NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069099

Metagenome / Metatranscriptome Family F069099

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069099
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 45 residues
Representative Sequence MKKLCLILVALACLPALAAGQVVEEIIARVNNQIITRSEFDRSK
Number of Associated Samples 109
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 63.41 %
% of genes near scaffold ends (potentially truncated) 97.58 %
% of genes from short scaffolds (< 2000 bps) 85.48 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.677 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.097 % of family members)
Environment Ontology (ENVO) Unclassified
(24.194 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.258 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 56.94%    β-sheet: 0.00%    Coil/Unstructured: 43.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF07228SpoIIE 84.68
PF13485Peptidase_MA_2 3.23
PF01327Pep_deformylase 0.81
PF00733Asn_synthase 0.81
PF00990GGDEF 0.81
PF01255Prenyltransf 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0020Undecaprenyl pyrophosphate synthaseLipid transport and metabolism [I] 0.81
COG0242Peptide deformylaseTranslation, ribosomal structure and biogenesis [J] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.68 %
UnclassifiedrootN/A15.32 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10025772All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3535Open in IMG/M
3300000789|JGI1027J11758_12224073All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae773Open in IMG/M
3300001471|JGI12712J15308_10203251Not Available521Open in IMG/M
3300002245|JGIcombinedJ26739_101676026Not Available534Open in IMG/M
3300004092|Ga0062389_103213777All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter612Open in IMG/M
3300004092|Ga0062389_104277871Not Available537Open in IMG/M
3300005434|Ga0070709_11260711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae595Open in IMG/M
3300005435|Ga0070714_100891523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae863Open in IMG/M
3300005471|Ga0070698_101989325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae534Open in IMG/M
3300005529|Ga0070741_10410391All Organisms → cellular organisms → Bacteria → Acidobacteria1242Open in IMG/M
3300005532|Ga0070739_10511122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae540Open in IMG/M
3300005542|Ga0070732_10015036All Organisms → cellular organisms → Bacteria → Acidobacteria4309Open in IMG/M
3300005558|Ga0066698_10657124All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300005764|Ga0066903_100180985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3108Open in IMG/M
3300006176|Ga0070765_100266584All Organisms → cellular organisms → Bacteria1575Open in IMG/M
3300006176|Ga0070765_101583794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia616Open in IMG/M
3300006794|Ga0066658_10079991All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300006800|Ga0066660_11469358Not Available536Open in IMG/M
3300006854|Ga0075425_100768025All Organisms → cellular organisms → Bacteria → Acidobacteria1105Open in IMG/M
3300006893|Ga0073928_10305050All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300009038|Ga0099829_11272952All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300009143|Ga0099792_11114871Not Available532Open in IMG/M
3300009522|Ga0116218_1305510All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae712Open in IMG/M
3300009624|Ga0116105_1123784All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300010358|Ga0126370_11555780All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300012096|Ga0137389_10462922All Organisms → cellular organisms → Bacteria → Acidobacteria1086Open in IMG/M
3300012189|Ga0137388_11159051All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300012209|Ga0137379_10110653All Organisms → cellular organisms → Bacteria → Acidobacteria2644Open in IMG/M
3300012210|Ga0137378_10101534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2642Open in IMG/M
3300012923|Ga0137359_11385121Not Available591Open in IMG/M
3300012944|Ga0137410_10925235All Organisms → cellular organisms → Bacteria → Acidobacteria739Open in IMG/M
3300014164|Ga0181532_10496507All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300015265|Ga0182005_1091073All Organisms → cellular organisms → Bacteria → Acidobacteria848Open in IMG/M
3300017927|Ga0187824_10038290All Organisms → cellular organisms → Bacteria → Acidobacteria1459Open in IMG/M
3300017935|Ga0187848_10035020All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2503Open in IMG/M
3300017936|Ga0187821_10327228All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300017961|Ga0187778_10856900Not Available622Open in IMG/M
3300017974|Ga0187777_10500243All Organisms → cellular organisms → Bacteria → Acidobacteria849Open in IMG/M
3300017975|Ga0187782_11073012All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae628Open in IMG/M
3300017988|Ga0181520_10326574All Organisms → cellular organisms → Bacteria → Acidobacteria1138Open in IMG/M
3300017994|Ga0187822_10107137All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300018022|Ga0187864_10176106All Organisms → cellular organisms → Bacteria → Acidobacteria1034Open in IMG/M
3300018062|Ga0187784_10208293All Organisms → cellular organisms → Bacteria → Acidobacteria1595Open in IMG/M
3300018085|Ga0187772_11294488Not Available539Open in IMG/M
3300018090|Ga0187770_10306045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1237Open in IMG/M
3300018090|Ga0187770_11762597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae507Open in IMG/M
3300018468|Ga0066662_10707118All Organisms → cellular organisms → Bacteria → Acidobacteria963Open in IMG/M
3300018468|Ga0066662_11655424All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300020199|Ga0179592_10171082All Organisms → cellular organisms → Bacteria → Acidobacteria990Open in IMG/M
3300020581|Ga0210399_10789831All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300020581|Ga0210399_11051776All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300021181|Ga0210388_10563310All Organisms → cellular organisms → Bacteria → Acidobacteria998Open in IMG/M
3300021403|Ga0210397_10947052All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300021420|Ga0210394_10328611All Organisms → cellular organisms → Bacteria → Acidobacteria1343Open in IMG/M
3300021420|Ga0210394_10637987All Organisms → cellular organisms → Bacteria → Acidobacteria935Open in IMG/M
3300021476|Ga0187846_10476462Not Available511Open in IMG/M
3300021478|Ga0210402_10972287All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300021479|Ga0210410_10452601All Organisms → cellular organisms → Bacteria → Acidobacteria1148Open in IMG/M
3300021479|Ga0210410_10499653All Organisms → cellular organisms → Bacteria → Acidobacteria1086Open in IMG/M
3300021479|Ga0210410_10749397All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300021479|Ga0210410_11672540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae530Open in IMG/M
3300021559|Ga0210409_10779215All Organisms → cellular organisms → Bacteria → Acidobacteria829Open in IMG/M
3300022522|Ga0242659_1120695All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300022711|Ga0242674_1008220All Organisms → cellular organisms → Bacteria → Acidobacteria1044Open in IMG/M
3300022730|Ga0224570_114908Not Available509Open in IMG/M
3300024271|Ga0224564_1064974All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300025414|Ga0208935_1041222All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300025448|Ga0208037_1045169All Organisms → cellular organisms → Bacteria → Acidobacteria871Open in IMG/M
3300025906|Ga0207699_10534628All Organisms → cellular organisms → Bacteria → Acidobacteria849Open in IMG/M
3300025928|Ga0207700_10047642All Organisms → cellular organisms → Bacteria → Acidobacteria3178Open in IMG/M
3300025928|Ga0207700_10793346All Organisms → cellular organisms → Bacteria → Acidobacteria847Open in IMG/M
3300025939|Ga0207665_11311350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300026308|Ga0209265_1090078All Organisms → cellular organisms → Bacteria → Acidobacteria846Open in IMG/M
3300026331|Ga0209267_1272058All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300026530|Ga0209807_1323103Not Available524Open in IMG/M
3300026538|Ga0209056_10132824All Organisms → cellular organisms → Bacteria1948Open in IMG/M
3300027370|Ga0209010_1014455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1409Open in IMG/M
3300027583|Ga0209527_1029239All Organisms → cellular organisms → Bacteria → Acidobacteria1232Open in IMG/M
3300027641|Ga0208827_1216541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae503Open in IMG/M
3300027676|Ga0209333_1017270All Organisms → cellular organisms → Bacteria → Acidobacteria2070Open in IMG/M
3300027745|Ga0209908_10001860All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2596Open in IMG/M
3300027745|Ga0209908_10032824All Organisms → cellular organisms → Bacteria → Acidobacteria1065Open in IMG/M
3300027812|Ga0209656_10014562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4900Open in IMG/M
3300027853|Ga0209274_10152151All Organisms → cellular organisms → Bacteria → Acidobacteria1165Open in IMG/M
3300027855|Ga0209693_10228540All Organisms → cellular organisms → Bacteria → Acidobacteria913Open in IMG/M
3300027879|Ga0209169_10590454Not Available581Open in IMG/M
3300027882|Ga0209590_10079285All Organisms → cellular organisms → Bacteria1912Open in IMG/M
3300027884|Ga0209275_10817806Not Available537Open in IMG/M
3300027889|Ga0209380_10730692All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300027903|Ga0209488_10366423All Organisms → cellular organisms → Bacteria → Acidobacteria1070Open in IMG/M
3300027908|Ga0209006_10103809All Organisms → cellular organisms → Bacteria → Terrabacteria group2518Open in IMG/M
3300028572|Ga0302152_10251891Not Available576Open in IMG/M
3300028747|Ga0302219_10170236All Organisms → cellular organisms → Bacteria → Acidobacteria837Open in IMG/M
3300028798|Ga0302222_10008992All Organisms → cellular organisms → Bacteria → Acidobacteria4159Open in IMG/M
3300028863|Ga0302218_10073338All Organisms → cellular organisms → Bacteria → Acidobacteria1071Open in IMG/M
3300028906|Ga0308309_11446091All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300029910|Ga0311369_11119992All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300029915|Ga0311358_10409737All Organisms → cellular organisms → Bacteria → Acidobacteria1092Open in IMG/M
3300029951|Ga0311371_11330093All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300029999|Ga0311339_10570908All Organisms → cellular organisms → Bacteria → Acidobacteria1133Open in IMG/M
3300030503|Ga0311370_10591101All Organisms → cellular organisms → Bacteria → Acidobacteria1333Open in IMG/M
3300030618|Ga0311354_10069603All Organisms → cellular organisms → Bacteria4018Open in IMG/M
3300030618|Ga0311354_11046654All Organisms → cellular organisms → Bacteria → Acidobacteria749Open in IMG/M
3300030706|Ga0310039_10211184All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300030739|Ga0302311_10307705All Organisms → cellular organisms → Bacteria → Acidobacteria1148Open in IMG/M
3300030815|Ga0265746_1001704All Organisms → cellular organisms → Bacteria → Acidobacteria2125Open in IMG/M
3300030815|Ga0265746_1041615Not Available618Open in IMG/M
3300030991|Ga0073994_12359843All Organisms → cellular organisms → Bacteria → Acidobacteria1027Open in IMG/M
3300031027|Ga0302308_10478934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae735Open in IMG/M
3300031090|Ga0265760_10007121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3203Open in IMG/M
3300031231|Ga0170824_125013667All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae600Open in IMG/M
3300031236|Ga0302324_103549838Not Available505Open in IMG/M
3300031525|Ga0302326_11987629All Organisms → cellular organisms → Bacteria → Acidobacteria752Open in IMG/M
3300031708|Ga0310686_105702892All Organisms → cellular organisms → Bacteria → Acidobacteria941Open in IMG/M
3300031715|Ga0307476_10343949All Organisms → cellular organisms → Bacteria → Acidobacteria1097Open in IMG/M
3300032160|Ga0311301_12881431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae522Open in IMG/M
3300032180|Ga0307471_100008762All Organisms → cellular organisms → Bacteria6643Open in IMG/M
3300032180|Ga0307471_102882866All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300032898|Ga0335072_10025265All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria8310Open in IMG/M
3300032898|Ga0335072_10345092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1634Open in IMG/M
3300033134|Ga0335073_11597209Not Available622Open in IMG/M
3300033158|Ga0335077_11457184Not Available657Open in IMG/M
3300034282|Ga0370492_0381395All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.10%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa11.29%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.45%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.45%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.03%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.23%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.42%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.42%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.42%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.61%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.61%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost1.61%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.61%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.81%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022730Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2Host-AssociatedOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1002577213300000567Peatlands SoilMKKLCLILTAVACLPALAAGQVVEEIIARVNNQIVTRSEFTRSKDQLKDEV
JGI1027J11758_1222407323300000789SoilMKKLALTLIALACMPVVVAGQVVEEIIARVNGQIITRSEFARSKD
JGI12712J15308_1020325113300001471Forest SoilMNSMKKLCLLLIALACLPAFAAGQVVEEIITRVNNQIITQ
JGIcombinedJ26739_10167602613300002245Forest SoilMKKLPLVLAVMACLCGVSAGQVVEEIITRVNNQIITRSEFLRNKDQLKDDV
Ga0062389_10321377723300004092Bog Forest SoilVATPENLMKKLLLVLIAMACLPTFVVGQVVEEIIARVNSQIITRSEYMRS
Ga0062389_10427787123300004092Bog Forest SoilMKRLVLILVATAYLPVFAVGQVVEEIVTRVNGQIITLSEY
Ga0070709_1126071113300005434Corn, Switchgrass And Miscanthus RhizosphereMKRLYLVLIALACLSGLAAGQVVEEIIARINNQIVTHSEFVRSK
Ga0070714_10089152323300005435Agricultural SoilMKRLPLILIVLACTSALATGQVVEEIIARVNNQIITRSEYARSKDQLRDEIKSQ
Ga0070698_10198932513300005471Corn, Switchgrass And Miscanthus RhizosphereMKKLCLVLLALASLPALSVGQVVEEIIARVNNQIVTRSEFVR
Ga0070741_1041039113300005529Surface SoilMTPMKKLCLTSIALACVPVLAAGQVVEEIVARVNNQII
Ga0070739_1051112223300005532Surface SoilMNRFALTLIALACMPALAAGQVVEEIVARVNNQIITRSEYIRSK
Ga0070732_1001503613300005542Surface SoilMKKLCLILVALACLPALAAGQVVEEIIARVNNQIITRSEFDRSK
Ga0066698_1065712413300005558SoilMKKLCILSIIFACFPVLAGAQVVEEIIARVNSQIVTRS
Ga0066903_10018098513300005764Tropical Forest SoilMKRLRLILIVLACTPALAAGQVVEEIIARVNNQII
Ga0070765_10026658443300006176SoilMKKFCLFLAVLAWMPVLASAQVVEEIIARVNNQIVTRSEF
Ga0070765_10158379423300006176SoilMSQGLCRRIVVATPENLMKKLLFVLIAMACLPTFVVGQVVEEIIARVNSQIITRSEYMRSKD
Ga0066658_1007999113300006794SoilMTPMKKLCLTCIALACLPALAAGQVVEEIVARVNNQIITRSEFTRSKDQ
Ga0066660_1146935813300006800SoilMTPMKKLCLTYFALACLPALASGQVVEEIVARVNNQIITGSEFSRSK
Ga0075425_10076802523300006854Populus RhizosphereMRKLFLMLVALACMPALAAGQVVEEIIARVNNQIITHSEFER
Ga0073928_1030505023300006893Iron-Sulfur Acid SpringMKKHCLVLIALTCGPALAAGQAAQNGQVVEEIIARVNNQIITRSEFDRSKDQLKDEV*
Ga0099829_1127295213300009038Vadose Zone SoilMKKLCILSVIFACFPVFAGAQVVEEIIARVNSQIVTRSEF
Ga0099792_1111487113300009143Vadose Zone SoilMKRLCLVLIILASLPALSAGQVVEEIIARVNNQII
Ga0116218_130551023300009522Peatlands SoilMKKLVLILIAMAGLPVFAAGQVVEEIVTRVNSQIITLSE*
Ga0116105_112378423300009624PeatlandMKKLALLFTAFLCCSAFAAGQVVEEIIARVNSQIITRSEFLRSKDQRKDDVK
Ga0126370_1155578023300010358Tropical Forest SoilMKKLLLTLIAIGWIPTLAAGQVVEEIIARVNNQIITKSEFGRSKDQLREEAK
Ga0137389_1046292223300012096Vadose Zone SoilMNKLLLILIATLCLPILAAGQVVEEIITRVNGQIITRSEFQR
Ga0137388_1115905123300012189Vadose Zone SoilMKKLVLVLIAVACLPVFCAGQVVEEIIARVNSQIVTRSEFVRSKDQLK
Ga0137379_1011065333300012209Vadose Zone SoilMKKFSLVLIASVCLPALAAGQVVEEIITRVNNQII
Ga0137378_1010153433300012210Vadose Zone SoilMKKLCLALIPLVCFSVLAAGQVVEEIITRVNNQIITRSEYDRSKDQLKEEAKQQDPKDP
Ga0137359_1138512123300012923Vadose Zone SoilMKKLVLILIAVGCLPVFCAGQVVEEIIARVNSQIITRSEFA
Ga0137410_1092523513300012944Vadose Zone SoilMKKLPLALITLTCLHIPASGQVVEEIVTRVNSQIVTRSEFERSKEQLKDECKQQGG
Ga0181532_1049650713300014164BogMKRMLLIVASVTCLSAFAAGQVIEEVVARVNSQIITLSEFQRSKDQ
Ga0182005_109107313300015265RhizosphereMKRLYLTSITLACLPVLASGQVVEEIVARVNNQIITRSEFN
Ga0187824_1003829033300017927Freshwater SedimentMKKISLVALALFCLPIVAGGQVVEEIITRVNNQIITRSEFQRSKDQLKDEVK
Ga0187848_1003502033300017935PeatlandMKRPFLILVAIACLPAFAAGQVVEEIVTRVNGQIITLSEFQRSKDQLKDDVKQQDPAN
Ga0187821_1032722813300017936Freshwater SedimentMKKPFFALVITACLPALAAGQVVEEIIARVNNQIVTRSEFQRSK
Ga0187778_1085690023300017961Tropical PeatlandMKRVPLVLAALACSSVLATAQAVVEEIITRVNNQIITRSELERSKEQLKDE
Ga0187777_1050024313300017974Tropical PeatlandMKRVPLVLAALACSSVLATAQAVVEEIITRVNNQIITRSELERSK
Ga0187782_1107301223300017975Tropical PeatlandMKKLCLVLTAFACLPSLAAGQQVVEEIIARVNNQIITKSEFER
Ga0181520_1032657423300017988BogMKKIFFAIIGMACVPAMMAGQSVVEEIIARVNGQIITRSEFIRSK
Ga0187822_1010713723300017994Freshwater SedimentMKKLSLILIALACLPALATGQVVEEIIARVNNQIITRSEIARSKDQLRD
Ga0187864_1017610623300018022PeatlandMKTMLLMVIGMSLMPAFAAGQVVEEIVARVNSQIITHSEFLRSKDQLK
Ga0187784_1020829333300018062Tropical PeatlandMKKSFLMLLGVACLSSFAAGQSVVEEIIARVNNQIITLSEFERSKDQL
Ga0187772_1129448813300018085Tropical PeatlandMNRLFVILIGIACLPAFCAGQVVEEIVARVNNQIITRSEFDRSKDQLR
Ga0187770_1030604513300018090Tropical PeatlandMKKLCLVLSAFACLPSLAAGQQVVEEIITRVNNQII
Ga0187770_1176259713300018090Tropical PeatlandMKKHCLILVALACMPAVAFGQVVEEIIARVNNQIITSSEFARSKDQLRDEVKAQNPND
Ga0066662_1070711823300018468Grasslands SoilMKKLFSVILALTCVPALAAGQVVEEIIARVNNQIVTRSEFLRS
Ga0066662_1165542423300018468Grasslands SoilMKKLCILSIIFACFPVLAGAQVVEEIIARVNSQIVTRSEFARSKDQLKEEAK
Ga0179592_1017108213300020199Vadose Zone SoilMKKLLLLLIAMASLPALCAGQVVEEIIARVNSQIVTRSEFLR
Ga0210399_1078983113300020581SoilMKKLCLLIIALSCLTALAAAQGGQVVEEIVTRVNGQIITRSEF
Ga0210399_1105177623300020581SoilMKKHCLVLIALTCGPALAAGQAAQNGQVVEEIIARVNNQIITRSEFDRSKDQL
Ga0210388_1056331023300021181SoilMKKLCLVLIALSCVPALAAGQATQNGQVVEEIIARVNNQIITRSEFDRSK
Ga0210397_1094705213300021403SoilMKRVVLILVGMACLSALAAGQVVEEIVTRVNSQIITRSEF
Ga0210394_1032861113300021420SoilMKRVALILAGMACLPALAAGQVVEEIVTRVNSQIITRSEF
Ga0210394_1063798723300021420SoilMKKLVLILIALISLPTFAAGQLVEEIVTRVNGQIITLSEFQRSKD
Ga0187846_1047646213300021476BiofilmMKKLSLVLILISAMPVLSGAQVVEEIIARVNNQIVTRSEFIRS
Ga0210402_1097228713300021478SoilMKKLCLVLAVLACLPAIAAGQVVEEIIARVNNQIITRSEYERS
Ga0210410_1045260113300021479SoilMKRLVLTLIVTVCMPTFVVGQVVEEIITRVNGQIIT
Ga0210410_1049965323300021479SoilMKKLCLLIIVLSCLSALAAAQGGQVVEEIVTRVNGQIITRS
Ga0210410_1074939723300021479SoilMKKIFLILIVIASLPVLAAGQVVEEIVTRVNSQIITLSEYQRSKDQ
Ga0210410_1167254023300021479SoilMMKKLFPVLLAFACLPALAAGQVVEEIIARVNNQIVTRSE
Ga0210409_1077921523300021559SoilMKKLCLVLAVLACLPAIAAGQVVEEIIARVNNQIITRSEY
Ga0242659_112069523300022522SoilVATPENLMKKLLLVLIAMACLPTFVVGQVVEEIIARVNSQIITRSEY
Ga0242674_100822023300022711SoilMKRLVLILIAMAYLPAFAAGQVVEEIVTRVNSQIITRSEYQRSKDQLRDD
Ga0224570_11490813300022730RhizosphereMKKLCLLIIALSCLTALAAAQGGQVVEEIVTRVNGQIITRSEFDRSKDTLKDE
Ga0224564_106497413300024271SoilMKRPLLILIAMVCLAAFAAGQVVEEIVARVNSAIIT
Ga0208935_104122213300025414PeatlandMKKLALLFTAFLCCSAFAAGQVVEEIIARVNSQIIT
Ga0208037_104516923300025448PeatlandMLLILIGMSFVPAFAAGQVVEEIVARVNSQIITRSEFLRSKD
Ga0207699_1053462823300025906Corn, Switchgrass And Miscanthus RhizosphereMKKLALTLIALTFVPSLASAQQTVEEIIACVNNQIITKSEYTRSKDQLRDEAKQ
Ga0207700_1004764213300025928Corn, Switchgrass And Miscanthus RhizosphereMKRLCLIPVALACLPAFAAGQVVEEIITRVNNQIITRSEYQRSKD
Ga0207700_1079334613300025928Corn, Switchgrass And Miscanthus RhizosphereMKKLALTLIALTFVPSLASAQQTVEEIIARVNNQIITKS
Ga0207665_1131135023300025939Corn, Switchgrass And Miscanthus RhizosphereMKKLCLVLVASACLPALAAGQVVEEIVTRVNNQIITRSE
Ga0209265_109007813300026308SoilMTPMKKRCLTCIALACLPALAAGQVVEEIVARVTNQIITRSE
Ga0209267_127205823300026331SoilMKKLCILSVIFACFPVLAGAQVVEEIIARVNSQIVTRSEF
Ga0209807_132310323300026530SoilMTPMKKLCLTCIALACLPALAAGQVVEEIVARVNNQIITRSEFTRSKDQLRDEVKQ
Ga0209056_1013282413300026538SoilMKKLCILSVIFACFPVLAGAQVVEEIIARVNSQIVT
Ga0209010_101445533300027370Forest SoilMKKLWLVLIASTCVPALAAAQAAQNGQVVEEIITRVNNQIITRSE
Ga0209527_102923933300027583Forest SoilMKKLFCVLVAIAGLPVVCAGQVVEEIIARVNNQIITRSEFVRSKDQ
Ga0208827_121654123300027641Peatlands SoilMKKVCLVLTALACLPPLAAGQVVEEIIARVNNQIVTRSEFGRSKD
Ga0209333_101727033300027676Forest SoilMKRLVLILIAMAYLPVLAGGQVVEEIVTRVNGQIIT
Ga0209908_1000186013300027745Thawing PermafrostMKKLVLILIALICLPVFAAGQVVEEIVTRVNSQIITLSEFQRSKDQLKDEVKQQLSLIHI
Ga0209908_1003282413300027745Thawing PermafrostMLLIVASVTCLSAFAAGQVIEEVVARVNSQIITLSEFQRSKDQLKD
Ga0209656_1001456243300027812Bog Forest SoilMKKFCLVLIASACLPVFASAQVIEEIIARVNNQIVTRSEF
Ga0209274_1015215123300027853SoilMKKLCLLIIALSCLSALAAAQGGQVVEEIVTRVNGQIITRSEFDRSKDT
Ga0209693_1022854013300027855SoilMKRVVLILVGMACLSALAAGQVVEEIVTRVNSQIITRSEFLRSKD
Ga0209169_1059045423300027879SoilMKKLVLILIALISLPAFAAGQVVEEIVTRVNGQIITLSEFQRSKDQ
Ga0209590_1007928533300027882Vadose Zone SoilMKKFSLVLIASVCLPALAAGQVVEEIITRVNNQIIT
Ga0209275_1081780623300027884SoilMKRLVLISIAMAYLPGLAAGQVVEEIVTRVNGQIITRSEYQRSKDQLRD
Ga0209380_1073069213300027889SoilMKKLVLILIAMAGLPVFTAAQVVEEIVTRVNGQIITLSEFQRSKDQ
Ga0209488_1036642313300027903Vadose Zone SoilMKKLVLILIAVGCLPVFCAGQVVEEIIARVNSQIITRSEFARSKDQLKGDVKQQS
Ga0209006_1010380923300027908Forest SoilMKRMLLILLGLSLVPAFAAGQVVEEIVARVNGSIITRSEF
Ga0302152_1025189123300028572BogMKKLVLIFVAMACLPVFCAGQVVEEIITRVNGQIITLSEFQRSKD
Ga0302219_1017023623300028747PalsaMKRMLLILLGMASVSAFAAGQVIEEIVARVNSQIITRSE
Ga0302222_1000899243300028798PalsaMKKLVLILVAMSCLPVYCAGQVVEEIITRVNGQIITLSEFQ
Ga0302218_1007333813300028863PalsaMTISCLAPFCAGQVVEEIIARVNSQIITRSEYIRSKDQLKDDVKQQ
Ga0308309_1144609123300028906SoilMKKLVLTLISMACLPGFTAAQVVEEIVTRVNGQIV
Ga0311369_1111999213300029910PalsaMKKIPLLLAVIACLCAASAGQVVEEIIARVNNQIVTRSEFLRNKD
Ga0311358_1040973713300029915BogMKRPFLILVAITCLSAFAAGQVVEEIVTRVNGRIITLSE
Ga0311371_1133009313300029951PalsaMKKLCLLLIALSCLSALAAAQGGQVVEEIVTRVNGQIITHAEFDRSKDTL
Ga0311339_1057090813300029999PalsaMKKFSCAIICLLSLPALATGQVVEEIIARVNNQIVTRSEFTRS
Ga0311370_1059110123300030503PalsaMNSMKRLSLVLIASACLPALAAGQVVEEIITRVNNQIITHSEYVRSKDQLRD
Ga0311354_1006960343300030618PalsaMKRMLLILLGMASVSAFAAGQVIEEIVARVNSQIITRSEFLRSK
Ga0311354_1104665423300030618PalsaMKKLVLILIAMAGLPVFTAGQVVEEIVTRVNGQIITL
Ga0310039_1021118423300030706Peatlands SoilMKKVCLVLTALACLPPLAAGQVVEEIIARVNNQIVTR
Ga0302311_1030770513300030739PalsaMKRLVLILTAMACLPALATGQVVEEIIARVNSQIIT
Ga0265746_100170433300030815SoilMKKTVLILLCLSFVPALAAGQVVEEIVARVNSQIITRSEY
Ga0265746_104161513300030815SoilMKKLCLLIVTLSCLSALAAAQGGQVVEEIVTRVNSQIITRAEFDR
Ga0073994_1235984323300030991SoilMKKLCLVILASACLPALAVGQVVEEIIARVNNQIVTRSEFVRSKDQLKDEVKQ
Ga0302308_1047893413300031027PalsaMKKMILIFLGMACVPAIVSAQVVEEIIARVNGQIVTLSEFQRSKDQLKEDV
Ga0302180_1027205313300031028PalsaMHMKKFSCAIICLLSLPALATGQVVEEIIARVNNQIVTRSEFTRS
Ga0265760_1000712113300031090SoilMKKLASLFTAVLCCSAFATGQVVEEIIARVNSQIITRSEFLRSKDQL
Ga0170824_12501366713300031231Forest SoilMKRLSLTLIGFACLPAFAHAQVVEEIIARVNNQIITQSEYARSKDQL
Ga0302324_10354983813300031236PalsaMKKLVLTLITMACLPVFCAGQVVEEIITRVNGQIITLSEFQRSKDQL
Ga0302326_1198762923300031525PalsaMKRIVFLLVGLCCLPLFATGQVVEEIVARVNGQIVTRSEF
Ga0310686_10570289223300031708SoilMKRPFLLLVAVACLSVFAAGQVVEEIVARVNSQIITLSEFQRSKD
Ga0307476_1034394913300031715Hardwood Forest SoilMKKLPLILIALTCMPAFAAGQVVEEIVARVNNQIITKSEFARSKDQLRDE
Ga0311301_1288143113300032160Peatlands SoilMKKLCAVLTAFACLPALAAGQQVVEEIIARVNNQII
Ga0307471_10000876213300032180Hardwood Forest SoilMKKFPLTLVALACMPALAEGQVVEEIIARVNNQIITKSE
Ga0307471_10288286623300032180Hardwood Forest SoilMKKFSLALVALACMPALAEGQVVEEIIARVNNQIITKSEFARSKDQ
Ga0335072_1002526583300032898SoilVISMKRLLVVLTVLVCLPVLAGAQVVEEIIARINNQIITRSEYDRSKDQLRDE
Ga0335072_1034509233300032898SoilMKRLSLLLVAFACLPAFVAGQTVVEEIIARVNNQIITRSEYLRSKDQ
Ga0335073_1159720913300033134SoilMKKIFLLSFAVAFLPALAAAQVVEEIITQVNTEIITRSEYQRSKD
Ga0335077_1145718413300033158SoilMKKLSLLLIAIACAPALAAGQSGQVVEEIIAHVNNQIITKSEYERSKDQLRDEVKAQSPNDADK
Ga0370492_0381395_3_1073300034282Untreated Peat SoilMLLILIGMSFVPAFAAGQVVEEIVARVNSQIITRS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.