Basic Information | |
---|---|
Family ID | F069136 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 39 residues |
Representative Sequence | SVAMFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.03 % |
% of genes near scaffold ends (potentially truncated) | 91.94 % |
% of genes from short scaffolds (< 2000 bps) | 95.97 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.742 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.613 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.871 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.839 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF00528 | BPD_transp_1 | 16.94 |
PF13416 | SBP_bac_8 | 10.48 |
PF01547 | SBP_bac_1 | 2.42 |
PF01738 | DLH | 1.61 |
PF00078 | RVT_1 | 0.81 |
PF13610 | DDE_Tnp_IS240 | 0.81 |
PF01636 | APH | 0.81 |
PF01609 | DDE_Tnp_1 | 0.81 |
PF13714 | PEP_mutase | 0.81 |
PF01135 | PCMT | 0.81 |
PF01381 | HTH_3 | 0.81 |
PF04279 | IspA | 0.81 |
PF12760 | Zn_Tnp_IS1595 | 0.81 |
PF02738 | MoCoBD_1 | 0.81 |
PF12697 | Abhydrolase_6 | 0.81 |
PF01728 | FtsJ | 0.81 |
PF01545 | Cation_efflux | 0.81 |
PF00216 | Bac_DNA_binding | 0.81 |
PF10518 | TAT_signal | 0.81 |
PF16317 | Glyco_hydro_99 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.81 |
COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.81 |
COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.81 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.81 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG2917 | Intracellular septation protein A | Cell cycle control, cell division, chromosome partitioning [D] | 0.81 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.81 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.81 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.81 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.81 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.74 % |
Unclassified | root | N/A | 7.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004091|Ga0062387_101117301 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300004633|Ga0066395_10324039 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300005332|Ga0066388_102716292 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300005555|Ga0066692_10158515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1394 | Open in IMG/M |
3300005559|Ga0066700_10166482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1504 | Open in IMG/M |
3300005561|Ga0066699_10886442 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005575|Ga0066702_10657878 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300005764|Ga0066903_102827878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 941 | Open in IMG/M |
3300005921|Ga0070766_11033548 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300006028|Ga0070717_10659973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 949 | Open in IMG/M |
3300006175|Ga0070712_101126194 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300006846|Ga0075430_101592660 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300009038|Ga0099829_11494585 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300009090|Ga0099827_10110188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2202 | Open in IMG/M |
3300009143|Ga0099792_10378246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 861 | Open in IMG/M |
3300009143|Ga0099792_10601597 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300010046|Ga0126384_11839142 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300010047|Ga0126382_11003846 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300010048|Ga0126373_11510415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 737 | Open in IMG/M |
3300010125|Ga0127443_1098444 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300010140|Ga0127456_1022078 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300010358|Ga0126370_10485149 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300010358|Ga0126370_11602396 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300010359|Ga0126376_12957519 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300010361|Ga0126378_10400247 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
3300010361|Ga0126378_12604883 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300010366|Ga0126379_10907676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 983 | Open in IMG/M |
3300010376|Ga0126381_102088523 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300010376|Ga0126381_102249617 | Not Available | 784 | Open in IMG/M |
3300010376|Ga0126381_103639610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
3300010376|Ga0126381_104406832 | Not Available | 544 | Open in IMG/M |
3300010376|Ga0126381_104512829 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300010376|Ga0126381_105140961 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300010398|Ga0126383_10079519 | All Organisms → cellular organisms → Bacteria | 2857 | Open in IMG/M |
3300012096|Ga0137389_11460239 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300012189|Ga0137388_11815811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
3300012199|Ga0137383_10330701 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300012212|Ga0150985_121017200 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300012361|Ga0137360_10483854 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300012362|Ga0137361_10750598 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300012362|Ga0137361_11090469 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300012400|Ga0134048_1303510 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300012410|Ga0134060_1474757 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300012582|Ga0137358_10891597 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300012582|Ga0137358_11045342 | Not Available | 525 | Open in IMG/M |
3300012961|Ga0164302_11634161 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300012971|Ga0126369_10213249 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
3300012971|Ga0126369_10664453 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300012971|Ga0126369_11649700 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300012971|Ga0126369_12142193 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300012989|Ga0164305_11022019 | Not Available | 704 | Open in IMG/M |
3300015374|Ga0132255_102580346 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300016270|Ga0182036_10988885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
3300016270|Ga0182036_11783625 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300016294|Ga0182041_11519154 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300016319|Ga0182033_10606985 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300016341|Ga0182035_11624037 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300016371|Ga0182034_10159851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1703 | Open in IMG/M |
3300016371|Ga0182034_10993079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
3300016371|Ga0182034_11380668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
3300016422|Ga0182039_10831555 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300016445|Ga0182038_10067487 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
3300017942|Ga0187808_10123977 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300017974|Ga0187777_11477341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
3300021406|Ga0210386_10467257 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300021444|Ga0213878_10182859 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300021479|Ga0210410_11783045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
3300021560|Ga0126371_11036442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
3300022511|Ga0242651_1053872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
3300022531|Ga0242660_1040007 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300022532|Ga0242655_10127552 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300022533|Ga0242662_10038511 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
3300025906|Ga0207699_11273736 | Not Available | 544 | Open in IMG/M |
3300026317|Ga0209154_1044685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1990 | Open in IMG/M |
3300026507|Ga0257165_1102445 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300026547|Ga0209156_10021710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 3828 | Open in IMG/M |
3300027047|Ga0208730_1034454 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300027655|Ga0209388_1111381 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300027817|Ga0209112_10072670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1079 | Open in IMG/M |
3300027911|Ga0209698_10969926 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300029636|Ga0222749_10288104 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300029701|Ga0222748_1088342 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300031057|Ga0170834_107946555 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300031094|Ga0308199_1126158 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300031421|Ga0308194_10063988 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300031545|Ga0318541_10712571 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300031546|Ga0318538_10681320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
3300031572|Ga0318515_10567140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
3300031680|Ga0318574_10056478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2080 | Open in IMG/M |
3300031713|Ga0318496_10296104 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300031719|Ga0306917_11170313 | Not Available | 597 | Open in IMG/M |
3300031720|Ga0307469_10804366 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300031736|Ga0318501_10344561 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300031736|Ga0318501_10435445 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300031753|Ga0307477_10853576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
3300031771|Ga0318546_11003404 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300031781|Ga0318547_10674475 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300031793|Ga0318548_10532691 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300031798|Ga0318523_10464173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
3300031846|Ga0318512_10394313 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300031890|Ga0306925_11875373 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300031941|Ga0310912_11015207 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300031942|Ga0310916_10209067 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
3300031942|Ga0310916_11589511 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300031945|Ga0310913_10479282 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300031947|Ga0310909_10740104 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300031947|Ga0310909_10950901 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300031947|Ga0310909_11430152 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300031954|Ga0306926_10421302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1646 | Open in IMG/M |
3300031954|Ga0306926_12052878 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300031962|Ga0307479_11404507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 657 | Open in IMG/M |
3300031981|Ga0318531_10275699 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300032001|Ga0306922_10802898 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300032054|Ga0318570_10178174 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300032067|Ga0318524_10436177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
3300032068|Ga0318553_10439272 | Not Available | 683 | Open in IMG/M |
3300032076|Ga0306924_11974514 | Not Available | 602 | Open in IMG/M |
3300032174|Ga0307470_11111139 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300032180|Ga0307471_100843566 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300032205|Ga0307472_100447199 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300032261|Ga0306920_102635680 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300032261|Ga0306920_102700825 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300033134|Ga0335073_11249287 | Not Available | 740 | Open in IMG/M |
3300033289|Ga0310914_11642231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.52% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.84% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.23% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.42% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.61% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.81% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010125 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062387_1011173011 | 3300004091 | Bog Forest Soil | AEHVFSIAMLDVMNNGMAPEQAVDKAFKRAEAIFVKYPITQA* |
Ga0066395_103240391 | 3300004633 | Tropical Forest Soil | IFSVAEFDVINSGMAPEQAIDKAFERAEAIFAKYPITQS* |
Ga0066388_1027162922 | 3300005332 | Tropical Forest Soil | VFSVAEFDVLKNGMAPEAAIDKAFKRAEEIFSKYPIQQA* |
Ga0066692_101585153 | 3300005555 | Soil | AMFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA* |
Ga0066700_101664821 | 3300005559 | Soil | EFDVMNDGMTPEKAIDKALKRAEEIFAKYPIQNA* |
Ga0066699_108864421 | 3300005561 | Soil | MFDVMNNGMAPEQAIDKAFKRAEAIFAKYPVEQA* |
Ga0066702_106578782 | 3300005575 | Soil | FSVAMFDAMNNGMSPEQAIDKAFKRAEEIFAKYPIQQA* |
Ga0066903_1028278782 | 3300005764 | Tropical Forest Soil | VFSVAEFDVLKNGMAPEAAIDKAFKRAEEIFVKYPITQA* |
Ga0070766_110335482 | 3300005921 | Soil | MSAAFSVMNSGAAPEQEIDKAFSRIEEIFAKYPIASS* |
Ga0070717_106599732 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EFDVINSGMAPEQAIDKAFKRAEAIFAKYPIEQA* |
Ga0070712_1011261941 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EFDVMNGGMAPEAAIDKAFKRVEEIVAKYPITQA* |
Ga0075430_1015926601 | 3300006846 | Populus Rhizosphere | NPAISEVDNEHVWSVAMFDVINNGMPPAQAIDKAFKRVEALFAKYQIAQG* |
Ga0099829_114945852 | 3300009038 | Vadose Zone Soil | VAEFDVMNDGMAPEKAIDKALKRAEEIFAKYPHQQA* |
Ga0099827_101101881 | 3300009090 | Vadose Zone Soil | NPAISEVDNEHVWSVAMFDVINNGMTPAQAIDKAFKRVEALFAKYQIAQG* |
Ga0099792_103782462 | 3300009143 | Vadose Zone Soil | DSEHVFSIAMLDVMNNGMILEQAVGKAFKRAEEIFAKYPITEA* |
Ga0099792_106015971 | 3300009143 | Vadose Zone Soil | NGEHLFSVAMFDVMNDGMAPEKAVDKVFKRAEEIFLKYPIVAS* |
Ga0126384_118391422 | 3300010046 | Tropical Forest Soil | AIAEVDAEHVWSVAMFDVINNGMTPAQAIDKAFKRVEALFAKYQIAQG* |
Ga0126382_110038462 | 3300010047 | Tropical Forest Soil | IDAEHVWSVAMFDVINNGMAPAQAIDKAFKRAETIFAKYQIV* |
Ga0126373_115104151 | 3300010048 | Tropical Forest Soil | MSDVINNGMTPEATIDKAFKRGEAIFAKYPIEQA* |
Ga0127443_10984441 | 3300010125 | Grasslands Soil | EHVWSVAMFDVINNGMAPAQAIDKAFKRVEALFAKYQIAQG* |
Ga0127456_10220782 | 3300010140 | Grasslands Soil | DAEHVWSVAMFDVINNGMTPAQAIDKAFKRVETLFAKYQIAQG* |
Ga0126370_104851491 | 3300010358 | Tropical Forest Soil | EFDVLKNEMAPEAAIDKAFKRADEIFARYPIAQS* |
Ga0126370_116023962 | 3300010358 | Tropical Forest Soil | VFDFLNNGMAPEPAIDKAFKRAEEIFAKYPIQQA* |
Ga0126376_129575192 | 3300010359 | Tropical Forest Soil | AMFDVMKEGMAPEQAIDKAFKRAEEIFAKYPIQQA* |
Ga0126378_104002471 | 3300010361 | Tropical Forest Soil | EVNTEHVFSIAMLDVMNNGMAPEQAIDKAFKRAEEIFVKYPITQA* |
Ga0126378_126048831 | 3300010361 | Tropical Forest Soil | VNAEHVFMVAEFDVMNGGMAPEAAIDKAFKRVEEIVAKYPITQA* |
Ga0126379_109076763 | 3300010366 | Tropical Forest Soil | WSVAMFDVLNNGLQPAQAIEKAFKRVEALFAKYQIAQG* |
Ga0126381_1020885232 | 3300010376 | Tropical Forest Soil | SVAMFDVINNGMAPAQAIDKAFKRVEALFAKYQVA* |
Ga0126381_1022496172 | 3300010376 | Tropical Forest Soil | SVAEFDVINSGMAPEQAIDKAFKRAEAIFAKYPIA* |
Ga0126381_1036396102 | 3300010376 | Tropical Forest Soil | AEFDVLKNGMAPEAAIDKAFGRADEIFTKYPITQA* |
Ga0126381_1044068321 | 3300010376 | Tropical Forest Soil | LAINDAMNNGMTPQAAIDKAFRRCEAIFAKYPIVQA* |
Ga0126381_1045128292 | 3300010376 | Tropical Forest Soil | AMFDVMKEGMAPEQAVDKAFKRAEEIFAKYPIVAS* |
Ga0126381_1051409611 | 3300010376 | Tropical Forest Soil | VAMLDVMNSGMTPEQAIERAFKRAEAIFAKYPIQEA* |
Ga0126383_100795195 | 3300010398 | Tropical Forest Soil | WSVAMFDVINNGMTPAQAIDKAFKRVETLFAKYPVAQG* |
Ga0137389_114602392 | 3300012096 | Vadose Zone Soil | AMFDVMNNGMAPEQAIDKAFTRAEAIFAKYPIISS* |
Ga0137388_118158112 | 3300012189 | Vadose Zone Soil | FSVAMFDVMKEKMKPEAAIDKAFKRCEEIFAKYPIQNA* |
Ga0137383_103307011 | 3300012199 | Vadose Zone Soil | DNEHVWSVAMFDVINNGMAPAQAIDKAFKRVEALFAKYQIAQG* |
Ga0150985_1210172001 | 3300012212 | Avena Fatua Rhizosphere | MFDVMNNGMASEQAVDKAFKRAEEIFAKYPIQQA* |
Ga0137360_104838542 | 3300012361 | Vadose Zone Soil | AEHVWSVAMFDVINNGMAPAAAIDKAFKRAETIFAKYQVV* |
Ga0137361_107505983 | 3300012362 | Vadose Zone Soil | VAEFDVINNGMAPQTAIDKAFKRVEEIFAKYPIAQG* |
Ga0137361_110904692 | 3300012362 | Vadose Zone Soil | EIDAEHVWSVAMFDVINNGMAPAAAIDKAFKRAETIFAKYQVV* |
Ga0134048_13035101 | 3300012400 | Grasslands Soil | EHVWSVAMFDVINNGMKPAQAIDKAFKRVEALFAKYQIAQG* |
Ga0134060_14747571 | 3300012410 | Grasslands Soil | ISEVDAEHVWSVAMFDVMNNGMKPAQAIDKAFKRVEALFAKYQIAQG* |
Ga0137358_108915972 | 3300012582 | Vadose Zone Soil | MFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA* |
Ga0137358_110453421 | 3300012582 | Vadose Zone Soil | VAEFDVINSGMAPEQAIDKAFKRAEAIFAKYPIEQA* |
Ga0164302_116341611 | 3300012961 | Soil | AIFDYLNNGIAPEPAIDKAFKRAEEIFAKYPIQQA* |
Ga0126369_102132491 | 3300012971 | Tropical Forest Soil | VAEFDVLKNGMAPEAAIDKAFKRAEEIFSKYPIQQA* |
Ga0126369_106644531 | 3300012971 | Tropical Forest Soil | EVDAAHVWSVAMFDVINNGMSPAQAIDKAFKRVETLFAKYQVA* |
Ga0126369_116497002 | 3300012971 | Tropical Forest Soil | AIAEVNGEHLFSVAMFDAMNNGMTPAQAIDKAFKRAEEIFGKYPIQQA* |
Ga0126369_121421932 | 3300012971 | Tropical Forest Soil | VFMVAEFDVMKEGMAPEKAIDKAFRRVEEIFAKYPISQA* |
Ga0164305_110220191 | 3300012989 | Soil | SVAEFDVINSGVAPEQAIDKAFKRAEAIFAKYPIEQA* |
Ga0132255_1025803462 | 3300015374 | Arabidopsis Rhizosphere | AWFAITRDGLKAEAAVDKAFKRCEEIFAKYPMQQS* |
Ga0182036_109888852 | 3300016270 | Soil | AAFDVMNNGMAPEQAIDKAFKRAEEIFAKYPITQA |
Ga0182036_117836251 | 3300016270 | Soil | NADHAFSIAEYDVMKEGMSPEQAIDKAFKRAEAIFPKYPIEQA |
Ga0182041_115191541 | 3300016294 | Soil | EVDAEHVFSVAEFDVLKNGMAPEAAIDKAFKRADEMFAKYQIVQG |
Ga0182033_106069852 | 3300016319 | Soil | SVAEFDVLKNGMAPEAAIDKAFKRAEEIFAKYQIT |
Ga0182035_116240372 | 3300016341 | Soil | FSVAMFDVMNNGMASEQAVDKAFKRAEEIFAKYPIQQA |
Ga0182034_101598511 | 3300016371 | Soil | AMIDVINKRVTPQAAVDKAFKRAEEIFAQYPIEEG |
Ga0182034_109930791 | 3300016371 | Soil | AMFDAMNNGMTPEQAIDKAFKRAEEIFAKYPIVAS |
Ga0182034_113806681 | 3300016371 | Soil | IAINNVINNGMTPEAAIDKAFRRCEEIFAKYPIEQA |
Ga0182039_108315551 | 3300016422 | Soil | IAMLDVMNNGMAPEAAIDKAFKRADEIFAKYPITQA |
Ga0182038_100674874 | 3300016445 | Soil | AMLDVMNNGMTPEQAIDKAFKRAEEIFAKYPIVAS |
Ga0187808_101239772 | 3300017942 | Freshwater Sediment | FPLAILDVINNGVAPEAAVDKAFKRTEEIFAKYPIAQS |
Ga0187777_114773412 | 3300017974 | Tropical Peatland | HVIMNAAFAVMNSGAAAEPEIDKAFKRIEEIFAKYPIVSS |
Ga0210386_104672571 | 3300021406 | Soil | SVAEFDVMNNGMAPEQAVDKAFKRAETIFAKYPIQQA |
Ga0213878_101828593 | 3300021444 | Bulk Soil | AEFDVMKNGMAPEAAIDQAFKRAEEIFAKFPITQA |
Ga0210410_117830452 | 3300021479 | Soil | LFSVAMFDVMNNGMASEQAIGKAFKRAEEIFAKYPIQQA |
Ga0126371_110364423 | 3300021560 | Tropical Forest Soil | VFSVAEFDVLKNGMAPEAAIDKAFKRAEEIFVKYPITQA |
Ga0242651_10538721 | 3300022511 | Soil | SVAMFDVMNNGMASEQAVDKAFKRGEEIFAKYPIQQA |
Ga0242660_10400071 | 3300022531 | Soil | AEHVIMTAAFAVMNSGAVPEQQIDKAFSRIEEIFAKYPIASS |
Ga0242655_101275522 | 3300022532 | Soil | SVAMFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQT |
Ga0242662_100385111 | 3300022533 | Soil | MNAAFAVMNSGAAAEPEIDKAFRRIEEIFAKYPIVSS |
Ga0207699_112737362 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SVAEFDVINSGMAPEQAIDKAFKRAEAIFAKYPIEQA |
Ga0209154_10446851 | 3300026317 | Soil | EHVFMTAIFDFLNNGVAAEPAIDKAFKRAEEIFAKYPIQQA |
Ga0257165_11024452 | 3300026507 | Soil | AMFDVMNNGMAPEQAIDKAFKRAEAIFAKYPIISS |
Ga0209156_100217104 | 3300026547 | Soil | LRDQHDSIGYMTAIFDYLNNGIAPEPAIDKAFKRAEEIFAKYPIQQA |
Ga0208730_10344542 | 3300027047 | Forest Soil | VDAEHVFSVAEFDVLKNGMAPEAAIDKAFKRADEIFTRYPISQS |
Ga0209388_11113811 | 3300027655 | Vadose Zone Soil | EIDAEHVWSVAMFDVINNGMAPAQAIDKAFKRAETIFAKYQIT |
Ga0209112_100726703 | 3300027817 | Forest Soil | LAILDVINNGVAPEAAVDKAFKRTEEIFAKYPIAQS |
Ga0209698_109699261 | 3300027911 | Watersheds | VGQENVFMSAVVEVMKNGAKVAEAADKALKRAETIFAKYPIQQA |
Ga0222749_102881041 | 3300029636 | Soil | SVAEFDVLKNGMAPEAAIDKAFKRADEIFTRYPISQS |
Ga0222748_10883421 | 3300029701 | Soil | VAMFDVMNNGMASEQAVDKAFKRGEEIFAKYPIQQA |
Ga0170834_1079465552 | 3300031057 | Forest Soil | AEFDVLKNGMAPEAAIDKAFKRADEIFTRYPISQS |
Ga0308199_11261581 | 3300031094 | Soil | IDAEHVWSVAMFDVINNGMAPAQAIDKAFKRAETIFAKYQIT |
Ga0308194_100639881 | 3300031421 | Soil | MPSMCGVAMFDVINNGMAPAQAIDKAFKRAEAIFAKYPIQQA |
Ga0318541_107125712 | 3300031545 | Soil | VAMFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA |
Ga0318538_106813201 | 3300031546 | Soil | HVFSVAEFDVLKNGMAPEAAIDKAFKRADEIFTKYPITQA |
Ga0318515_105671402 | 3300031572 | Soil | VNAEHFFSIAEFDVMNNGIAPEQAIDNAFKRAEAIFAKYQIVQG |
Ga0318574_100564781 | 3300031680 | Soil | LFSVAMFDVMKEGMKPEQAVDKAFKRAEEIFAKYPIQQA |
Ga0318496_102961042 | 3300031713 | Soil | VFSVAMFDVMKEGMAPEAAVDKAFKRAEEIFAKYQIVQG |
Ga0306917_111703132 | 3300031719 | Soil | FSIAEFDVMNNGMAPEQAIDHAFKRAEAIFAKYQIVQG |
Ga0307469_108043661 | 3300031720 | Hardwood Forest Soil | FSVAMFDAMNNGMTAEQAIDKAFKRAEEIFAKYPIISS |
Ga0318501_103445612 | 3300031736 | Soil | FSVAMFDVMKEGMAPEAAVDKAFKRAEEIFAKYQIVQG |
Ga0318501_104354451 | 3300031736 | Soil | LFSVAMFDAMNNGMTSEQAIDKAFKRAEEIFTKYPIQQA |
Ga0307477_108535763 | 3300031753 | Hardwood Forest Soil | VAMFDVMNNGMAPEQAIDKAFTRAEEIFAKYPIQQA |
Ga0318546_110034041 | 3300031771 | Soil | AFSVAMFDVMNNGMTAEQAIDKAFKRADEIFAKYPIQQA |
Ga0318547_106744751 | 3300031781 | Soil | FSVAEFDVLKNGMAPEAAIDKAFKRAEEIFSKYPIQQA |
Ga0318548_105326911 | 3300031793 | Soil | VFSVAEFDVLKNGMAAEAAIDKAFKRADEIFTKYPIAQS |
Ga0318523_104641731 | 3300031798 | Soil | SSIAEFDVMNNGMAPEQAIDKAFKRAEAIFAKYQIVQG |
Ga0318512_103943131 | 3300031846 | Soil | VAMFDVMNNGMAPEQAVDKAFKRAEEIFAKYPIVSS |
Ga0306925_118753731 | 3300031890 | Soil | AEHVWSVAMFDVINNGMTPAQAIDKAFKRVETLLAKYQITQG |
Ga0310912_110152071 | 3300031941 | Soil | VGAEHVFMVAVFDVLNNGMAPVAAIDKAFKRAEEIFAKYPIQQV |
Ga0310916_102090671 | 3300031942 | Soil | DHAFSIAEYDVMKEGMSPEQAIDKAFKRAEAIFPKYPIEQA |
Ga0310916_115895112 | 3300031942 | Soil | AEFDVLKNGMTPEAAIDKAFKRAEEIFTKYQIVQG |
Ga0310913_104792821 | 3300031945 | Soil | VAMFYVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA |
Ga0310909_107401041 | 3300031947 | Soil | IAEYDVMKEGMTPEAAIDKAFKRADEIFAKYPITQA |
Ga0310909_109509012 | 3300031947 | Soil | SVAEFDVLKNGMAPEAAIDKAFKRAEEIFSKYPIQQA |
Ga0310909_114301521 | 3300031947 | Soil | FSVAEFDVLKNGMAAEAAIDKAFKRADEIFTKYPIAQS |
Ga0306926_104213022 | 3300031954 | Soil | SVAMFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA |
Ga0306926_120528781 | 3300031954 | Soil | SIAAYEVMTEGMTPEAAIDKAFKRADEIFAKYPITQA |
Ga0307479_114045071 | 3300031962 | Hardwood Forest Soil | SVAEFDVLKNGMAPEAAIDKAFKRADEIFTRYPIAQS |
Ga0318531_102756991 | 3300031981 | Soil | VNAEHLFSVAMFDAIKEGMAAKQAIDKAFKRAEEIFAKYPIAQA |
Ga0306922_108028981 | 3300032001 | Soil | EHVIMNGVFDVLNNGMAPEVAIDKAFKRAEAIFAKYPIVSS |
Ga0318570_101781741 | 3300032054 | Soil | AEFDVLKNGMAAEAAIDKAFKRADEIFTKYPIAQS |
Ga0318524_104361772 | 3300032067 | Soil | VFSIAEFDVMNNGIAPEQAIDNAFKRAEAIFAKYQIVQG |
Ga0318553_104392722 | 3300032068 | Soil | AINDVISNGMTPEAAIDKAFSRCEAIFAKFPIAQA |
Ga0306924_119745141 | 3300032076 | Soil | NAEHVFSVAEFDVMNNGIAPEQAIDNAFKRAEAIFAKYQIVQG |
Ga0307470_111111391 | 3300032174 | Hardwood Forest Soil | NGERLFSVAMLDVMNNGMTPEQAIDKSFKRVEPIFAKCPIQQAWEES |
Ga0307471_1008435661 | 3300032180 | Hardwood Forest Soil | NAEHVFMVAEFDVMNGGMAPEAAIDKAFKRVEEIVAKYPITQS |
Ga0307472_1004471991 | 3300032205 | Hardwood Forest Soil | AEFDVLKNGMAPEAAIDKAFKRAEEIFAKYPITQT |
Ga0306920_1026356802 | 3300032261 | Soil | VAEFDVLKNGMAAEAAIDKAFKRADEIFTKYPIAQS |
Ga0306920_1027008251 | 3300032261 | Soil | IAEFDVMNNGMAPEQAIDKAFKRAEAIFAKYQIVQG |
Ga0335073_112492871 | 3300033134 | Soil | FAVAMADVMNDGMTPQAAIDKAFKRCETIFAEYPIQQA |
Ga0310914_116422311 | 3300033289 | Soil | GVFDVMKNGMAPEVAIDKAFKRAETIFTKYPILSS |
⦗Top⦘ |