032277|Ga0316202_10067459All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1665Open in IMG/M
3300033742|Ga0314858_043360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1074Open in IMG/M
3300033742|Ga0314858_132828Not Available637Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine29.84%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater29.84%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.48%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.65%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.23%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.23%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine2.42%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.42%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.61%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.61%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.61%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.81%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.81%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.81%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.81%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.81%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.81%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.81%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.81%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.81%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment0.81%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001349Pelagic Microbial community sample from North Sea - COGITO 998_met_10EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300002242Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey matEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005613Saline sediment microbial communities from Etoliko Lagoon, Greece - sedimentEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020207Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020349Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300024236Seawater microbial communities from Monterey Bay, California, United States - 67DEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025577Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes)EnvironmentalOpen in IMG/M
3300025590Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300028127Seawater microbial communities from Monterey Bay, California, United States - 49DEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1018142613300000116MarineQSRFQVEIKNDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEELRSAKRRMLSQSKSKI*
JGI20151J14362_1004640153300001346Pelagic MarineMEIKNEKQNENEKQKIFRGSPVKYCLKCKKKRWTCTCYKVSGLEEIRSAKRRMLS
JGI20160J14292_1024074013300001349Pelagic MarineMEIKNEKQNENEKQKIFRGSPVKYCLKCKKKRWTCTCYKVSGLEEIRSAKRRMLSQS
JGI24003J15210_1008549443300001460MarineEIKNDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEEIRSAKRRMLSQSKSKI*
JGI24004J15324_1003382013300001472MarineVEIKNDQKENEKQKIFRGSPVKYCLNCKKKKWSCTCYRVSGFEELRNAKRRMLSKSKSKI
KVWGV2_1066220733300002242Marine SedimentVEIGKEKREKEKQKIFRGSPVKYCLNCGRKKWSCRCYRVSGFEELKNAKRRM
Ga0055584_10222989933300004097Pelagic MarineMEIKNDQKENEKQKIFRGSPVKYCLKCKKKRWTCTCYRVSGLEEIRSAKRRMLSQSK
Ga0066223_101983533300004461MarineVEIKEEEQKKEKQRIFKGSPVKYCTDCGKKRWSCRCYKVTGLEELRNAKRR
Ga0074649_115360033300005613Saline Water And SedimentVEIKKRKEREIIKGSPVKYCLDCGHRKWSCKCYRVTGFEELRNAKRRMLSQSKS
Ga0075478_1009634413300006026AqueousKENEKQKIFRGSPVKYCLKCGKKKWTCTCYKVSGLEELRSAKRRMLSQSKSKI*
Ga0075441_1018978133300006164MarineVDLKKDQEKEQQIIKGSPVKYCLSCNKKKWSCRCYRVTGLEELRNAKRRMLSESKSKL*
Ga0098038_103270813300006735MarinePFQVEIKEKKENEKQKIFRGSPVKYCLGCGKKKWSCRCYRVSGFEELKNVKKRRMLSQSKSKI*
Ga0098038_105080053300006735MarineVEIEKQKKENEKQKIFKGSPVKYCVDCGHRKWSCKCYRVSGLEELRNVKK
Ga0098037_119992813300006737MarineVEIKEKKENEKQKIFRGSPVKYCLLCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKV*
Ga0098042_105971543300006749MarineVEIKEKKEKEKQKIFRGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKV*
Ga0098054_109823913300006789MarineVEIKKDQKENEKQKIFRGSPVKYCLKCKKKKWTCTCYRITGLEELRNAKRRMLSQSKSKI
Ga0075467_1011341813300006803AqueousVEIEKEKREKEKQKIFKGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKS
Ga0070754_1004700753300006810AqueousMEIKKDQKENEKQKIFRGSPVKYCLKCGKKKWICTCYRITGLEELRNAKRRMLSESKSKI
Ga0075476_1014487143300006867AqueousDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEEIRSAKRRMLSQSKSKI*
Ga0075476_1023337933300006867AqueousVEIKNDQKENEKQKIFRGSPVKYCLKCGKKKWTCTCYKVSGLEELRSAKRRMLSQSKS
Ga0070746_1006814653300006919AqueousVEIKNDQKENEKQKIFRGSPVKYCLKCGKKKWTCTCYKVSGLEELRSAKRRMLSQS
Ga0098051_102813813300006924MarineQSLVQVEVKKEKEKEKIFRGSPVKYCLECGRKKWTCKCYKVTGFEELRNAKRRMLSQSKVKI*
Ga0098051_115082233300006924MarineVEVKKEKEKEKIFKGSPVKYCLECGRKKWICKCYKVTGFEELRNAKRRMLSQSKVKI*
Ga0098036_117963413300006929MarineKKENEKQKIFKGSPVKYCVDCGHRKWSCKCYRVSGLEELRNVKKRRMLSQGESKV*
Ga0098036_118901423300006929MarineVEIKEKKENEKQKIFRGSPVKYCLNCGRKKWSCRCYRVSGFEELKNVKKRRMLPQGESKV
Ga0102810_109204843300009002EstuarineVEIKNDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEELRSAKRRML
Ga0115548_101167383300009423Pelagic MarineMEIKNERQNENKKQKIFRGSPVKYCLKCKKKRWTCTCYKVSGLEELRSAKRR
Ga0115563_114234643300009442Pelagic MarineMEIKNEKQNENEKQKIFRGSPVKYCLKCKKKRWTCTCYKVSGLEELRNAKRRMLSQSKSKI*
Ga0115003_1068732213300009512MarineVEIKEEEQKKEKQRIFKGSPVKYCTDCGKKRWSCRCYKVTGLEELRNAKRRMLSKSKSKL
Ga0115011_1009706843300009593MarineMALEKEKEREKQKIIKGNPVKYCTGCGKKKWSCRCYRVSGFEEMKKAKERQR*
Ga0114906_122914133300009605Deep OceanVEIERKKEKKEKQKIFRGSPVKYCLSCGRKKWSCRCYRVSGFEELRNVKKRRMLSQGKSKV*
Ga0098059_110084853300010153MarineVEIKEKKENEKQKIFRGSPVKYCLLCGRKKWSCRCYRVSGFEELRNAKRR
Ga0129324_1010026013300010368Freshwater To Marine Saline GradientMEIKKDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEEIRSAK
Ga0129324_1014024543300010368Freshwater To Marine Saline GradientVEVKKEKEKEKIFRGSPVKYCLDCGHRKWSCKCYRVTGFEELRNAKRR
Ga0151677_101760353300011258MarineVEIKKEKQENEKQKIFRGSPVKYCLNCRKKKWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0181377_102589653300017706MarineVEIKKDQKENEKQKIFRGSPVKYCLKCKKKRWTCTCYKVSGLEELRSAKRRML
Ga0181369_101348333300017708MarineMEIKKDQKENEKQKIFRGSPVKYCLNCKKKKWTCTCYRITGLEELRNAKRRMLSQSKSKI
Ga0181369_110111033300017708MarineVEIERKNEKNEKQKIFKGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKS
Ga0181412_115795513300017714SeawaterVEIKKDQKENEKQKIFRGSPVKYCLKCGKKKWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0181404_113368513300017717SeawaterVEIKEKKENEKQKIFRGSPVKYCLLCGRKKWSCRCYRVSGFEELRNVKKRRM
Ga0181398_107179213300017725SeawaterNKFQSPFQVEIEKEKRENEKQKIFRGSPVKYCLKCGKKKWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0181398_107938923300017725SeawaterVEIKNDQKEKEKQKIFRGSPVKYCLKCGKKKWSCRCYRVSGLEELRYAKRRMLSQSKSKI
Ga0181398_114534213300017725SeawaterEKQKIFRGSPVKYCLKCGKKKWTCTCYKVSGLEEIRSAKRRMLSQSKSKI
Ga0181381_102883713300017726SeawaterIKNDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEEIRSAKRRMLSQSKSKI
Ga0181416_104114913300017731SeawaterQSRFQVEIKNDQKENEKQKIFRGSPVKYCLKCGKKKWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0181416_104849413300017731SeawaterRFQVEIKNDQKENEKQKIFRGSPVKYCFKCGKKKWICTCYKVSGLEELRNAKRRMLSQSKSKI
Ga0187222_103184713300017734SeawaterSRFQVEIKNDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0187222_114501023300017734SeawaterVEIEKEKRENEKQKIFKGSPVKYCLKCGRKKWSCRCYRVSGFEELKNAKRRMLSQSKSKV
Ga0181431_100032753300017735SeawaterMEIKNEKQNENEKQKIFRGSPVKYCLKCKKKRWTCTCYKVSGLEELRSAKRRMLSQSKSK
Ga0187218_101318243300017737SeawaterMEIKKDQKENEKQKIFRGSPVKYCLKCGKKRWTCTCYKVSGLEELRNAKRRMLSQSKSKI
Ga0187218_113429323300017737SeawaterVEIEKNEKQKNEKQKIFRGSPVKYCLDCGKKKWSCTCYRVTGFEELRNAKRRMLSQSKSK
Ga0181433_101760523300017739SeawaterVEIEKEKRENEKQKIFKGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKS
Ga0181397_103349253300017744SeawaterQSRFQVEIKNDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0181389_101589523300017746SeawaterVEIEKEKRENEKQKIFKGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKI
Ga0181389_118998213300017746SeawaterMEIKKDQKENEKQKIFRGSPVKYCLKCGKKRWTCTCYKVSGLEEIRSAKRRMLSQ
Ga0181389_119132813300017746SeawaterSRFQVEIKNDQKEKEKQKIFRGSPVKYCLKCGKKKWSCTCYRVSGFEELRNAKRRMLSKSKSKI
Ga0181405_103448513300017750SeawaterMEIKNEKQNENEKQKIFRGSPVKYCLKCKKKRWTCTCYKVSGLEELRSAKRRTLSQSKSK
Ga0181405_116813813300017750SeawaterVEIKEKKENEKQKIFRGSPVKYCLLCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKV
Ga0181407_105023353300017753SeawaterFQVEIKNDQKENEKQKIFRGSPVKYCLECGKKKWSCTCYRVSGFEELRNAKRRMLSKSKSKI
Ga0181407_117764013300017753SeawaterVEIKNDQKENEKQKIFRGSPVKYCLKCKKKRWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0181411_103779053300017755SeawaterVEIEKNEKQKNEKQKIFRGSPVKYCLDCGKKRWTCTCYKVSGLEEIRSAKRRMLSQ
Ga0181411_109974413300017755SeawaterKEKKENEKQKIFRGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKV
Ga0181411_112201143300017755SeawaterVEIKEKKENEKQKIFRGSPVKYCLLCGRKKWSCRCYRVSGFEELRNAKR
Ga0181414_111346033300017759SeawaterQVEIEKEKRENEKQKIFRGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSK
Ga0181410_107156913300017763SeawaterKEKREKEKQKIFKGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKV
Ga0181406_107489233300017767SeawaterVEIEKEKRENEKQKIFRGSPVKYCLKCGRKKWSCRCYRVSGFEELRNVKKRRMLSQGKSK
Ga0187221_100966793300017769SeawaterVEIKKDQKENEKQKIFRGSPVKYCLKCGKKRWTCTCYKVSGLEELRNAKRRMLSQSKSKI
Ga0187221_104061953300017769SeawaterKNDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0187221_109487433300017769SeawaterVEIEKEKRENEKQKIFKGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKV
Ga0181425_126288633300017771SeawaterFQVEIEKEKRENEKQKIFKGSPVKYCLGCGRKKWSCRCYRVSGFEELRNVKKRRMLSQGKSKV
Ga0181394_121002713300017776SeawaterKENEKQKIFRGSPVKYCFKCGKKKWICTCYKVSGLEELRNAKRRMLSKSKSKI
Ga0181395_106181313300017779SeawaterFQVEIKNDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEEIRSAKRRMLSQSKSKI
Ga0181395_114254213300017779SeawaterQSPFQVEIKEKKEKNEKQKIFKGSPVKYCLGCGRKKWSCRCYRVSGFEELRNVKKRRMLSQGKSKV
Ga0181380_127025713300017782SeawaterVEIKEKKENEKQKIFRGSPVKYCLLCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKI
Ga0181565_1021039253300017818Salt MarshVEVKKEKQKEREIIRGSPVKYCLDCGHRKWSCRCYRVSGIEELRHAKRRLLSQSKS
Ga0181570_1031709413300020207Salt MarshVEVKKEKQKEREIIRGSPVKYCLDCGHRKWSCRCYRVSGIEELRHAKRRLLSQ
Ga0211511_112997213300020349MarineVEIGKEKREKEKQKIFRGSPVKYCLLCGRKKWSCRCYRVSGFEELRNVKKRRMLSQGKSK
Ga0211659_1010223213300020404MarineVEIKEKKENEKQKIFRGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRML
Ga0211577_1009024363300020469MarineANKFQSPFQVEIEKEKRENEKQKIFRGSPVKYCLKCGRKKWSCRCYRVSGFEELRNVKKRRMLSQGKSKV
Ga0211577_1035237143300020469MarineANKFQSPFQVEIEKEKRENEKQKIFKGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKV
Ga0213867_128062923300021335SeawaterMEIKKDQKENEKQKIFRGSPVKYCLKCGKKKWICTCYRITGLEELRNAKRRMLSQSKSKI
Ga0206123_1038191113300021365SeawaterMEIKKDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEEIRSAKRRMLSQSK
Ga0213868_1045517433300021389SeawaterMEIKKDQKENEKQKIFRGSPVKYCLKCGKKKWICTCYRITGLEELRNAKRRMLSQSKSK
Ga0212030_106865033300022053AqueousVEIKNDQKENEKQKIFRGSPVKYCLKCGKKKWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0196889_100933813300022072AqueousMEIKKDQKENEKQKIFRGSPVKYCLKCGKKKWICTCYRITGLEELRNAKR
Ga0224906_111515033300022074SeawaterVEIEKEKRENEKQKIFRGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKV
Ga0228655_111731833300024236SeawaterVEIEKNEKQKNEKQKIFRGSPVKYCLDCGKKRWTCTCYKVSGLEELRSAKRRMLSQSK
(restricted) Ga0233444_1020706033300024264SeawaterMEIKNDQKENEKQKIFRGSPVKYCLKCGKKKWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0208791_104786713300025083MarineMEIKKDQKENEKQKIFRGSPVKYCLKCKKKRWTCTCYKVSGLEELRSAKRRMLSQSKS
Ga0208434_101274863300025098MarineMEIKKDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0208434_103969513300025098MarineVEIKRQKEEKQKQKIFRGSPVKYCLLCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKS
Ga0208669_100346773300025099MarineMEIKKDQKENEKQKIFRGSPVKYCLNCKKKKWTCTCYRVTGLEELRNAKRRMLSQSKSKI
Ga0208669_109660323300025099MarineVEIKEKKENEKQKIFRGSPVKYCLNCGRKKWSCRCYRVSGFEELKNVKKRRMLSQGKGEV
Ga0208159_103946743300025101MarineVEIKEKKEKEKQKIFRGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKV
Ga0208666_103663543300025102MarineVEIERKNEKNEKQKIFKGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQSKSKV
Ga0208666_108998423300025102MarineVEIKKDQKENEKQKIFRGSPVKYCLNCKKKKWTCTCYRITGLEELRNAKRRMLSQSKSKI
Ga0208666_110249133300025102MarineVEIKEKKENEKQKIFRGSPVKYCLKCGRKKWSCRCYRVSGFEELRNVKKR
Ga0209535_112504133300025120MarineVEIEKNEKQKNEKQKIFRGSPVKYCLDCGKKKWSCTCYRVSGFEELRNAKRRMLSKSKSK
Ga0209348_115677213300025127MarineVEIKEKKENEKQKIFRGSPVKYCLNCGRKKWSCKCYRVSGLEELRNVKKRRMLPQGESKV
Ga0209336_1007233443300025137MarineVEIEKEKREKEKQKIFRGSPVKYCLKCGRKKWSCRCYRVSGFEELRNVKKRRMLSQGKSK
Ga0209336_1014271213300025137MarineVEIKEEEQKKEKQRIFKGSPVKYCTDCGKKRWSCRCYKVTGLEELRNAKRRMLSKSKS
Ga0209634_124961133300025138MarineFQVEIEKNEKQKNEKQKIFRGSPVKYCLDCGKKKWSCTCYRVTGFEELRNAKRRMLSKSKSKI
Ga0209337_122420433300025168MarineVEIEKNEKQKNEKQKIFRGSPVKYCLDCGKKKWSCTCYRVSGFEELRNAKRRMLSKSKS
Ga0208303_102590753300025543AqueousVEIEKEKREKEKQKIFKGSPVKYCLKCGRKKWSCRCYRVSGFEELRNAKRRMLSQ
Ga0209304_111330033300025577Pelagic MarineMEIKKDQKENEKQKIFRGSPVKYCFKCGKKKWICTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0209195_109833123300025590Pelagic MarineMEIKNEKQNENEKQKIFRGSPVKYCLKCKKKRWTCTCYKVSGLEEIRSAKRRMLSQSKSK
Ga0208162_103827353300025674AqueousMEIKKDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEEIRSAKRRMLSQSKSKI
Ga0208162_106144513300025674AqueousQMEIKKDQKENEKQKIFRGSPVKYCLKCGKKKWICTCYRITGLEELRNAKRRMLSQSKSK
Ga0208162_116808623300025674AqueousVEIGKNEKRKNEKQKIFRGSPVKYCLECGKKKWSCTCYRVSGFEELRNAKRRMLSKSKSK
Ga0208644_138139823300025889AqueousVEIGKNEKQKNEKQKIFRGSPVKYCLECGKKKWSCTCYRVSGFEELRNAKRRMLSKSKSK
Ga0209482_115493233300027668MarineVDLKKDQEKEQQIIKGSPVKYCLSCNKKKWSCRCYRVTGLEELRNAKRRMLSESKSKL
Ga0209816_126100613300027704MarineLKKDQEKEQQIIKGSPVKYCLSCNKKKWSCRCYRVTGIEELKNAKRRMLSESKSKL
Ga0209192_1029486723300027752MarineVEIKEEEQKKEKQRIFKGSPVKYCTDCGKKRWSCRCYKVTGLEELRNAKRRMLSKSKSKI
Ga0209502_1037273533300027780MarineVEIKKDQKEKERPKIFRGSPVKYCLECGKKKWSCKCYKVTGIEELRNAKRRMLSESKSKI
Ga0209711_1031998313300027788MarineVEIKEEEQKKEKQRIFKGSPVKYCTDCGKKRWSCRCYKVTGVEELRNAKRRMLSKS
Ga0209503_1040353633300027859MarineVEIKEKKENEKQKIFRGSPVKYCLLCGRKKWSCRCYRVSGFEELRNVKKRRMLSQSKSKV
Ga0209404_1041111233300027906MarineMALEKEKEREKQKIIKGNPVKYCTGCGKKKWSCRCYRVSGFEEMKKAKERQR
Ga0256368_104069323300028125Sea-Ice BrineVEIKKDQKEKEKQRIFKGSPVKYCTDCGKKKWSCRCYKVTGLEELRNAKRRMLSESKSKL
Ga0233401_113355113300028127SeawaterVEIEKNEKQKNEKQKIFRGSPVKYCLDCGKKRWTCTCYKVSGLEELRSAKRRMLSQSKSK
Ga0307488_1078375633300031519Sackhole BrineKQRIFKGSPVKYCIDCGKKKWSCRCYKVTGLEELRNAKRRMLSKSKSKI
Ga0316203_114126033300032274Microbial MatKQKIFRGSPVKYCLKCGKKKWTCTCYKVSGLEELRSAKRRMLSQSKSKI
Ga0316202_1006745953300032277Microbial MatVEIKNDQKENEKQKIFRGSPVKYCLNCKKKRWTCTCYKVSGLEELRSA
Ga0314858_043360_856_10413300033742Sea-Ice BrineVEIEKNEKQKNEKQKIFRGSPVKYCLDCGKKKWSCRCYKVSGLEELRSAKRRMLSQSKSK
Ga0314858_132828_141_3233300033742Sea-Ice BrineMEIKEEKLKNEKQRIFKGSPVKYCTDCGKKRWSCRCYKVTGLEELRNAKRRMLSKSKSKI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.