


| Basic Information | |
|---|---|
| Family ID | F069130 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PIAPGLAISETQFAELIDTCRHLDRHDRAAEKLIGLTIPS |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.82 % |
| % of genes near scaffold ends (potentially truncated) | 97.58 % |
| % of genes from short scaffolds (< 2000 bps) | 88.71 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.161 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.645 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.903 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.839 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 2.94% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13432 | TPR_16 | 17.74 |
| PF00501 | AMP-binding | 5.65 |
| PF01436 | NHL | 4.03 |
| PF00903 | Glyoxalase | 4.03 |
| PF00274 | Glycolytic | 4.03 |
| PF03060 | NMO | 3.23 |
| PF06983 | 3-dmu-9_3-mt | 2.42 |
| PF00296 | Bac_luciferase | 2.42 |
| PF02604 | PhdYeFM_antitox | 1.61 |
| PF01042 | Ribonuc_L-PSP | 1.61 |
| PF02776 | TPP_enzyme_N | 1.61 |
| PF08240 | ADH_N | 1.61 |
| PF13365 | Trypsin_2 | 1.61 |
| PF00497 | SBP_bac_3 | 0.81 |
| PF13410 | GST_C_2 | 0.81 |
| PF00702 | Hydrolase | 0.81 |
| PF12695 | Abhydrolase_5 | 0.81 |
| PF00211 | Guanylate_cyc | 0.81 |
| PF02668 | TauD | 0.81 |
| PF09837 | DUF2064 | 0.81 |
| PF02798 | GST_N | 0.81 |
| PF00144 | Beta-lactamase | 0.81 |
| PF13181 | TPR_8 | 0.81 |
| PF04828 | GFA | 0.81 |
| PF02452 | PemK_toxin | 0.81 |
| PF13533 | Biotin_lipoyl_2 | 0.81 |
| PF01799 | Fer2_2 | 0.81 |
| PF13424 | TPR_12 | 0.81 |
| PF13417 | GST_N_3 | 0.81 |
| PF03972 | MmgE_PrpD | 0.81 |
| PF01515 | PTA_PTB | 0.81 |
| PF13193 | AMP-binding_C | 0.81 |
| PF02653 | BPD_transp_2 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 4.03 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 3.23 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 3.23 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.42 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 2.42 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 2.42 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.61 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.61 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.61 |
| COG0280 | Phosphotransacetylase (includes Pta, EutD and phosphobutyryltransferase) | Energy production and conversion [C] | 0.81 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.81 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.81 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.81 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.81 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.81 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.16 % |
| Unclassified | root | N/A | 29.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101074732 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101785143 | Not Available | 516 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10255442 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300004091|Ga0062387_100469098 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005179|Ga0066684_10919863 | Not Available | 570 | Open in IMG/M |
| 3300005184|Ga0066671_10521487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300005439|Ga0070711_100593436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 923 | Open in IMG/M |
| 3300005530|Ga0070679_101672150 | Not Available | 584 | Open in IMG/M |
| 3300005538|Ga0070731_10201520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1321 | Open in IMG/M |
| 3300005560|Ga0066670_10132499 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300005602|Ga0070762_10155692 | Not Available | 1371 | Open in IMG/M |
| 3300005610|Ga0070763_10121428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-69-10 | 1339 | Open in IMG/M |
| 3300005764|Ga0066903_105491275 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006175|Ga0070712_101545658 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300007982|Ga0102924_1047892 | All Organisms → cellular organisms → Bacteria | 2542 | Open in IMG/M |
| 3300009094|Ga0111539_13372042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300009137|Ga0066709_102312090 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300009137|Ga0066709_103123583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300009137|Ga0066709_104575130 | Not Available | 506 | Open in IMG/M |
| 3300009553|Ga0105249_13014516 | Not Available | 541 | Open in IMG/M |
| 3300010048|Ga0126373_10074034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3084 | Open in IMG/M |
| 3300010048|Ga0126373_11195510 | Not Available | 826 | Open in IMG/M |
| 3300010048|Ga0126373_11258622 | Not Available | 806 | Open in IMG/M |
| 3300010048|Ga0126373_12071905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300010048|Ga0126373_13156797 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010147|Ga0126319_1263184 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010358|Ga0126370_11185212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300010358|Ga0126370_12016547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300010360|Ga0126372_10205743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1644 | Open in IMG/M |
| 3300010366|Ga0126379_11256922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300010401|Ga0134121_13146584 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010869|Ga0126359_1741182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 815 | Open in IMG/M |
| 3300010880|Ga0126350_11128174 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300011120|Ga0150983_14905764 | Not Available | 580 | Open in IMG/M |
| 3300011270|Ga0137391_11074077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300012212|Ga0150985_105497299 | Not Available | 525 | Open in IMG/M |
| 3300012349|Ga0137387_10948813 | Not Available | 619 | Open in IMG/M |
| 3300012363|Ga0137390_10971963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium albiziae | 802 | Open in IMG/M |
| 3300012582|Ga0137358_10103063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1933 | Open in IMG/M |
| 3300012929|Ga0137404_11591015 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012931|Ga0153915_12964705 | Not Available | 553 | Open in IMG/M |
| 3300012989|Ga0164305_11757653 | Not Available | 558 | Open in IMG/M |
| 3300014497|Ga0182008_10004253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8392 | Open in IMG/M |
| 3300015242|Ga0137412_10983979 | Not Available | 605 | Open in IMG/M |
| 3300015245|Ga0137409_11538283 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300016270|Ga0182036_10075863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2209 | Open in IMG/M |
| 3300016319|Ga0182033_11364478 | Not Available | 638 | Open in IMG/M |
| 3300016357|Ga0182032_10992212 | Not Available | 717 | Open in IMG/M |
| 3300016404|Ga0182037_10201667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1543 | Open in IMG/M |
| 3300016404|Ga0182037_11775817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300017792|Ga0163161_10725232 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300017961|Ga0187778_11182805 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300017974|Ga0187777_11136182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300018476|Ga0190274_12466168 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300020140|Ga0179590_1133118 | Not Available | 677 | Open in IMG/M |
| 3300021170|Ga0210400_10059296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2982 | Open in IMG/M |
| 3300021362|Ga0213882_10098343 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300021420|Ga0210394_10304693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-69-10 | 1398 | Open in IMG/M |
| 3300021441|Ga0213871_10289310 | Not Available | 527 | Open in IMG/M |
| 3300021478|Ga0210402_11755373 | Not Available | 547 | Open in IMG/M |
| 3300021479|Ga0210410_10799897 | Not Available | 828 | Open in IMG/M |
| 3300021479|Ga0210410_11278946 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300021560|Ga0126371_11866815 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 721 | Open in IMG/M |
| 3300021560|Ga0126371_12121007 | Not Available | 677 | Open in IMG/M |
| 3300021560|Ga0126371_12261583 | Not Available | 656 | Open in IMG/M |
| 3300022506|Ga0242648_1020139 | Not Available | 848 | Open in IMG/M |
| 3300022726|Ga0242654_10349861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300025916|Ga0207663_10767626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis | 766 | Open in IMG/M |
| 3300025939|Ga0207665_11305492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 578 | Open in IMG/M |
| 3300026538|Ga0209056_10355641 | Not Available | 956 | Open in IMG/M |
| 3300027173|Ga0208097_1004541 | Not Available | 1413 | Open in IMG/M |
| 3300027729|Ga0209248_10154762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 683 | Open in IMG/M |
| 3300027903|Ga0209488_10923024 | Not Available | 610 | Open in IMG/M |
| 3300028047|Ga0209526_10263310 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300028813|Ga0302157_10179643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1230 | Open in IMG/M |
| 3300029701|Ga0222748_1016083 | Not Available | 1041 | Open in IMG/M |
| 3300029913|Ga0311362_10308979 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300030518|Ga0302275_10111915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1796 | Open in IMG/M |
| 3300030520|Ga0311372_12352861 | Not Available | 606 | Open in IMG/M |
| 3300031546|Ga0318538_10155803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1209 | Open in IMG/M |
| 3300031546|Ga0318538_10596101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300031682|Ga0318560_10113992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1409 | Open in IMG/M |
| 3300031708|Ga0310686_119243727 | Not Available | 603 | Open in IMG/M |
| 3300031713|Ga0318496_10180205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1159 | Open in IMG/M |
| 3300031719|Ga0306917_10034925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3272 | Open in IMG/M |
| 3300031744|Ga0306918_10630629 | Not Available | 840 | Open in IMG/M |
| 3300031744|Ga0306918_11067541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300031744|Ga0306918_11220030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300031747|Ga0318502_10983578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300031748|Ga0318492_10551422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300031768|Ga0318509_10083499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1698 | Open in IMG/M |
| 3300031777|Ga0318543_10005213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4208 | Open in IMG/M |
| 3300031777|Ga0318543_10399669 | Not Available | 616 | Open in IMG/M |
| 3300031780|Ga0318508_1156828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium albiziae | 647 | Open in IMG/M |
| 3300031797|Ga0318550_10230076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300031798|Ga0318523_10409933 | Not Available | 673 | Open in IMG/M |
| 3300031846|Ga0318512_10312760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300031893|Ga0318536_10653260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300031896|Ga0318551_10586956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
| 3300031910|Ga0306923_10059417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4241 | Open in IMG/M |
| 3300031910|Ga0306923_10891868 | Not Available | 975 | Open in IMG/M |
| 3300031912|Ga0306921_10084450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3659 | Open in IMG/M |
| 3300031942|Ga0310916_10385430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1192 | Open in IMG/M |
| 3300031945|Ga0310913_10131850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1715 | Open in IMG/M |
| 3300031954|Ga0306926_10109994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3387 | Open in IMG/M |
| 3300031954|Ga0306926_11820183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300032035|Ga0310911_10538585 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300032039|Ga0318559_10006132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4095 | Open in IMG/M |
| 3300032042|Ga0318545_10210508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300032051|Ga0318532_10274955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300032052|Ga0318506_10333988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300032064|Ga0318510_10538903 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300032066|Ga0318514_10142766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1238 | Open in IMG/M |
| 3300032066|Ga0318514_10567954 | Not Available | 604 | Open in IMG/M |
| 3300032076|Ga0306924_11397473 | Not Available | 747 | Open in IMG/M |
| 3300032091|Ga0318577_10016038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3040 | Open in IMG/M |
| 3300032091|Ga0318577_10390999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300032261|Ga0306920_104213571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300032515|Ga0348332_12585520 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300033289|Ga0310914_10181385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1873 | Open in IMG/M |
| 3300033289|Ga0310914_11088471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium albiziae | 700 | Open in IMG/M |
| 3300033290|Ga0318519_10886482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.68% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.42% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.61% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.61% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.81% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1005403961 | 3300002245 | Forest Soil | QPVIPGIAITAGQFAELVDTCRHLERLDTAGQGLIALTIPR* |
| JGIcombinedJ26739_1010747322 | 3300002245 | Forest Soil | APGLAIGEAQFAELIDTCRHLDTIDAAAKKLIGLTIPG* |
| JGIcombinedJ26739_1017851432 | 3300002245 | Forest Soil | APGLAIGETQFAELIDGCRHLDRVDRPAARLISLTIPS* |
| JGIcombinedJ51221_102554421 | 3300003505 | Forest Soil | RPITPGLAIGETQFAELIDTCRRLDRTDRAAEKLIALTIPA* |
| Ga0062387_1004690982 | 3300004091 | Bog Forest Soil | AGRIRPIAPGLAIGETQFAELIDTCGHLDRIDRAAQKLIALTIPS* |
| Ga0066684_109198632 | 3300005179 | Soil | TPGLAISETQFAALIDTCRHLDRADRAAARLISLTIPREV* |
| Ga0066671_105214871 | 3300005184 | Soil | QARRIRPITPGLAISDSQFAELINTCRHLDRVDRAAARLISRTIPS* |
| Ga0070711_1005934362 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EQARRIQPISTGLAISEAQFAEVVDTCRRLDQFDAAAHRLIALTIPR* |
| Ga0070679_1016721502 | 3300005530 | Corn Rhizosphere | TLTSRLQPIAKGLAIPARQFEELIDTCRHLEGVDNAARQLIARTVP* |
| Ga0070731_102015201 | 3300005538 | Surface Soil | IKISPARFAELIDTCRRLDAIEGAAQKLVGLTIPT* |
| Ga0066670_101324991 | 3300005560 | Soil | ARRIGPIAPGTAIGEAGFTELVDACRNLDRLDHAAERLIALTIPA* |
| Ga0070762_101556921 | 3300005602 | Soil | PITPGLAISEAQFAELIDTCRHLDRHDRAAEKLIGLTIPS* |
| Ga0070763_101214282 | 3300005610 | Soil | IAPGLAISETQFAELIDGCRHLDRVDRAAARLISLTVPA* |
| Ga0066903_1054912752 | 3300005764 | Tropical Forest Soil | RIRPITPGLAIGEGQFGELIDTCRRLDRVEQTAQRLIALTTPMGA* |
| Ga0070712_1015456582 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGIPEAQFTRLIDTCRNLDSIDGAADKLVSLTIPA* |
| Ga0102924_10478923 | 3300007982 | Iron-Sulfur Acid Spring | RRIRPVAPGLAIGEAQYAELIDTCRHLDTIDNAARRLIALTIPA* |
| Ga0111539_133720421 | 3300009094 | Populus Rhizosphere | AIGEAQFDGLIDSCRRLDTLDRAAETLIGLTIPA* |
| Ga0066709_1023120901 | 3300009137 | Grasslands Soil | THLNKPIAPGLAITQAQSAILIDACRHLDNIPGAAEKLISLTIP* |
| Ga0066709_1031235833 | 3300009137 | Grasslands Soil | MRGIAPGLAISETQFAELIDTCRHLDTLDRAASSLIDLTLPA* |
| Ga0066709_1045751301 | 3300009137 | Grasslands Soil | EISEARYAELIDTCRHLDRHDRAAAKLIALTLPS* |
| Ga0105249_130145161 | 3300009553 | Switchgrass Rhizosphere | QPFSSGLAISEAQFAEVVDTCRRLDQLDAAGQRMIALTIPR* |
| Ga0126373_100740341 | 3300010048 | Tropical Forest Soil | PGLAVSETQFAELIDTCRHLDRIDAAAQKLIALTIPS* |
| Ga0126373_111955101 | 3300010048 | Tropical Forest Soil | PGLAISEGEFSELIDTCRRLDRTERAAERLIALTIPA* |
| Ga0126373_112586222 | 3300010048 | Tropical Forest Soil | EVRRIRPIAAGLAISDAQFAELIDTCRRLDRAERAAQDLISLTLPLGRSATV* |
| Ga0126373_120719052 | 3300010048 | Tropical Forest Soil | GLAISEAQFAELIDTCRHLDTIDRAAEKLIGLTIPS* |
| Ga0126373_131567972 | 3300010048 | Tropical Forest Soil | APGLAIPESQFAELIDTCRNLDRVERAGGRLIALTIPA* |
| Ga0126319_12631842 | 3300010147 | Soil | DFEEQARRIRPIAPGLAISDARFAELIDTCRNIDRIDRAAERLISLTIA* |
| Ga0126370_111852121 | 3300010358 | Tropical Forest Soil | PGLAISEAEFGELIDCCRHLDRLERAAEKLIALTIPS* |
| Ga0126370_120165471 | 3300010358 | Tropical Forest Soil | APGLAINKAQFAELIEACRHLDRADRAAGTLIKLTIPA* |
| Ga0126372_102057431 | 3300010360 | Tropical Forest Soil | GLAIREGQFAELIDTCCHLDRHEQAAEKLIALTIPS* |
| Ga0126379_112569221 | 3300010366 | Tropical Forest Soil | IRPIAPGLAISETQFAELIDTCRHLDGVDGAAKKLIALTVPG* |
| Ga0134121_131465841 | 3300010401 | Terrestrial Soil | TPGLAISGIQFAELIDACRTLDRIDDAGRKLIALTIPA* |
| Ga0126359_17411823 | 3300010869 | Boreal Forest Soil | PGLAISPAQFAELIDACRHLDDVDNAAARLIGLTIPA* |
| Ga0126350_111281742 | 3300010880 | Boreal Forest Soil | RISPIVPGLAISPAQFAELIDTCRNLDRIDSTAQRLIALTIPG* |
| Ga0150983_149057641 | 3300011120 | Forest Soil | RRIRPITPGLAISETQFAELIDTCRHLDRVDQAAARLISLTVPS* |
| Ga0137391_110740772 | 3300011270 | Vadose Zone Soil | IAIGEAQYDRLIDCCRHLDTLDHAAETLIGLTIPG* |
| Ga0150985_1054972991 | 3300012212 | Avena Fatua Rhizosphere | ISPIAPGLAISEAQFAELIDTCRHLDRVERGAQQLIALTVPS* |
| Ga0137387_109488132 | 3300012349 | Vadose Zone Soil | LAIGESQFAELIDTCRRLDRLDRAASKLISLTIPV* |
| Ga0137390_109719632 | 3300012363 | Vadose Zone Soil | GLAISEGQFTELIDTCRHLDRLDRAAHKLISLTIPA* |
| Ga0137358_101030634 | 3300012582 | Vadose Zone Soil | ALALAIGETQFAELIDACRHLDRIDRAAERLISLTVPG* |
| Ga0137404_115910151 | 3300012929 | Vadose Zone Soil | MLRITPGLAIDEAQFERLIETCRHLDGVERAAATLIALTIPG* |
| Ga0153915_129647052 | 3300012931 | Freshwater Wetlands | IRPIAPGLAIAEAQYERLIDTCRHLDTLDHAAGELITLTIPG* |
| Ga0164305_117576531 | 3300012989 | Soil | SAGLAISETQFAELVDTCRRLDRFDTAGRRLIALTIPR* |
| Ga0182008_1000425311 | 3300014497 | Rhizosphere | RLAIKEGRFAELVDTCRKLDQFDAAAQKLIGLTIPR* |
| Ga0137412_109839791 | 3300015242 | Vadose Zone Soil | ITPGLAIGETQFAELIDTCRRLDRTDRAAEKLIALTIPA* |
| Ga0137409_115382832 | 3300015245 | Vadose Zone Soil | PGLAINEAQFTELIDTCRHLDGTDRAAEKLIALTIAS* |
| Ga0182036_100758633 | 3300016270 | Soil | RIYPIASGLAVRETQFAELIDTCRRLDGTDRVAEKLIRLTIPS |
| Ga0182033_113644781 | 3300016319 | Soil | RIRPIAPGLAISEAQYAKLLDTCRHLDDIDGAAEKLIALTIPS |
| Ga0182032_109922121 | 3300016357 | Soil | SPPHPPDRPGVAIGNAQFAELIDCRGHLDLVDRAAEKLISLTIRS |
| Ga0182037_102016673 | 3300016404 | Soil | RIRPIAAGLAVGETQFAELIDTCHHLDRMDRAAEKLIALTIPS |
| Ga0182037_117758172 | 3300016404 | Soil | FDEQARRIRPIAAGLAVGETQFAELIDTCRHLDRLDLAAQKLIALTIPA |
| Ga0163161_107252321 | 3300017792 | Switchgrass Rhizosphere | IAIGEAQFDRLIDSCRHLETLDRAAETLIGLTIPA |
| Ga0187778_111828051 | 3300017961 | Tropical Peatland | ETGLAIAPAQYAELIDTCRRLDSVDNAAQKLIALTISG |
| Ga0187777_111361822 | 3300017974 | Tropical Peatland | VAPGLAISEAQYDRLIDSCRHLDRLDRAAQTLIGLTVPG |
| Ga0190274_124661681 | 3300018476 | Soil | ILPIAPGLAIPEPQFARLIDTCRNLERNDEAAHTLIGLTVPA |
| Ga0179590_11331182 | 3300020140 | Vadose Zone Soil | EARRIRPITPGLAISETQFAALIDGCRRLDRVDRAAARLISLTVSA |
| Ga0210400_100592961 | 3300021170 | Soil | RRIRPITPGLAISETQFAELIDGCRHLDRVDRAAARLISLTVPA |
| Ga0213882_100983432 | 3300021362 | Exposed Rock | GLAISEAQFAALIDSCRHLDDLDRAAKLIALTIPT |
| Ga0210394_103046932 | 3300021420 | Soil | RPIAPGLAISETQFAELIDGCRHLDRVDRAAARLISLTVPA |
| Ga0213871_102893101 | 3300021441 | Rhizosphere | EEEARRIAPIASGLAIGEGQFARLIDGSRHLDRLDRAAEQLIRLTIPA |
| Ga0210402_117553732 | 3300021478 | Soil | RRIRPVAAGLAIGEAQFAELIDTCRHLDRTDRAAQKLILLTIPL |
| Ga0210410_107998971 | 3300021479 | Soil | IQPIAPGLAIPEIQFAALIDVCRNLDRIDNAASRLIALTLPHGG |
| Ga0210410_112789463 | 3300021479 | Soil | PGLAIPEAQFAELIDACRHLDTIDHAAQKLIALTIPS |
| Ga0126371_118668151 | 3300021560 | Tropical Forest Soil | PIAPGLAISETQFAELIDACRHLDDLDRAAQKLIALTIPP |
| Ga0126371_121210071 | 3300021560 | Tropical Forest Soil | VCRIRPIAPGLAISEVQFVELIDACRHLDRVEQTAQHLIALTIPS |
| Ga0126371_122615831 | 3300021560 | Tropical Forest Soil | RRIRPIAPGLAIPETQFVELIDACRRLDAIDRAADRLIALTIPA |
| Ga0242648_10201392 | 3300022506 | Soil | PIAPGLAISETQFAELIDTCRHLDRHDRAAENLIGLTIPS |
| Ga0242654_103498611 | 3300022726 | Soil | DFEEHARRIRPIAPGLAIGEAQFGELVDTCRHLDLMDRAAERVIALTVPA |
| Ga0207663_107676262 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QARRIRPVTPGLAISEGQFTELIDACRHLEKIDGAAEKLISLTIDGGH |
| Ga0207665_113054922 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TPGLAIGETQFAELIDTCRRLDRTDRAAEKLIALTIPA |
| Ga0209056_103556412 | 3300026538 | Soil | LAIGETQFTELIDTCRHLDRIDRAAEKLIALTIPA |
| Ga0208097_10045411 | 3300027173 | Forest Soil | RPITPALAISEAQFAELIDTCRHLDRHDRAAEKLIGLTIPS |
| Ga0209248_101547622 | 3300027729 | Bog Forest Soil | RIRPIGPGLAISETQFSELIDTCRHLDRADRAAQQLIALTIPA |
| Ga0209488_109230242 | 3300027903 | Vadose Zone Soil | GLAIGEAQFAELIDTCRHLDTIDAAAEKLIRLTIPV |
| Ga0209526_102633102 | 3300028047 | Forest Soil | RRIKPIAPGLAIGEAQFAELIDACRHLDTLDAAAKKLIGLTIPG |
| Ga0302157_101796433 | 3300028813 | Bog | PVKPGLAISPSRFDGLIDTCRHLDTIDTAASNLFVLTIPQ |
| Ga0222748_10160831 | 3300029701 | Soil | PIAPGLAISETQFAELIDTCRHLDRHDRAAEKLIGLTIPS |
| Ga0311362_103089792 | 3300029913 | Bog | LAIGGRQFSELIDCCRNLDHVDRAAEELIALTIPA |
| Ga0302275_101119154 | 3300030518 | Bog | VKPGLAISPSRFDGLIDTCRHLDTIDTAASNLIVLTIPQ |
| Ga0311372_123528611 | 3300030520 | Palsa | PIESGIAVSPARYAELTDTCRHLDEIDNAAQRLIGLTIPN |
| Ga0318538_101558031 | 3300031546 | Soil | RRIRPIAPGFAISEAQFVELIDTCRRLDRIDRAAEKLIGLTIPARTPQRSAE |
| Ga0318538_105961012 | 3300031546 | Soil | TSGLAISDKQFGELIDTCRHLDRIDRAADKLISLTIPA |
| Ga0318560_101139923 | 3300031682 | Soil | AISEAQFVELIDTCRRLDRIDPAAEKLIGLTIPARTPQRSAD |
| Ga0310686_1192437271 | 3300031708 | Soil | GLAISETQYDRLIDSCRNLETLDRAADTLIGLTIPA |
| Ga0318496_101802052 | 3300031713 | Soil | AISEAQFVELIDTCRRLDRIDRAAEKLIGLTIPARTPQRSAD |
| Ga0306917_100349251 | 3300031719 | Soil | GFAISEAQFVELIDTCRRLDRIDRAAEKLIGLTIPARTPQRSAD |
| Ga0306918_106306292 | 3300031744 | Soil | HPPDRPGVAIGNAQFAELIDCRGHLDLVDRAAEKLISLTIRS |
| Ga0306918_110675411 | 3300031744 | Soil | AAGLAVGETQFAELIDTCRHLDRMDHATEKLIALTIPS |
| Ga0306918_112200301 | 3300031744 | Soil | IRPITSGLAISESQFAELIDTCRHLDHIDAAAGKLIGLTIPS |
| Ga0318502_109835781 | 3300031747 | Soil | PSLAIGKAQFAELIDCRRHLDLVDRVAEKLISLTIRS |
| Ga0318492_105514222 | 3300031748 | Soil | RIYPIASGLAVRETQFAELIDTCRRLDGTDRVAEKLIGLTIPS |
| Ga0318509_100834992 | 3300031768 | Soil | RRIRPIAPGLAISEAQFVELIDTCRRLDRIDPAAEKLIGLTIPARTPQRSAD |
| Ga0318543_100052134 | 3300031777 | Soil | PGLAISEAQFAELINTCRHLDHIDRAGEKLIGLTVSA |
| Ga0318543_103996691 | 3300031777 | Soil | IAPGLAIGEPQFAELIDTCRHLERRDRAAPKLIALTIPA |
| Ga0318508_11568281 | 3300031780 | Soil | PGLAIPEAQFVELIDTCRRLDRIDRAAQDLIALTVAT |
| Ga0318550_102300761 | 3300031797 | Soil | AISEAQVVELIDTCRRLDRIDRAAEKLIGLTIPARTPQRSAD |
| Ga0318523_104099332 | 3300031798 | Soil | QRIRPIAPGLAISEAQYAKLLDTCRHLDDIDGAAEKLIALTIPS |
| Ga0318512_103127601 | 3300031846 | Soil | PITPGLAVSETQFDELIDTCRRLDRTDRAAERLIVLTIPS |
| Ga0318536_106532601 | 3300031893 | Soil | ARRIYPIASGLAVRETQFAELIDTCRRLDGTDRVAEKLIRLTIPS |
| Ga0318551_105869561 | 3300031896 | Soil | VELIDTCRRLDRIDRAAEKLIGLTIPARTPQRSAD |
| Ga0306923_100594171 | 3300031910 | Soil | PGLAIGEPQFAELIDTCRHLERRDRAAPKLIALTIPA |
| Ga0306923_108918682 | 3300031910 | Soil | REFILNFEEVDRRIRPIAPSLAIGKAQFAELIDCRRHLDLVDRVAEKLISLTIRS |
| Ga0306921_100844501 | 3300031912 | Soil | PGFAISEAQFVELIDTCRRLDRIDRAAEKLIGLTIPARTPQRSAD |
| Ga0310916_103854301 | 3300031942 | Soil | IAPGLAISEAQFVELIDTCRRLDRIDPAAEKLIGLTIPARTPQRSAD |
| Ga0310913_101318501 | 3300031945 | Soil | IAISEAQFVELIDTCRRLDRIDRAAEKLIGLTIPARTPQRSAD |
| Ga0306926_101099941 | 3300031954 | Soil | RPIAPGLAISETQFAELIDTCRQLDRLDRAAEQLISLTIPS |
| Ga0306926_115386662 | 3300031954 | Soil | RIRPVASGLAISDAQFAELIDACRHLDGIEAAGQQLIALTIPR |
| Ga0306926_118201832 | 3300031954 | Soil | EQARRIRPIAAGLAVGETQFAELIDTCRHLDRMDHATEKLIALTIPS |
| Ga0310911_105385851 | 3300032035 | Soil | TPGLAIGEGQFGELIDTCRRLDRVEQAAQRLIALTTPMGA |
| Ga0318559_100061321 | 3300032039 | Soil | IRPIAPGLAISEAQYAKLLDTCRHLDDIDGAAEKLIALTIPS |
| Ga0318545_102105082 | 3300032042 | Soil | PGLAVSETQFDELIDTCRRLDRTDRAAERLIVLTIPS |
| Ga0318532_102749552 | 3300032051 | Soil | IAGGLAVRETQFAELIDTCRRLDSTDRVAEKLIGLTIPS |
| Ga0318506_103339881 | 3300032052 | Soil | SGLAISDKQFGELIDTCRHLDRIDRAADKLISLTIPA |
| Ga0318510_105389032 | 3300032064 | Soil | IRPIAPGLAISEAQFAELLDSCRHLDLVDRAAEMLIGLTVPG |
| Ga0318514_101427661 | 3300032066 | Soil | EFEEQARRIYPIAGGLAVRETQFAELIDTCRRLDSTDRVAEKLIGLTIPS |
| Ga0318514_105679542 | 3300032066 | Soil | LAISEAQFAELIDTCRHLDHIDRAGEKLIGLTISA |
| Ga0306924_113974731 | 3300032076 | Soil | LAIGEAQFAELIDTCRNLDRTDRAALKLISLTIPT |
| Ga0318577_100160381 | 3300032091 | Soil | IRGVAPGLAITETQFAELIDCCRHLDRLDQAAEKLISLTIPS |
| Ga0318577_103909992 | 3300032091 | Soil | PIAPGFAISEAQFVELIDTCRRLDRIDRAAEKLIGLTIPARTPQRSAD |
| Ga0306920_1042135711 | 3300032261 | Soil | DFEEQARRIYPIASGLAVRETQFAELIDTCRRLDGTDRVAEKLIGLTIPS |
| Ga0348332_125855201 | 3300032515 | Plant Litter | PGLAIAQAQFAELIDACRHLDRAERAAEKLIALTIP |
| Ga0310914_101813855 | 3300033289 | Soil | IATGLAIGEPQFAELIDTCRHLERRDRAAPKLIALTIPA |
| Ga0310914_110884711 | 3300033289 | Soil | GLAIPEAQFAALIDTCRRLDRIDRAAQNLIALTVAT |
| Ga0318519_108864822 | 3300033290 | Soil | IRPIAAGLAVGETQFAELIDTCRHLDRMDHATEKLIALTIPS |
| ⦗Top⦘ |