NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069227

Metagenome / Metatranscriptome Family F069227

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069227
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 47 residues
Representative Sequence MGRPLGWSRRRRAAETRRYLDLVEAERTRPAMDSVPVPGLALAAAR
Number of Associated Samples 103
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.82 %
% of genes near scaffold ends (potentially truncated) 97.58 %
% of genes from short scaffolds (< 2000 bps) 95.97 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.774 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(37.097 % of family members)
Environment Ontology (ENVO) Unclassified
(35.484 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.742 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.59%    β-sheet: 0.00%    Coil/Unstructured: 55.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF00196GerE 15.32
PF00171Aldedh 11.29
PF11706zf-CGNR 6.45
PF00892EamA 6.45
PF13185GAF_2 5.65
PF13649Methyltransf_25 5.65
PF13546DDE_5 0.81
PF01391Collagen 0.81
PF13412HTH_24 0.81
PF13358DDE_3 0.81
PF00589Phage_integrase 0.81
PF01590GAF 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 11.29
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 11.29
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 11.29

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.77 %
UnclassifiedrootN/A28.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003505|JGIcombinedJ51221_10165069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia896Open in IMG/M
3300004152|Ga0062386_101279805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300005167|Ga0066672_10599199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia714Open in IMG/M
3300005337|Ga0070682_101772320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia538Open in IMG/M
3300005437|Ga0070710_11449759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300005610|Ga0070763_10349239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia823Open in IMG/M
3300005719|Ga0068861_100538933Not Available1061Open in IMG/M
3300006028|Ga0070717_11135284Not Available711Open in IMG/M
3300006162|Ga0075030_100893593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium701Open in IMG/M
3300006173|Ga0070716_101310459Not Available586Open in IMG/M
3300006174|Ga0075014_100291713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales857Open in IMG/M
3300006175|Ga0070712_100957939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia739Open in IMG/M
3300006175|Ga0070712_100984342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae729Open in IMG/M
3300006176|Ga0070765_100240082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1658Open in IMG/M
3300006797|Ga0066659_11746751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300006806|Ga0079220_11515819Not Available576Open in IMG/M
3300006854|Ga0075425_101814214Not Available684Open in IMG/M
3300009012|Ga0066710_100761980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1481Open in IMG/M
3300009137|Ga0066709_103492592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales570Open in IMG/M
3300009672|Ga0116215_1318126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium676Open in IMG/M
3300009672|Ga0116215_1344169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium647Open in IMG/M
3300010379|Ga0136449_104360325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium522Open in IMG/M
3300010379|Ga0136449_104597252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium506Open in IMG/M
3300010396|Ga0134126_12368355Not Available578Open in IMG/M
3300010398|Ga0126383_11069577All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300010861|Ga0126349_1268363Not Available522Open in IMG/M
3300011119|Ga0105246_10224684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cirratus1474Open in IMG/M
3300012206|Ga0137380_10035021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4633Open in IMG/M
3300012351|Ga0137386_10231806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1327Open in IMG/M
3300012362|Ga0137361_10226340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1698Open in IMG/M
3300012960|Ga0164301_10126682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cirratus1519Open in IMG/M
3300014325|Ga0163163_12496345Not Available575Open in IMG/M
3300015373|Ga0132257_103173797Not Available599Open in IMG/M
3300016341|Ga0182035_12134931All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300017942|Ga0187808_10046537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium1828Open in IMG/M
3300017959|Ga0187779_10091473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium1823Open in IMG/M
3300017959|Ga0187779_10798487Not Available644Open in IMG/M
3300017973|Ga0187780_10394894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium981Open in IMG/M
3300018062|Ga0187784_11156654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium614Open in IMG/M
3300018482|Ga0066669_10638067Not Available936Open in IMG/M
3300020582|Ga0210395_10137155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium1821Open in IMG/M
3300021401|Ga0210393_11599031Not Available517Open in IMG/M
3300021405|Ga0210387_10905537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium776Open in IMG/M
3300021432|Ga0210384_10527417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1062Open in IMG/M
3300021475|Ga0210392_10147783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cirratus1602Open in IMG/M
3300021478|Ga0210402_10797043Not Available870Open in IMG/M
3300021478|Ga0210402_10853605Not Available836Open in IMG/M
3300021478|Ga0210402_10896094Not Available813Open in IMG/M
3300021560|Ga0126371_10566858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1284Open in IMG/M
3300022467|Ga0224712_10193703Not Available921Open in IMG/M
3300024187|Ga0247672_1018007Not Available1124Open in IMG/M
3300024271|Ga0224564_1048770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium823Open in IMG/M
3300024288|Ga0179589_10241213All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300025898|Ga0207692_10676789Not Available668Open in IMG/M
3300025906|Ga0207699_10152553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cirratus1530Open in IMG/M
3300025915|Ga0207693_10106585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2199Open in IMG/M
3300025935|Ga0207709_10794130Not Available764Open in IMG/M
3300027076|Ga0208860_1029291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium577Open in IMG/M
3300027765|Ga0209073_10107227Not Available993Open in IMG/M
3300027783|Ga0209448_10106443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium939Open in IMG/M
3300027817|Ga0209112_10051335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cirratus1261Open in IMG/M
3300027905|Ga0209415_10707732Not Available720Open in IMG/M
3300028906|Ga0308309_10237486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium1519Open in IMG/M
3300030494|Ga0310037_10188232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium920Open in IMG/M
3300030706|Ga0310039_10368275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium533Open in IMG/M
3300031546|Ga0318538_10750605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300031679|Ga0318561_10336539All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300031708|Ga0310686_108157156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1395Open in IMG/M
3300031708|Ga0310686_114268161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium626Open in IMG/M
3300031713|Ga0318496_10270445All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300031715|Ga0307476_10212772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cirratus1406Open in IMG/M
3300031716|Ga0310813_12111262Not Available532Open in IMG/M
3300031723|Ga0318493_10451472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales707Open in IMG/M
3300031724|Ga0318500_10668799All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300031744|Ga0306918_11086260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium620Open in IMG/M
3300031744|Ga0306918_11429160Not Available530Open in IMG/M
3300031764|Ga0318535_10548893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300031765|Ga0318554_10117935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1497Open in IMG/M
3300031765|Ga0318554_10184165All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300031765|Ga0318554_10376386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300031770|Ga0318521_10487921All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300031778|Ga0318498_10063367All Organisms → cellular organisms → Bacteria1653Open in IMG/M
3300031778|Ga0318498_10073482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1538Open in IMG/M
3300031778|Ga0318498_10260950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales780Open in IMG/M
3300031781|Ga0318547_10934395Not Available541Open in IMG/M
3300031792|Ga0318529_10395642All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300031795|Ga0318557_10085502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1380Open in IMG/M
3300031797|Ga0318550_10196833All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300031799|Ga0318565_10497747All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031805|Ga0318497_10128570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1375Open in IMG/M
3300031805|Ga0318497_10142837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium1307Open in IMG/M
3300031805|Ga0318497_10441636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300031831|Ga0318564_10489744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales534Open in IMG/M
3300031835|Ga0318517_10171657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales973Open in IMG/M
3300031845|Ga0318511_10419501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria614Open in IMG/M
3300031845|Ga0318511_10494220Not Available566Open in IMG/M
3300031879|Ga0306919_10215135All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300031897|Ga0318520_10788663Not Available596Open in IMG/M
3300031912|Ga0306921_12598377Not Available523Open in IMG/M
3300031939|Ga0308174_11543629Not Available570Open in IMG/M
3300031942|Ga0310916_11425039Not Available567Open in IMG/M
3300031954|Ga0306926_11941122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae664Open in IMG/M
3300032009|Ga0318563_10361993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales785Open in IMG/M
3300032060|Ga0318505_10039766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1968Open in IMG/M
3300032060|Ga0318505_10144528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1100Open in IMG/M
3300032063|Ga0318504_10329619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales724Open in IMG/M
3300032064|Ga0318510_10337764All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300032068|Ga0318553_10304231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales834Open in IMG/M
3300032068|Ga0318553_10529948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia617Open in IMG/M
3300032076|Ga0306924_11778737Not Available643Open in IMG/M
3300032089|Ga0318525_10224402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales966Open in IMG/M
3300032089|Ga0318525_10552572Not Available588Open in IMG/M
3300032160|Ga0311301_10344328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2338Open in IMG/M
3300032160|Ga0311301_12097432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium654Open in IMG/M
3300032205|Ga0307472_100144254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cirratus1727Open in IMG/M
3300032770|Ga0335085_11816511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium624Open in IMG/M
3300032898|Ga0335072_10800327Not Available901Open in IMG/M
3300032954|Ga0335083_10846903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia730Open in IMG/M
3300033134|Ga0335073_10348150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cirratus1756Open in IMG/M
3300033134|Ga0335073_10405053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1593Open in IMG/M
3300033290|Ga0318519_10296666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Ea1.12945Open in IMG/M
3300034817|Ga0373948_0139942Not Available598Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil37.10%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.06%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.03%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.23%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.81%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027076Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ51221_1016506913300003505Forest SoilRLLGWSRRRRAAETRRYLDLVEAEQTVISMNPDRVPDRALAAVR*
Ga0062386_10127980523300004152Bog Forest SoilRLLGWSRRRRAAETRRYLDLVEAEQTMMAIDPGPAPDSAPDRALAAVR*
Ga0066672_1059919913300005167SoilAIMGRLLGWSRRRRAAETRRYLDLVQAERALPAMDAIPAPGLALAAAR*
Ga0070682_10177232013300005337Corn RhizosphereSGVSAAADVAAIMGRLLGWSRRRRGAETRRYLDLVEAECARPAMSSTPAPGLALAVAR*
Ga0070710_1144975923300005437Corn, Switchgrass And Miscanthus RhizosphereSAAADVAAIMGRLLGWSRRRRGAETRRYLDLVEAECARPAMSSTPAPGLALAVAR*
Ga0070763_1034923923300005610SoilTIMGRLLGWSRRKRAAETRRYLDLVAAEQTVTALGPDSVPGPMLARATAG*
Ga0068861_10053893333300005719Switchgrass RhizosphereRRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR*
Ga0070717_1113528423300006028Corn, Switchgrass And Miscanthus RhizosphereVAAIMGRLLGWSRRRRGAETRRYLDLVEAERARPAMDSALVPSLALAAAR*
Ga0075030_10089359323300006162WatershedsRRRAAETRRYLDLIEAEQTVIAMDPGPLPDQALAAVR*
Ga0070716_10131045913300006173Corn, Switchgrass And Miscanthus RhizosphereRAAETRRYLELVSAEHAVPSMDSDSAPSLALAAAR*
Ga0075014_10029171313300006174WatershedsAETRRYLDLIEAEQTMIAMDPGPAPDSAHDRALAAVR*
Ga0070712_10095793913300006175Corn, Switchgrass And Miscanthus RhizosphereLMGRPLGWSRRRRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR*
Ga0070712_10098434213300006175Corn, Switchgrass And Miscanthus RhizosphereAAADVAAIMGRLLGWSRRRRGAETRRYLDLVEAERTRPAMHSALAPGLALVAAR*
Ga0070765_10024008213300006176SoilEVSATMGRLLGWSRRRRAAETRRYLDLVDAQQTVIAMDPGLVPDRALAAVR*
Ga0066659_1174675113300006797SoilAAAEVSATMGRLLGWSRRRRAAETRRYLDLVDAEQTVIAMDPGAVPDRALAAVR*
Ga0079220_1151581913300006806Agricultural SoilWSRRRRAAETRRYLVPVQVERAGRATDSVPAPLPALAG*
Ga0075425_10181421413300006854Populus RhizosphereRRRAAETRRYLDLVEAERTRPAMDSVPVPGLALAAAR*
Ga0075434_10234562013300006871Populus RhizosphereRRRRAAETRRYLDLVESEQAVIGMDTGQVPEVALAASAR*
Ga0066710_10076198033300009012Grasslands SoilRLFLEPADSGAGVAAEVAALMGRLLGWSRRRRTAETRRYLDLVVGERARPVMDSVPALGLALAAAR
Ga0066709_10349259233300009137Grasslands SoilGRLLGWSRRCRAAETRRYLDLVRAGQPVLAIDPGPVHDRALAG*
Ga0116215_131812613300009672Peatlands SoilEVSAIMGRLLGWSRRRRAAETRRYLDLIEAEQTVIAMDPGPPPDSASDRALAAVR*
Ga0116215_134416913300009672Peatlands SoilEVSAIMGRLLGWSRRRRAAETRRYLDLIEAEQTVIAMDPGPVPDRALAAVR*
Ga0136449_10436032523300010379Peatlands SoilIMGRLLGWSRRRRAAETRRYLDLIEAEQTVIAMDPGPPPDSASDRALAAVR*
Ga0136449_10457558713300010379Peatlands SoilRKRATETRRYLDLVESEQAVIGMDTGQVPEVALTASAR*
Ga0136449_10459725223300010379Peatlands SoilGRLLGWSRRRRAAETRRYLDLIEAEQTMIAMDPGPAPDSAHYRALAAVR*
Ga0134126_1236835513300010396Terrestrial SoilLGWSRRRRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR*
Ga0126383_1106957713300010398Tropical Forest SoilWSRRRRGAETARYLDLIAAEQTVIAIDPGPVSGRALAG*
Ga0126349_126836313300010861Boreal Forest SoilLGWSRRRRATETRRYLDLVAAERTLPAVDTVPAPGLALAAAR*
Ga0105246_1022468433300011119Miscanthus RhizosphereGRPLGWSRRRRAAETRRYLDLVEAERTRPAMDSVPVPGLALAAAR*
Ga0137380_1003502143300012206Vadose Zone SoilLGWSRRRRAAETRRYLDLVDAEQTVIAMDPGAVPDRALAAVR*
Ga0137386_1023180623300012351Vadose Zone SoilADAGAGAAADVSLIMGRLLGWSRRRRAAETRRYLGLVQAEQPVVTMDPGPAPARALAAAR
Ga0137361_1022634023300012362Vadose Zone SoilSATMGRLLGWSRRRRAAETRRYLDLVDAEQTVIAMDPGAVPDRALAAVR*
Ga0164301_1012668233300012960SoilVVVGPLLGWSRRRRATETRRYLDLVEAERTRPAVESVPAPGLALAAAR*
Ga0163163_1249634513300014325Switchgrass RhizosphereWSRRRRAAETRRYLDLVEAERTLPAVDSVPVSGLALAAAR*
Ga0132257_10317379723300015373Arabidopsis RhizosphereRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR*
Ga0182035_1213493123300016341SoilLLGWSRRRRAAETRRYLDLVRAGQPVFAVDPGPAPDRALAG
Ga0187808_1004653743300017942Freshwater SedimentGRLLGWSRRKRAAETRRYLDLVAAEQTTAAVGSAAVPGPVLASATAG
Ga0187779_1009147343300017959Tropical PeatlandIMGRLLGWSRRRRAAETRRYLDLVAAEQAVTDIGSGSVHAAALAGASAG
Ga0187779_1079848713300017959Tropical PeatlandGRLLGWNRRKRAAETRRYLDLVAAEPTVPAIGPGSARDAALAGATAG
Ga0187780_1039489423300017973Tropical PeatlandRRTRLFIESADGGAGVAAEVSAIMGRLLGWSRRRRAVETHRYLDLVQAEQPVLAGNPGTVPDQALATAG
Ga0187784_1115665423300018062Tropical PeatlandTGAAAEVSSIMGRLLGWSRRRRAAETRRYLELVAAEQTVTNIASGPVREADLAG
Ga0066669_1063806733300018482Grasslands SoilWSRRRRAAETRRYLDLVVAERPRPEVDSVPAPGLALAAAR
Ga0210395_1013715543300020582SoilAVEVSAIMGRLLGWSRRRRAAETRRYLDLVEAEQTLTATDSDPVPDRALAAAR
Ga0210393_1159903113300021401SoilSRRRRGAETRRYLDLVEAERARPAMDSALAPGLALVAAR
Ga0210387_1090553713300021405SoilRAAETRRYLDLVEAEQTLTATDSDPVPDRALAAAR
Ga0210384_1052741713300021432SoilLLGWSRRRRGAETRRYLDLVEAERARPAMDSALVPSLALAAAR
Ga0210392_1014778313300021475SoilGAAVAADVAALMGRPLGWSRRRRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR
Ga0210402_1079704313300021478SoilQLLGWSRRRRAAETRRYLDPVQVERAGRATDSVPAPLRALAG
Ga0210402_1085360513300021478SoilADGGAAAAAEVAALMGRPLGWSRRRRAAETRRYLDLVAAERTLPAMDTVPAPGLALAAAR
Ga0210402_1089609413300021478SoilGRLLGWNRRRRAAETRRYLDLVEAERVMPAVDSVPAPGLALAAAR
Ga0126371_1056685813300021560Tropical Forest SoilRRRAAETRRYLDLVRTAQPMFAIDPGPVANQDLAG
Ga0224712_1019370323300022467Corn, Switchgrass And Miscanthus RhizosphereAALMGRPLGWSRRRRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR
Ga0247672_101800733300024187SoilEVAVLMGRPLGWSRRRRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR
Ga0224564_104877013300024271SoilAIMGRLLGWSRRRRAAETRRYLDLVEAEHTVTATDSDPVPDRALAAAR
Ga0179589_1024121323300024288Vadose Zone SoilAVAAAEVSAIMGRMLGWSRRRRAAETRRYLDLVRAGQPVLAIDPGPVPDRVLAG
Ga0207692_1067678913300025898Corn, Switchgrass And Miscanthus RhizosphereRPLGWSRRRRAAETRRYLDLVEAERPRPAVDSVPAPGLALVAAR
Ga0207699_1015255313300025906Corn, Switchgrass And Miscanthus RhizosphereAAEVAVLMGRPLGWSRRRRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR
Ga0207693_1010658543300025915Corn, Switchgrass And Miscanthus RhizosphereAADVAAIMGRLLGWSRRRRGAETRRYLDLVEAECARPAMSSTPAPGLALAVAR
Ga0207709_1079413013300025935Miscanthus RhizosphereMGRPLGWSRRRRAAETRRYLDLVEAERTRPAMDSVPVPGLALAAAR
Ga0208860_102929123300027076Forest SoilRRAAETRRYLDLVEAEQTVISMNPDRVPDRALAAVR
Ga0209073_1010722733300027765Agricultural SoilLMGRPLGWSRRRRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR
Ga0209448_1010644333300027783Bog Forest SoilAIMGRLLGWSRRRRAAETRRYLDLIEAEQTMIAMDPGPAPDSAHDRALAAVR
Ga0209112_1005133513300027817Forest SoilRRRRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR
Ga0209415_1070773213300027905Peatlands SoilGAAAAAEVAVIMGRLLGWSRRRRAAETRRYLDLVVAEQAMLADSAAVGAAAV
Ga0308309_1023748613300028906SoilAGSGAAPEVSATMGRLLGWSRRRRAAETRRYLDLVDAQQTVIAMDPGLVPDRALAAVR
Ga0310037_1018823223300030494Peatlands SoilLLGWSRRRRAAETRRYLDLIEAEQTMIAMDPGPAPDSAHHPALAAVR
Ga0310039_1036827513300030706Peatlands SoilRRAAETRRYLDLVEAEQTVIAMDPGAMPDRALAAAR
Ga0318538_1075060523300031546SoilIMGRLLGWNRRRRAAEIRRYLDLVEAEQTMPAIKSASMPDGALAVATPA
Ga0318561_1033653913300031679SoilGRLLGWSRRRRAAETRRYLDLVRAGQPVPAIDPGPAPDRALAG
Ga0310686_10815715623300031708SoilVSAIMGRLLGWNRRKRATETRRYLDLVESEQAVIGMDTGQVPEVALTASAR
Ga0310686_11426816113300031708SoilAGEVSAIMGRLLGWSRRRRAAETRRYLDLVEAEQTVTAMDPGPAPDRALAAVR
Ga0318496_1027044513300031713SoilASAAADVAAIMGRLLGWSRRRRVAETARYLDLIAAGQTVIAIDPGSVSGRALAG
Ga0307476_1021277233300031715Hardwood Forest SoilIIGRLLGWSRRRRGAETRRYLDLVEAERARPAMDSALAPGLALVAAR
Ga0310813_1211126223300031716SoilMGRLLGWSRRRRGAETRRYLDLVEAERARPAMSSTPAPGLALAVAR
Ga0318493_1045147213300031723SoilWSRRRRAAETRRYLDLVRAGQPVLATEPGAVPGRALAAAG
Ga0318500_1066879923300031724SoilGTATAAEVSAIMGRLLGWSRRRRAAETRRYLDLVRAGQTVPAIDPGPVSDRALAG
Ga0306918_1108626013300031744SoilRRRRAAEIRRYLELVAAEQTVTDIGSGSAYAAALAGASAG
Ga0306918_1142916023300031744SoilRRAAETRRYLDLVRAGQPVLATEPGAVPGRALAAAG
Ga0318535_1054889313300031764SoilAAAAAEVSAIMGRLLGWSRRRRAAETRRYLDLVRAGRPVLAIEPGAVPGRALAAAG
Ga0318554_1011793533300031765SoilGRLLGWSRRRRAAETRRYLDLVEAERPARAVDSAPAPGLALAVAR
Ga0318554_1018416523300031765SoilIESADAGASAAADVAAIMGRLLGWSRRRRVAETARYLDLIAAGQTVIAIDPGSVSGRALA
Ga0318554_1037638613300031765SoilIMGRLLGWSRRRRPAETRRYLDLVEAEQTVIAIDPGPAPDRALATAR
Ga0318521_1048792113300031770SoilADAGASAAADVAAIMGRLLGWSRRRRVAETARYLDLIAAGQTVIAIDPGSVSGRALAG
Ga0318498_1006336713300031778SoilAGAAPAVSAIMGQLLGWSRRRRAAETRRYLDLVRAGQPVFAVDPGPAPDRALAG
Ga0318498_1007348213300031778SoilFIESADSGARAAAEVRTIMGRLLGWSRRRRPAETRRYLDLVEAEQTVIAIDPGPAPDRALATAR
Ga0318498_1026095023300031778SoilGWSRRRRAAETRRYLDLVRAGRPVLAMEPGPVPGRALAAAG
Ga0318547_1093439513300031781SoilRLLGWSRRRRAAETRRYLDLVQAEQPMLAIDPGPVPDRALAG
Ga0318529_1039564223300031792SoilSRRRRAAETRRYLDLVRAGQPVPAIDPGPAPDRALAG
Ga0318557_1008550233300031795SoilSRRRRAAETRRYLDLVEAERPARAVDSAPAPGLALAVAR
Ga0318550_1019683323300031797SoilWSRRRRAAETRRYLDLVRAGQPVPAIDPGPAPDRALAG
Ga0318565_1049774713300031799SoilIMGRLLGWSRRRRVAETARYLDLIAAGQTVIAIDPGSVSGRALAG
Ga0318497_1012857033300031805SoilRAAETRRYLDLVEAERPARAVDSAPAPGLALAVAR
Ga0318497_1014283733300031805SoilIMGRLLGWSRRRRAAEIRRYLDLVEAEQAMPAMDPGPAPEAALAVAR
Ga0318497_1044163613300031805SoilLGWSRRRRAAETRRYLDLVRAGRPVLAMEPGPVPGRALAAAG
Ga0318564_1048974423300031831SoilVAADVAAIMGRLLGWSRRRRAAETRRYLDLVQAEQPMLAIDPGPVPDRALAG
Ga0318517_1017165723300031835SoilADVAAIMGRLLGWNRRRRAAETRRYLDLVRAEQLVLAIDPGPLPDRALAG
Ga0318511_1041950113300031845SoilVSTIMGRLLGWSRRRRPAETRRYLDLVEAEQTVIAIDPGPAPDRALATAR
Ga0318511_1049422013300031845SoilAAAKVSAIMGRLLGWSRRRRAAETGRYLDLVRAGRPVLAIEPGAVPGRALAAAG
Ga0306919_1021513523300031879SoilAADVAAIMGRLLGWSRRRRAAETRRYLDLIAAEQTVIAIDPGSVSGRALAG
Ga0318520_1078866313300031897SoilSRRRRAAETRRYLDLVRAGRPVLAMEPGPVPGRALAAAG
Ga0306921_1259837723300031912SoilRRAAETRRYLDLVQAERATPAVKSVPVPDLALAAAR
Ga0308174_1154362923300031939SoilAEVAALMGRPLGWSRRRRAAETRRYLDLVVAERPRPEVDSVPAPGLALAAAR
Ga0310916_1142503913300031942SoilWSRRRRAAETRRYLDLVRAGRPVLAMEPGPVPGRALAAAG
Ga0306926_1194112223300031954SoilAVIMGRLLGWNRRRRAAEIRRYLDLVEAEQTMPAIKSASMPDGALAVATPA
Ga0318563_1036199313300032009SoilSRRRRAAETRRYLDLVQAEQPMLAIDPGPVPDRALAG
Ga0318505_1003976613300032060SoilAAIMGRLLGWNRRRRAAETRRYLDLVRAEQLVLAIDPGPLPDRALAG
Ga0318505_1014452833300032060SoilRAAAEVSTIMGRLLGWSRRRRPAETRRYLDLVEAEQTVIAIDPGPAPDRALATAR
Ga0318504_1032961923300032063SoilVSAIMGRLLGWSRRRRAAETRRYLDLVRAGRPVLAMEPGPVPGRALAAAG
Ga0318510_1033776413300032064SoilEVSAIMGRLLGWSRRRRAAETRRYLDLVRAGQTVPAIDPGPVSDRALAG
Ga0318553_1030423123300032068SoilDVAAIMGRLLGWNRRRRAAETRRYLDLVRAEQLVLAIDPGPLPDRALAG
Ga0318553_1052994813300032068SoilVAVIMGRLLGWNRRRRAAEIRRYLDLVEAEQTMPAIKSASMPDGALAVATPA
Ga0306924_1177873713300032076SoilRAAETRRYLDLVRAGRPVLAMEPGPVPGRALAAAG
Ga0318525_1022440213300032089SoilGRLLGWSRRRRAAETRRYLDLVRAGRPVLAMEPGPVPGRALAAAG
Ga0318525_1055257223300032089SoilGWSRRRRAAETRRYLDLVQAEQPMLAIDPGPVPDRALAG
Ga0311301_1034432843300032160Peatlands SoilSAIMGRLLGWSRRRRAAETRRYLDLVEAEQTVIAMDPGPVPERALAAVR
Ga0311301_1209743213300032160Peatlands SoilAEVSAIMGRLLGWSRRRRAAETRRYLDLIEAEQTVIAMDPGPVPDRALAAVR
Ga0307472_10014425433300032205Hardwood Forest SoilALMGRPLGWSRRRRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR
Ga0335085_1181651113300032770SoilGRLLGWSRRRRAAEIRRYLDLVEAEQTVLAADSGPVPEAALAVAR
Ga0335072_1080032733300032898SoilRRRAAESRRYLDLVEAERTLPAVDSVPAPGLALAAAR
Ga0335083_1084690313300032954SoilSRRRRAAETRRYLDLVQAGQPVLAIDPGPVSDRALAG
Ga0335073_1034815033300033134SoilDVAALMGRPLGWSRRRRAAETRRYLDLVEAERTLPAVDSVPAPGLALAAAR
Ga0335073_1040505333300033134SoilRLLGWNRRRRAAETRRYLDLVQAERATLAVNSVPVPGLALAAAR
Ga0318519_1029666613300033290SoilVGAAAAEVSAIMGRLLGWSRRRRAAETRRYLELVRAEQLVLAIDPGPLPDRALAG
Ga0373948_0139942_2_1663300034817Rhizosphere SoilVAADVAALMARPLGWSRRRRAAETRRYLDLVEAERTRPAVDSVPAPGLALAAAR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.