| Basic Information | |
|---|---|
| Family ID | F069128 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 45 residues |
| Representative Sequence | RAYLPGVPMYGAVFVVAFFSPLAAVFLTFAIAAFYLPSAALFDR |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.46 % |
| % of genes near scaffold ends (potentially truncated) | 91.13 % |
| % of genes from short scaffolds (< 2000 bps) | 93.55 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.419 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (9.677 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.194 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.935 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00994 | MoCF_biosynth | 40.32 |
| PF00005 | ABC_tran | 5.65 |
| PF06736 | TMEM175 | 4.03 |
| PF00300 | His_Phos_1 | 3.23 |
| PF01906 | YbjQ_1 | 2.42 |
| PF11139 | SfLAP | 2.42 |
| PF01032 | FecCD | 1.61 |
| PF16640 | Big_3_5 | 0.81 |
| PF00041 | fn3 | 0.81 |
| PF00873 | ACR_tran | 0.81 |
| PF12951 | PATR | 0.81 |
| PF13177 | DNA_pol3_delta2 | 0.81 |
| PF13292 | DXP_synthase_N | 0.81 |
| PF12848 | ABC_tran_Xtn | 0.81 |
| PF01872 | RibD_C | 0.81 |
| PF00571 | CBS | 0.81 |
| PF00432 | Prenyltrans | 0.81 |
| PF01636 | APH | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 4.03 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 2.42 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.81 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.42 % |
| All Organisms | root | All Organisms | 22.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.23% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908039 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B3_v_00480120 | 2124908039 | Soil | MYGIVLLVAVFSPLASVVLTFAIAAFYLPSGALFAER |
| E4A_03227530 | 2170459003 | Grass Soil | MYGTVLVVAFFSPLASVALTLAIAAFYVPSAALFAER |
| E4A_09985530 | 2170459003 | Grass Soil | AVDRAFNPGIPMYVACLVVAIFSPLGAVLLTFAIAAFYLPSAALFERTG |
| AF_2010_repII_A1DRAFT_100848982 | 3300000597 | Forest Soil | VDRAYLPGLPMYGAVFVLAFFSPLGAVVATFAIAAFYLPSAALFDR* |
| A1565W1_103430352 | 3300001536 | Permafrost | AVRAITRAFAPGVPMYATAVLVAIWSPLASVALTFAIAAFYLPSAALFDR* |
| Ga0066683_106486461 | 3300005172 | Soil | PESTVRAITRAFNPGVPIYAITLLVAVFSPLASVFLTFAIAAFYLPSAALFDR* |
| Ga0066679_102169901 | 3300005176 | Soil | KAITKAFNPGVPIYVLTLLVAVFSPLASVFLTFAIAAFYLPSAALFER* |
| Ga0066684_103794853 | 3300005179 | Soil | LPGLPMYGAVFVLAFFSPLGAVLLTFAIAAFYLPSAALFDR* |
| Ga0066685_108333051 | 3300005180 | Soil | YWPGVPMYAAVFVLAFFSPLGAVLLTFAIAAFYLPSAALFDR* |
| Ga0066676_102672483 | 3300005186 | Soil | FNPGPPIYVATLLVAFVSPLASVLLTLAIAAFYLPSAALFER* |
| Ga0070683_1012051782 | 3300005329 | Corn Rhizosphere | AFDPGVPMYAAVFVLAFFSPLAAVLLTFAIAAFYLPSAALFDR* |
| Ga0070714_1001054095 | 3300005435 | Agricultural Soil | LYGIVLVLAFFSPLAAVFLTFAIAAFYLPSAALFDRGGEPG* |
| Ga0070714_1021646781 | 3300005435 | Agricultural Soil | GLPMYGAVFVLAFFSPLGALLLTFAIAAFYLPSAALFDR* |
| Ga0070710_113477931 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PGVIAYAIVVGLVFVSPLAAVLGTLALAVFYLPSAALFDRGSEPL* |
| Ga0070663_1016045572 | 3300005455 | Corn Rhizosphere | VPIYLVTFAVAYVSPLASVFLTFAIAAFYLPSAALFERGAEPA* |
| Ga0070698_1019960371 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | NPGVPMYSFALLIAVFSPLASVLVTFAIAAFYLPSAALFVER* |
| Ga0070699_1016749822 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LRAVDRAYAPGIALYGIVLVLAFFSPLAAVFLTFAIAAFYLPSAALFDR* |
| Ga0070739_103012002 | 3300005532 | Surface Soil | VDRAFAPGVPAYAAVLLVAVASPLASVVLTLALAAFYLPSAALFER* |
| Ga0070733_110079382 | 3300005541 | Surface Soil | VPMYGAVFVLAFLSPLAAVVLTFAIAAFYLPSAALFDR* |
| Ga0068855_1017173392 | 3300005563 | Corn Rhizosphere | GVPDSALRAISRAFDPGVPMYAAVFVVAFFSPLTAVFLTFAIAAFYLPSAALFDR* |
| Ga0068854_1004479043 | 3300005578 | Corn Rhizosphere | MYGAVFVLAFFSPLGAVFLTFAIAAFYLPSAALFDR* |
| Ga0066654_101043821 | 3300005587 | Soil | AVDRAYAPGILLYGIVLVLAFFSPLAAVFLTFAIAAFYLPSAALFDRGGEPG* |
| Ga0066654_109163931 | 3300005587 | Soil | VDLAYAPGVPMYGVVLGVAFISPLAAVALTFAIAAFYLPSAALFER* |
| Ga0068852_1019301261 | 3300005616 | Corn Rhizosphere | AYLPGVPMYAAVFVVAFFSPLGAVFFTFAIAAFYLPSAALFDR* |
| Ga0068864_1010927721 | 3300005618 | Switchgrass Rhizosphere | RAYWPGVPMYAAVFVVAFFSPLAAVVVTFAIAAFYLPSAALFDR* |
| Ga0068860_1005037013 | 3300005843 | Switchgrass Rhizosphere | LRAVDRAYWPGVPMYAAVFAVAFFSPLAAVLITFAIAAFYLPSAALFDR* |
| Ga0070717_105955243 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VPSYLAVFVLAFFSPLVAVILTLALAAFCLPSATLFAGR* |
| Ga0070717_108930931 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IALLVTFASPLAAVLITFAIAAFYLPSAALFDRRREPR* |
| Ga0066652_1002402541 | 3300006046 | Soil | STIRAITRAFNPGVPMYAGILVVAIFSPLASVILTLAVAAFYLPSAALFAER* |
| Ga0066652_1012357962 | 3300006046 | Soil | RAVDRAYLPGVPMYGTVFVVAFFSPLAAVLITFAIAAFYLPSAALFDR* |
| Ga0070712_1016496852 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IPMYGVVLIVAFFSPVACLVLTFLIAAFYLPSAALFER* |
| Ga0097621_1018609142 | 3300006237 | Miscanthus Rhizosphere | SALRAVDRAYLPGLPMYGAVFVLAFFSPLAAVCLTLAIAAFYLPSAALFDR* |
| Ga0075426_102545191 | 3300006903 | Populus Rhizosphere | ALYGIVLVLAFFSPLAAVFLTFAIAAFYLPSAALFDR* |
| Ga0079219_117948251 | 3300006954 | Agricultural Soil | MYGLVFVVAFFSPLAAVLITFAIAAFYLPSAALFDR* |
| Ga0075435_1017595461 | 3300007076 | Populus Rhizosphere | VDRAYWPGVPMYAAVFVVAFFSPLAAVIVTFAIAAFYLPSAALFDR* |
| Ga0099791_104902402 | 3300007255 | Vadose Zone Soil | PGIPIYALTLIVAVFSPIASVFLTFAIAAFYLPSAALFER* |
| Ga0099827_111051801 | 3300009090 | Vadose Zone Soil | MYAVALLVAVFSPLASVLLTFAIAAFYLPSAALFAER* |
| Ga0105240_104175571 | 3300009093 | Corn Rhizosphere | DSVSDAALRAVDRAYAPGIAMYGIVLVLAFFSPLAAVFLTFAIAAFYLPSAALFDR* |
| Ga0105243_119063292 | 3300009148 | Miscanthus Rhizosphere | RAFNPGVPMYAVTFLVALWIPVASVALTFAIAAFYQPSAALFDRVTD* |
| Ga0126373_109605071 | 3300010048 | Tropical Forest Soil | AYAPGVPLYLLTFVVAFFSPLAAILITLAIAAFYLPSAALFDR* |
| Ga0126373_120716471 | 3300010048 | Tropical Forest Soil | PGIPMYAATFVVAFFSPLAAVVLTFAIAAFYLPSAALFDS* |
| Ga0134084_103723511 | 3300010322 | Grasslands Soil | PGVPMYGAVFLLAFFSPLAAVVLTFAIAAFYLPSAALFDR* |
| Ga0134086_103723731 | 3300010323 | Grasslands Soil | LRAVDRAYLPGLPMYGAVFVLAFFSPLGAVLLTFAIAAFYLPSAALFDR* |
| Ga0134063_104057001 | 3300010335 | Grasslands Soil | LRAVDRAYWPGVPMYAAVFVVAFFSPLAAVFLTFAIAAFYLPSAALFDR* |
| Ga0105239_127694891 | 3300010375 | Corn Rhizosphere | DGVPDSALRAISRAFDPGVPMYAAVFVLAFFSPLAAVLLTFAIAAFYLPSAALFDR* |
| Ga0126381_1043195432 | 3300010376 | Tropical Forest Soil | ISRAFDPGIPMYGAVFVVAFFSPLTAVFLTFAIAAFYLPSAALFDR* |
| Ga0124850_10843962 | 3300010863 | Tropical Forest Soil | DSALEAGDRAYIVGVPIYGVAFLVAFLSPLAAVLITLALAAFYLPSAALFDR* |
| Ga0126356_113000561 | 3300010877 | Boreal Forest Soil | AVPDSALRAVDRAYIPGVPMYGSVFVLAFFSPLAAVVLTFAIAAFYLPSAALFNR* |
| Ga0137392_108447132 | 3300011269 | Vadose Zone Soil | ESRVRAITRAFNPGVPIYALTLLVAVFSPIASVFLTFAIAAFYLPSAALFER* |
| Ga0137364_113716871 | 3300012198 | Vadose Zone Soil | LRAISRAFNPDVPMYAIIFAVAFVSPLASVFLSLAVAAFYLPSAALFAER* |
| Ga0137365_102312381 | 3300012201 | Vadose Zone Soil | PGLPMYGAVFVLAFFSPLGAVLLTFAIAAFYLPSAALFDR* |
| Ga0137381_112468891 | 3300012207 | Vadose Zone Soil | QEIRIRAISRAFNPGPPIYGVTLLVAVFSPLASVFLTFAIAAFYLPSAALFER* |
| Ga0137371_102320321 | 3300012356 | Vadose Zone Soil | GPPIYVATLLVAFASPLASVLLTLAIAAFYLPSAALFER* |
| Ga0137395_112618862 | 3300012917 | Vadose Zone Soil | YATALLVAVFSPLASVVLTFAIAAFYLPSAALFAER* |
| Ga0137410_116400781 | 3300012944 | Vadose Zone Soil | ITRAFNPGVPMYGIALLVAVFSPLASVVLTFAIAAFYLPSAALFAER* |
| Ga0164298_107811872 | 3300012955 | Soil | AYWPGVPMYAAVFVVAFFSPLAAVIVTFAIAAFYLPSAALFDR* |
| Ga0164301_115599162 | 3300012960 | Soil | SGIRAINRAFDPGVPLYTVTLLVAFWSPLASVALTFAIAAFYLPSAALFDRS* |
| Ga0164302_106761921 | 3300012961 | Soil | AIVVGLVFVSPLAAVLVTLGLAVFYLPSAALFDRGGEPL* |
| Ga0134077_105177841 | 3300012972 | Grasslands Soil | VDRAYRPGVPMYAAVFAVAFVSPLGAVLLTFAIAAFYLPSAALFDR* |
| Ga0164307_100811753 | 3300012987 | Soil | VPDSTLRAITRAFNPGIPLYATCFLVAVWSPLGSVALTFAVAAFYLPSAALFDR* |
| Ga0164307_109405371 | 3300012987 | Soil | AFNPGVPMYTTVLLIAFFSPLASVALTFAIAAFYLPSAALFAER* |
| Ga0157373_109979662 | 3300013100 | Corn Rhizosphere | ALRGVDLAYGPGVPIYAIALLVAFASPLASVVLTFAIAAFYLPSAALFDR* |
| Ga0157373_114707391 | 3300013100 | Corn Rhizosphere | ELRSVDLAYGPGVPLYAIAFGIAFASPLASVFFTFAIAAFYLPSAALFQR* |
| Ga0157372_123712552 | 3300013307 | Corn Rhizosphere | AALRGVDLAYAPGVPMYGAVLLIAFFSPLASVLLTFAIAAFYLPSAALFERAGEPA* |
| Ga0134079_103727742 | 3300014166 | Grasslands Soil | MYGTVLVVAFFSPLAAVFLTFAIAAFYLPSAALFDR* |
| Ga0137409_112907622 | 3300015245 | Vadose Zone Soil | VRAITRAFNPGVPMYATALLVAVFSPLASVVLTFAIAAFYLPSAALFAER* |
| Ga0182007_103606261 | 3300015262 | Rhizosphere | NPGVPIYAATLLVAFFSPLASVLLTFAIAAFYLPSAALFER* |
| Ga0134073_103331941 | 3300015356 | Grasslands Soil | LRAVDRAYWPGVPMYAAVFVLAFFSPLGAVLLTFAIAAFYLPSAALFDR* |
| Ga0134072_104172831 | 3300015357 | Grasslands Soil | VPMYALILVVAIVSPLASVILTFAVAAFYLPSAALFAER* |
| Ga0132255_1011118673 | 3300015374 | Arabidopsis Rhizosphere | YATVFVVAFFSPLAALVLTFAIAAFYLPSAALFDR* |
| Ga0182035_104960131 | 3300016341 | Soil | DGMPDSALRAVDRAYWPGVPMYGAVFVVAFFSPLAAVVITFAIAAFYLPSAALFDRGG |
| Ga0187820_10389621 | 3300017924 | Freshwater Sediment | AVDRAYAPGVPMYLLTFVIAFFSPLAAVFATFGIAAFYLPSAAIFDR |
| Ga0187825_104455041 | 3300017930 | Freshwater Sediment | MYGVTFLVAFASPLASVLLTFAIAAFYLPAAALFDR |
| Ga0187809_100239041 | 3300017937 | Freshwater Sediment | MYLLTFAIAFFSPLAAVFATFAIAAFYLPSAAIFDR |
| Ga0187809_100850281 | 3300017937 | Freshwater Sediment | PMYLATFVIAFFSPLAAVIVTFAIAAFYLPSAALFNR |
| Ga0187778_107880781 | 3300017961 | Tropical Peatland | VDRAYLPGVPMYGTVFAVAFFSPLAAVLLTFAIAAFYLPSATLFDR |
| Ga0187776_112340331 | 3300017966 | Tropical Peatland | RAYLPGVPMYATVFVVAFFSPLAAVLITFAIAAFYLPSAALFDRGG |
| Ga0187780_105518452 | 3300017973 | Tropical Peatland | VAQLGALSLPGVPMYGTVFAVAFFSPLAAVLLTFAIAAFYLPSATLFDR |
| Ga0187788_103210561 | 3300018032 | Tropical Peatland | DSALRAVDRAYLPGLPMYGAVFVLAFFSPLGAVLLTFAIAAFYLPSAALFDR |
| Ga0187788_105304302 | 3300018032 | Tropical Peatland | VRAITRAFNPGVPMYAAVFLVAVVSPLASVALTFAIALFYLPSAALFSRV |
| Ga0066662_115773411 | 3300018468 | Grasslands Soil | RAFNPGVPMYGAVFLVAVWSPLASVALTFAIAAFYLPSAALFDR |
| Ga0066662_127461641 | 3300018468 | Grasslands Soil | PESALRAVDRAYLPGVPMYGVVFVVAFFSPLAAVVLTFAIAAFYLPSAALFDR |
| Ga0173482_106713981 | 3300019361 | Soil | DETPDLALRAVDRAYWPGVPMYGAVFVVAFFSPLAAVLITFAIAAFYLPSAALFDR |
| Ga0206354_106244282 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | AFNPGVPIYAATLLVAFFSPLARVLLTFAIAAFYLPSAALFERGGEPA |
| Ga0126371_126925282 | 3300021560 | Tropical Forest Soil | GVPAYAIVLLVAVVSPLLSVVLTLLLAAFYVPSAALFER |
| Ga0207692_108059492 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRAYLPGLPMYGAVFVLAFFSPLAAVCLTLAIAAFYLPSAALFDR |
| Ga0207684_104630191 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VPSYLAVFVLAFFSALVAVILTLALAAFYLPSATLFAGR |
| Ga0207693_111621782 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | FMYGAVFVVAFFSPLASVALTLAIAAFYVPSAALFAER |
| Ga0207693_113000922 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DRAYRPGLPMYGTVFVLAFLSPLAAVVLTLAIAAFYLPSAALFDR |
| Ga0207663_104944791 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ALRAVDAAYLPGVPLYGVTLLAAFFSPLACLVLTFLIAAFYLPSAALFER |
| Ga0207660_114793272 | 3300025917 | Corn Rhizosphere | YAPGVPMYGAVLLIAFFSPLASVLLTFAIAAFYLPSAALFEQRSGQPG |
| Ga0207652_105055691 | 3300025921 | Corn Rhizosphere | FDPGVPMYAGVFVLAFFSPLAAVLLTFAIAAFYLPSAALFDR |
| Ga0207659_113928472 | 3300025926 | Miscanthus Rhizosphere | TVRAITRAFNPGVPMYAVTFLVAFWSPIASVALTFAIAAFYLPSAALFDRVTE |
| Ga0207700_117864771 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PGVVIYGIAFLVAFASPLASVLLTFAIAAFYLPSAALFDR |
| Ga0207664_118598882 | 3300025929 | Agricultural Soil | VDRAYLPGVAMYGTVFALAFFSPLASVVLTFAIAAFYLPSAALFDR |
| Ga0207678_113876451 | 3300026067 | Corn Rhizosphere | SRLDAISRAFNPGVPIYLVTFAVAYVSPLASVFLTFAIAAFYLPSAALFERGAEPA |
| Ga0207702_103711203 | 3300026078 | Corn Rhizosphere | EAALRGVDLAYGPGVPMYAVTLAVAFFSPLASVVLTFAIAAFYLPSAALFER |
| Ga0209265_10835453 | 3300026308 | Soil | RAYLPGVPMYGAVFVVAFFSPLAAVFLTFAIAAFYLPSAALFDR |
| Ga0209153_12814822 | 3300026312 | Soil | PGVPMYGTVFIVAFFSPLAAVILTLAIAAFYLPSAALFDR |
| Ga0209178_13000522 | 3300027725 | Agricultural Soil | LYGIVLVLAFFSPLAAVFLTFAIAAFYLPSAALFDR |
| Ga0265318_100752263 | 3300028577 | Rhizosphere | FNPGVPMYAFALLVAVFSPLASVLVTFAIAAFYLPSGALFAER |
| Ga0265322_100516721 | 3300028654 | Rhizosphere | SYLIVFAVAVFSPLASVGLALALAAFYVPSSALFDR |
| Ga0265336_102337212 | 3300028666 | Rhizosphere | DRAYAPGVAMYGAVFVLAFFSPLTAVALTFAIAAFYLPSAALFDR |
| Ga0265320_104559301 | 3300031240 | Rhizosphere | SAVRAISRAFDPGVPLYAVTFLVAFWSPLASVALTFAIAAFYLPSAALFDRS |
| Ga0265329_101183701 | 3300031242 | Rhizosphere | DRAYAPGVVMYGAVFVLAFFSPLAAVALTFAIAAFYLPSAALFDR |
| Ga0265316_107302501 | 3300031344 | Rhizosphere | YAFALLVAVFSPLASVLVTFAIAAFYLPSGALFAER |
| Ga0318534_106310712 | 3300031544 | Soil | TIVFVLAFFSPLAAVILTLVLAAFYLPSATLFAKR |
| Ga0265314_100862921 | 3300031711 | Rhizosphere | APGVAMYGAVFVLAFFSPLTAVALTFAIAAFYLPSAALFDR |
| Ga0307468_1015249051 | 3300031740 | Hardwood Forest Soil | YAAVFVVAFFSPLAAVLITFAIAAFYLPSAALFDR |
| Ga0318567_107489952 | 3300031821 | Soil | IYTIVFVLAFFSPLAAVILTLVLAAFYLPSATLFAER |
| Ga0318522_102923291 | 3300031894 | Soil | FAPGPPIYTIVFVLAFFSPLAAVILTLVLAAFYLPSATLFAER |
| Ga0318520_110684472 | 3300031897 | Soil | RGVSRAFNPGVPMYGAVFVIAFFSPLASVLLTFAIAAFYLPSAALFDR |
| Ga0308174_111376182 | 3300031939 | Soil | LRGVDLAYAPGVPMYGGVLVLAFFSPLASVLATFAIAAFYLPSAALFERRA |
| Ga0308174_117538562 | 3300031939 | Soil | AVDRAYRPGVPMYAAVFVVAFFSPLAAVFFTFAIAAFYLPSAALFDR |
| Ga0308176_110488112 | 3300031996 | Soil | YGPGVPLYAIAFGIAFASPLASVFFTFGIAAFYLPSAALFER |
| Ga0308176_113053931 | 3300031996 | Soil | ETPDSALRAVDRAYRPGVPMYAAVFVVAFFSPLAAVFFTFAIAAFYLPSAALFDR |
| Ga0308173_101760621 | 3300032074 | Soil | RAFDPGVPMYGIVFVVAFFSPLAAVLLTFAIAAFYLPSAALFDRSGQP |
| Ga0307470_107511482 | 3300032174 | Hardwood Forest Soil | AVDRAYWPGVPMYAAVFVVAFFSPLAAVLITFAIAAFYLPSAALFDR |
| Ga0307471_1010389521 | 3300032180 | Hardwood Forest Soil | GIPLYATCFLVAVWSPLGSVALTFAVAAFYLPSAALFDR |
| Ga0307472_1017141981 | 3300032205 | Hardwood Forest Soil | SALRAVDRAYWPGVPMYGLVFVVAFFSPLAAVVITFAIAAFYLPSAALFDR |
| Ga0335085_102215212 | 3300032770 | Soil | AFDPGVPMYVACLVVAIFSPLAAVFLTFAIAAFYLPSAALFERSTA |
| Ga0335082_100605171 | 3300032782 | Soil | MYGTVFVVAFFSPLAAVIITFAIAAFYLPSAALFDR |
| Ga0335069_101761532 | 3300032893 | Soil | PGVPMYVACLVVAIFSPLASVLLTFAIAAFYLPSAALFERAS |
| Ga0335076_103412441 | 3300032955 | Soil | DRAFDPGVPMYVACLVVAIFSPLAAVFLTFAIAAFYLPSAALFERSTA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |