NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069299

Metagenome / Metatranscriptome Family F069299

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069299
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 41 residues
Representative Sequence MVSALFEESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH
Number of Associated Samples 89
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 45.16 %
% of genes near scaffold ends (potentially truncated) 48.39 %
% of genes from short scaffolds (< 2000 bps) 87.10 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.161 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.613 % of family members)
Environment Ontology (ENVO) Unclassified
(36.290 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.032 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.00%    β-sheet: 14.71%    Coil/Unstructured: 60.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF00296Bac_luciferase 14.52
PF16868NMT1_3 8.87
PF00355Rieske 4.03
PF07681DoxX 2.42
PF13620CarboxypepD_reg 1.61
PF09084NMT1 0.81
PF01970TctA 0.81
PF07331TctB 0.81
PF13442Cytochrome_CBB3 0.81
PF00005ABC_tran 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 14.52
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 2.42
COG4270Uncharacterized membrane proteinFunction unknown [S] 2.42
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.81
COG1784TctA family transporterGeneral function prediction only [R] 0.81
COG3333TctA family transporterGeneral function prediction only [R] 0.81
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.16 %
UnclassifiedrootN/A4.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10019857All Organisms → cellular organisms → Bacteria1845Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10084775All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300002906|JGI25614J43888_10097358All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300002917|JGI25616J43925_10271320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300004268|Ga0066398_10119944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria631Open in IMG/M
3300004633|Ga0066395_10025703All Organisms → cellular organisms → Bacteria2398Open in IMG/M
3300004633|Ga0066395_10179058All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300005163|Ga0066823_10033733All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300005164|Ga0066815_10076815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300005332|Ga0066388_102678895All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300005332|Ga0066388_102850565All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300005332|Ga0066388_103122511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria846Open in IMG/M
3300005332|Ga0066388_103177687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria839Open in IMG/M
3300005332|Ga0066388_103566560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria794Open in IMG/M
3300005332|Ga0066388_104678449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria696Open in IMG/M
3300005363|Ga0008090_10114455All Organisms → cellular organisms → Bacteria1985Open in IMG/M
3300005363|Ga0008090_10175713All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300005363|Ga0008090_10192612All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300005363|Ga0008090_10265656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria648Open in IMG/M
3300005363|Ga0008090_15813601All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300005467|Ga0070706_100949749Not Available793Open in IMG/M
3300005467|Ga0070706_101105531All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300005540|Ga0066697_10561477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria638Open in IMG/M
3300005713|Ga0066905_101768335All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005713|Ga0066905_101979568Not Available540Open in IMG/M
3300005713|Ga0066905_102084196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria527Open in IMG/M
3300005713|Ga0066905_102170764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria517Open in IMG/M
3300005764|Ga0066903_102209559All Organisms → cellular organisms → Bacteria → Proteobacteria1061Open in IMG/M
3300005764|Ga0066903_103173503All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300005764|Ga0066903_103327329All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300005764|Ga0066903_104331945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria758Open in IMG/M
3300006172|Ga0075018_10022203All Organisms → cellular organisms → Bacteria2467Open in IMG/M
3300006175|Ga0070712_100043247All Organisms → cellular organisms → Bacteria → Proteobacteria3100Open in IMG/M
3300006604|Ga0074060_10017430All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300006845|Ga0075421_101220044All Organisms → cellular organisms → Bacteria → Proteobacteria838Open in IMG/M
3300006845|Ga0075421_102405687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300009012|Ga0066710_101656176All Organisms → cellular organisms → Bacteria → Proteobacteria977Open in IMG/M
3300009038|Ga0099829_10013676All Organisms → cellular organisms → Bacteria → Proteobacteria5360Open in IMG/M
3300009088|Ga0099830_10146609All Organisms → cellular organisms → Bacteria1812Open in IMG/M
3300009089|Ga0099828_10185582All Organisms → cellular organisms → Bacteria1851Open in IMG/M
3300009137|Ga0066709_102029836All Organisms → cellular organisms → Bacteria → Proteobacteria796Open in IMG/M
3300009147|Ga0114129_12380932All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300009792|Ga0126374_10979034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300009792|Ga0126374_11495024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria554Open in IMG/M
3300010043|Ga0126380_11695184All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300010047|Ga0126382_10448744All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300010048|Ga0126373_10411305Not Available1379Open in IMG/M
3300010048|Ga0126373_10778312All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300010303|Ga0134082_10302128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium671Open in IMG/M
3300010359|Ga0126376_11207450All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300010362|Ga0126377_11194500All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300010366|Ga0126379_11453225All Organisms → cellular organisms → Bacteria → Proteobacteria791Open in IMG/M
3300010376|Ga0126381_103862699All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300010398|Ga0126383_10877190All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300010398|Ga0126383_12926683All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300010398|Ga0126383_13166175All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300011106|Ga0151489_1706313All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300012199|Ga0137383_10017445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68604929Open in IMG/M
3300012200|Ga0137382_10057312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.2454Open in IMG/M
3300012201|Ga0137365_10010919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68607175Open in IMG/M
3300012211|Ga0137377_10218672Not Available1830Open in IMG/M
3300012350|Ga0137372_10786111Not Available683Open in IMG/M
3300012361|Ga0137360_11076330All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300012923|Ga0137359_10435956All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300012948|Ga0126375_10859025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria725Open in IMG/M
3300012948|Ga0126375_11311315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300012971|Ga0126369_10598049All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300012984|Ga0164309_10081746Not Available1982Open in IMG/M
3300012985|Ga0164308_12074271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300016357|Ga0182032_11617380All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300016387|Ga0182040_10479680All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300018433|Ga0066667_10353364All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300018468|Ga0066662_10005406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68606270Open in IMG/M
3300018468|Ga0066662_10076038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602273Open in IMG/M
3300020581|Ga0210399_11199146All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300021372|Ga0213877_10022062All Organisms → cellular organisms → Bacteria1720Open in IMG/M
3300021439|Ga0213879_10017226All Organisms → cellular organisms → Bacteria1679Open in IMG/M
3300025928|Ga0207700_10735959All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300026301|Ga0209238_1118027All Organisms → cellular organisms → Bacteria → Proteobacteria877Open in IMG/M
3300026312|Ga0209153_1256774All Organisms → cellular organisms → Bacteria → Proteobacteria562Open in IMG/M
3300026532|Ga0209160_1165511All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300026538|Ga0209056_10253037All Organisms → cellular organisms → Bacteria → Proteobacteria1250Open in IMG/M
3300027576|Ga0209003_1008590All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300027846|Ga0209180_10076829All Organisms → cellular organisms → Bacteria1881Open in IMG/M
3300027874|Ga0209465_10021346All Organisms → cellular organisms → Bacteria2986Open in IMG/M
3300027875|Ga0209283_10257097All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300027882|Ga0209590_10041461All Organisms → cellular organisms → Bacteria2511Open in IMG/M
3300031543|Ga0318516_10005124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68605922Open in IMG/M
3300031543|Ga0318516_10069326All Organisms → cellular organisms → Bacteria1952Open in IMG/M
3300031543|Ga0318516_10073682All Organisms → cellular organisms → Bacteria1897Open in IMG/M
3300031543|Ga0318516_10085394All Organisms → cellular organisms → Bacteria1766Open in IMG/M
3300031543|Ga0318516_10170445All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300031543|Ga0318516_10234292All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300031544|Ga0318534_10187006All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300031544|Ga0318534_10653612All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300031549|Ga0318571_10031101All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300031561|Ga0318528_10575009All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300031572|Ga0318515_10040544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602310Open in IMG/M
3300031572|Ga0318515_10754111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300031680|Ga0318574_10694097All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300031713|Ga0318496_10020545All Organisms → cellular organisms → Bacteria3259Open in IMG/M
3300031723|Ga0318493_10050523All Organisms → cellular organisms → Bacteria1965Open in IMG/M
3300031723|Ga0318493_10363936All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300031724|Ga0318500_10548281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300031736|Ga0318501_10167818All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300031744|Ga0306918_10441204All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300031748|Ga0318492_10439510All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300031764|Ga0318535_10400516All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300031769|Ga0318526_10209101All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300031777|Ga0318543_10072243All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300031792|Ga0318529_10346597All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300031795|Ga0318557_10178831All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300031797|Ga0318550_10024178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602556Open in IMG/M
3300031820|Ga0307473_10977294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300031832|Ga0318499_10066617All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300031832|Ga0318499_10306624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria613Open in IMG/M
3300031879|Ga0306919_11157315All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031890|Ga0306925_10705436All Organisms → cellular organisms → Bacteria → Terrabacteria group1055Open in IMG/M
3300032025|Ga0318507_10247290All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300032067|Ga0318524_10464869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300032174|Ga0307470_10192144All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300033289|Ga0310914_10271223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1527Open in IMG/M
3300033289|Ga0310914_10913050All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300033290|Ga0318519_10025975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.2697Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil14.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.03%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.23%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.61%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.61%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027576Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1001985723300000597Forest SoilMVSALFEESGEIAPVDLGQFGKRAGEIIARAKHWSRRRPH*
AF_2010_repII_A1DRAFT_1008477523300000597Forest SoilMVSALFKESGEIAPVDLGQFGNRAGEIIARATHWSRRRPH*
JGI25614J43888_1009735823300002906Grasslands SoilMVSALFEESGEIAAVDLGLFGKRAGEIIARATRLPRRRPH*
JGI25616J43925_1027132013300002917Grasslands SoilMVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH*
Ga0066398_1011994423300004268Tropical Forest SoilMVSALFEESGEIAPVDLGQFGKRAGEIIARATRLPTRRPH*
Ga0066395_1002570323300004633Tropical Forest SoilMVSALFEERGEIAGVDLGQFGKRAGEIIARGTHWSRRRPH*
Ga0066395_1017905823300004633Tropical Forest SoilMVSALFEESGEIAPVDLGLFGKRAGEIIAHATRLPRRRPH*
Ga0066823_1003373323300005163SoilMVSALFEESGEIAAVDLGQFGKRAGEIIARATRLRRRRPH*
Ga0066815_1007681523300005164SoilMVSALFEESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH*
Ga0066388_10267889523300005332Tropical Forest SoilMMVSALFEESGEIAPIDLGQFGKRAGEIIARARQLPRRRPH*
Ga0066388_10285056523300005332Tropical Forest SoilMVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPTRRPH*
Ga0066388_10312251123300005332Tropical Forest SoilMVSALFEESGEIAPVDLGQFGKRAGEIIAGATRRPRRRPH*
Ga0066388_10317768723300005332Tropical Forest SoilMMVSALFEESGEIAPVDIGRFGKRAGEIIARATRLPRRRPH*
Ga0066388_10356656023300005332Tropical Forest SoilMVSALFKENGEIAPVDLGQFGKRAGEIIARATHWSRRRPH*
Ga0066388_10467844913300005332Tropical Forest SoilMMVSALFEESGEIAPVDLGQFGKRAGEIIARATYPSRRRPH*
Ga0008090_1011445523300005363Tropical Rainforest SoilMVSALFEESGEIAPVDLGQFGKRAGEIIACATRLPRHRPH*
Ga0008090_1017571313300005363Tropical Rainforest SoilMVSALFEESGEIAPVDLGQFGKRAGEIIARATHWSRRRPH*
Ga0008090_1019261223300005363Tropical Rainforest SoilRWSLSDHKPMVSALFKESGEIAPVDLGQFGKRAGEIIARATHWSRRRPH*
Ga0008090_1026565613300005363Tropical Rainforest SoilMVSALFKESGEIAPVDLGQFGKRAGEIIARATHWSRRRPH*
Ga0008090_1581360123300005363Tropical Rainforest SoilMVSALFEESGGIAPVDLGQFGKRAGEIIARATRLPRRRPH*
Ga0070706_10094974923300005467Corn, Switchgrass And Miscanthus RhizosphereMVSALFEESGEIAAVDLGLFGKRAGEIIAHATRLPRRRPH*
Ga0070706_10110553113300005467Corn, Switchgrass And Miscanthus RhizosphereMVSALFEESGEIAPVDLGQFGKRAGEIIARATYLPRRRPH*
Ga0066697_1056147713300005540SoilMVSALFEESGEIAAVDLGLFGKRAGEIIARATRLPRR
Ga0066905_10176833523300005713Tropical Forest SoilDPKMMVSALFEESGEIAPVDIGRFGKRAGEIIARATQLPRRRPH*
Ga0066905_10197956813300005713Tropical Forest SoilMMVSALFAESGEIAPVDLGRFGKRAGEIIARATQL
Ga0066905_10208419623300005713Tropical Forest SoilMMVSALFEQSGEIAPVDIGRFGKRAGEIIARATQLPRRRPH*
Ga0066905_10217076423300005713Tropical Forest SoilLFAESGEIAPVDLGRFGKRAGEIIARATQLPRRRPY*
Ga0066903_10220955923300005764Tropical Forest SoilLFEQSGEIAPVDFRRFGTRAGEIIARAASLPRRKAL*
Ga0066903_10317350323300005764Tropical Forest SoilRWSISDPKLMVSALFEESGEIAPVDLGRFGKRAGEIIARATQLPRRRPY*
Ga0066903_10332732923300005764Tropical Forest SoilMMMSALFEESGGIAPIDIGQFGKRAGEIIARATQLPRRRPH*
Ga0066903_10433194523300005764Tropical Forest SoilMVSALFEESGEIAPVDFGQFGKRAGEIIARATHWSRRRPH*
Ga0075018_1002220343300006172WatershedsMVSALFEESGEIAPVDLGLFGKRAGEIIARATRLPRRRPH*
Ga0070712_10004324743300006175Corn, Switchgrass And Miscanthus RhizosphereSDTKPMVSALFEESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH*
Ga0074060_1001743023300006604SoilMVSALFEESGEIAAVDLGLFGRRAGEIIAHATRLPRRRPH*
Ga0075421_10122004423300006845Populus RhizosphereDERSKSDPKHVISALFEESGEVAAVDFRQFGKRAGEIIADATRLPHRKPH*
Ga0075421_10240568723300006845Populus RhizosphereMVSALFEESGEIAPVDLGQFGKRAGEIIARATHLPRRRPH*
Ga0066710_10165617623300009012Grasslands SoilDRDERSKSDPKHVISALFEESGEVAPVDFRRFGTRAGEIIARATRLPYRRAH
Ga0099829_1001367653300009038Vadose Zone SoilMVSVLFEESGEIAAVDLGQFGKRAGEIIAHATRLPRRRPH*
Ga0099830_1014660923300009088Vadose Zone SoilSLSDANPMVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH*
Ga0099828_1018558233300009089Vadose Zone SoilMVSALFEESGEIAAVDLGQFGKRAGDIIARATRLPRRRPH*
Ga0066709_10202983623300009137Grasslands SoilNESGEVAPVDFSQFGKRTGEIIARATRQPRRKPH*
Ga0114129_1238093223300009147Populus RhizosphereSLSDAKPMVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRSH*
Ga0126374_1097903423300009792Tropical Forest SoilLDRKLMVSALFEESGEIAAVDLGQFGKRAGEIIARGTHWSRRRPH*
Ga0126374_1149502423300009792Tropical Forest SoilFEESGEIAPVDFGQFGKRAGEIIACATRLPRRRPH*
Ga0126380_1169518413300010043Tropical Forest SoilKLMVSALFEESGEIAPVDLGRFGKRAGEIIARATQLPRRRPY*
Ga0126382_1044874423300010047Tropical Forest SoilMVSALFEESGQIAPVDLGQFGKRAGEIIARATRLPRRRPH*
Ga0126373_1041130523300010048Tropical Forest SoilMVSALFEESGEIAPVDLGQFGKRAGEIIACATRLPRRRPH*
Ga0126373_1077831223300010048Tropical Forest SoilLDRKLMVSALFEESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH*
Ga0134082_1030212823300010303Grasslands SoilNESGEVAPVDFSQFGKRTGEIIARATRLPRRKPH*
Ga0126376_1120745023300010359Tropical Forest SoilIVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH*
Ga0126377_1119450023300010362Tropical Forest SoilMMVSALFEESGEIAPVDIGRFGKRAGEIIARATQLPRRRPH*
Ga0126379_1145322513300010366Tropical Forest SoilIAALFEQSGEIAPVDFRRFGMRAGEIIARAASLPRRKAL*
Ga0126381_10386269923300010376Tropical Forest SoilSDPKLIVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH*
Ga0126383_1087719023300010398Tropical Forest SoilMVSALFKENGEIAPVDLGQFGKRAGEIIARATHWSRRRP
Ga0126383_1292668323300010398Tropical Forest SoilVSALFEESGEIAPVDLGRFGKRAGEIIARATQLPRRRPY*
Ga0126383_1316617523300010398Tropical Forest SoilLMVSALFEESGEIAPIDIGQFGKRAGEIIARARRLPRRRPH*
Ga0151489_170631313300011106SoilLFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH*
Ga0137383_1001744543300012199Vadose Zone SoilMVSALFEDSGEIAPVDLGQFGKRAGEIIARATYPQRRRPH*
Ga0137382_1005731213300012200Vadose Zone SoilERWSLSDAKPMVSALFEESGEIAAVDLGLFGKRAGEIIARATRLPRRRPH*
Ga0137365_1001091953300012201Vadose Zone SoilMVSALFEESGEIASVDLGQFGKRAGEIIARATYPQRRRPH*
Ga0137377_1021867223300012211Vadose Zone SoilMVSALFEESGGIAAGDLGLVGKRAGEIIPPATRLPRRRPH*
Ga0137372_1078611123300012350Vadose Zone SoilMVSALFEDSGEIASVDLGQFGKRAGEIIARATYPQRRRPH*
Ga0137360_1107633013300012361Vadose Zone SoilMVSALFEESGDIAPVDLGQFGKRAGAIIARATYPQRRRAH*
Ga0137359_1043595623300012923Vadose Zone SoilSDANPMVSALFEESGEIAAVDLGQFGKRAGEIIARATQLPRRRPH*
Ga0126375_1085902523300012948Tropical Forest SoilMMVSALFAESGEIAPVDLGRFGKRAGEIIARATQLPRRRPY*
Ga0126375_1131131523300012948Tropical Forest SoilMVSALFEESGQIAPVDLGQFGKRAGEIIARARHLPRRRPH*
Ga0126369_1059804923300012971Tropical Forest SoilLDRKLMVSALFEERGEIAGVDLGQFGKRAGEIIARGTHWSRRRPH*
Ga0164309_1008174613300012984SoilALFEQSGEIAPVDFRRFGMRAGEIIARGAQLPRRKSL*
Ga0164308_1207427113300012985SoilPQPVIAALFEQSGEIAPVDFRRFGMRAGEIIARGAQLPRRKPL*
Ga0182032_1161738013300016357SoilPKLIVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH
Ga0182040_1047968013300016387SoilRWSLSDPKLMVSALFEESGEIAPVDLGQFGKRAGEIIARATHLPRRRPH
Ga0066667_1035336423300018433Grasslands SoilMVSALFEESGEIPAVDLGLFGKRAGEIIARATRLPRRRPH
Ga0066662_1000540663300018468Grasslands SoilMVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH
Ga0066662_1007603833300018468Grasslands SoilMVSALFEESGEIAPVDLGQFGKRAGEIIARATYPQRRRAH
Ga0210399_1119914613300020581SoilKPMVSALFEESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH
Ga0213877_1002206223300021372Bulk SoilMVSALFAESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH
Ga0213879_1001722613300021439Bulk SoilMVSALFAESGEIAAVDLGQFGKRAGEIIARATRLP
Ga0207700_1073595923300025928Corn, Switchgrass And Miscanthus RhizosphereMVSALFEESGEIAAVDLGLFGKRAGEIIARATRLPRRRPH
Ga0209238_111802723300026301Grasslands SoilRDERSKSDPKHVISALFEESGEVAPVDFRRFGTRAGEIIARATRLPYRRAH
Ga0209153_125677413300026312SoilDRKHVITALFAQSGEIAPVDFRRFGTRAGEIIARAATLPRRKAL
Ga0209160_116551123300026532SoilALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH
Ga0209056_1025303713300026538SoilQWSSSDHKDAVTALFNESGEVAPVDFSQFGKRTGEIIARATRLPRRKPH
Ga0209003_100859023300027576Forest SoilQWSLSDAKPMVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH
Ga0209180_1007682933300027846Vadose Zone SoilMVSVLFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH
Ga0209465_1002134623300027874Tropical Forest SoilMVSALFEESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH
Ga0209283_1025709713300027875Vadose Zone SoilMVSALFEESGEIAAVDLGQFGKRAGDIIARATRLPRRRPH
Ga0209590_1004146123300027882Vadose Zone SoilMVSVLFEESGEIAAVDLGQFGKRAGEIIAHATRLPRRRPH
Ga0318516_1000512453300031543SoilMVSALFEESGEIAPVDLGQFGKRAGEIIARATHLPRRRPH
Ga0318516_1006932623300031543SoilMVSALFEESGEIAPVDLGQFGKRAGEIIACATRLPRRRPH
Ga0318516_1007368223300031543SoilMVSALFAESGEIAPVDLGQFGKRAGEIIARATRPPRRRPH
Ga0318516_1008539423300031543SoilMVSALFEESGEIAAVDFGQFGKRAGEIIARATQLPRRRPH
Ga0318516_1017044513300031543SoilMVSALFKESGEIAPVDLGQFGKRAGEIIARATHWSCRRPH
Ga0318516_1023429223300031543SoilMVSALFKESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH
Ga0318534_1018700623300031544SoilMVSALFAESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH
Ga0318534_1065361223300031544SoilALFEESGEIAPVDFGQFGKRAGEIIARATYLPRPRRRPH
Ga0318571_1003110123300031549SoilFKESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH
Ga0318528_1057500923300031561SoilRWSLSDPKLIVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH
Ga0318515_1004054423300031572SoilMVSALFEESGEIAPVDLGQFGKRAGEIIARATHPPRRRPH
Ga0318515_1075411123300031572SoilMVSALFAESGEIAPVDLGQFGKRAGEIIARATRPPRR
Ga0318574_1069409713300031680SoilLMVSALFAESGEIAPVDLGQFGKRAGEIIARATRPPRRRPH
Ga0318496_1002054523300031713SoilMVSALFAESGEIAPVDLGQFGNRAGEIIARATRPPRRRPH
Ga0318493_1005052313300031723SoilEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH
Ga0318493_1036393613300031723SoilDLWSLSDRKLMVSALFEESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH
Ga0318500_1054828123300031724SoilFEESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH
Ga0318501_1016781823300031736SoilMVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH
Ga0306918_1044120423300031744SoilERWSLSDPKLMVSALFEESGEIAPVDLGQFGKRAGEIIARATHLPRRRPH
Ga0318492_1043951023300031748SoilWSLSDAKPMVSALFEESGEIAAVDFGQFGKRAGEIIARATQLPRRRPH
Ga0318535_1040051623300031764SoilLMVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH
Ga0318526_1020910123300031769SoilLIVSALFEESGEIAPVDFGQFGKRAGEIIARATYLPRPRRRPH
Ga0318543_1007224313300031777SoilMVSALFEESGEIAPVDLGQYGKRAGEIIARGTHWSRRRPH
Ga0318529_1034659723300031792SoilVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH
Ga0318557_1017883113300031795SoilRWSLSDHKLMVSALFAESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH
Ga0318550_1002417813300031797SoilVSALFEENGEIAPVDLGQFGKRAGEIIAGATRLPRRRPH
Ga0307473_1097729423300031820Hardwood Forest SoilMVSALFEESGEIAAVDLGLFGKRAGEIIAHATRLPRRRPN
Ga0318499_1006661713300031832SoilMVSALFEESGEIAPVDLGQFGKRAGEIIARGSALT
Ga0318499_1030662423300031832SoilMVSALFEENGEIAPVDLGQFGKRAGEIIAGATRLPRRRPH
Ga0306919_1115731523300031879SoilFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH
Ga0306925_1070543613300031890SoilMVSALFEESGEIAPVDLGQFGKRAGEIIARGTHWSRRRP
Ga0318507_1024729023300032025SoilLFAESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH
Ga0318524_1046486923300032067SoilLSDHKLMVSALFKESGEIAPVDLGQFGKRAGEIIARATHWSCRGPH
Ga0307470_1019214423300032174Hardwood Forest SoilMVSALFEESGEIAAVDLGLFGKRAGEIIARATYLPRRRPH
Ga0310914_1027122313300033289SoilERWSLSDPKLMVSALFEESGEIAPVDLGQFGKRAGEIIARATHPPRRRPH
Ga0310914_1091305023300033289SoilKLMVSALFEESGEIAPVDLGQFGKRAGEIIACATRMPRRRPH
Ga0318519_1002597523300033290SoilMVSVLFEESGEIAPVDLGQFGKRAGEIIARATHPPRRRPH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.