NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068947

Metagenome / Metatranscriptome Family F068947

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068947
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 41 residues
Representative Sequence TSNVVHQVQQNVREVSHEVPADDLDVPTFLRRQAQKA
Number of Associated Samples 104
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 95.97 %
% of genes from short scaffolds (< 2000 bps) 87.10 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.226 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(22.581 % of family members)
Environment Ontology (ENVO) Unclassified
(29.839 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.032 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.54%    β-sheet: 0.00%    Coil/Unstructured: 58.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF03932CutC 36.29
PF14464Prok-JAB 8.06
PF01569PAP2 5.65
PF00296Bac_luciferase 4.84
PF01040UbiA 4.03
PF00881Nitroreductase 2.42
PF00702Hydrolase 2.42
PF04228Zn_peptidase 1.61
PF07228SpoIIE 1.61
PF01850PIN 1.61
PF00464SHMT 1.61
PF02604PhdYeFM_antitox 0.81
PF00912Transgly 0.81
PF04101Glyco_tran_28_C 0.81
PF13620CarboxypepD_reg 0.81
PF02583Trns_repr_metal 0.81
PF03328HpcH_HpaI 0.81
PF13650Asp_protease_2 0.81
PF05506PLipase_C_C 0.81
PF00069Pkinase 0.81
PF10865DUF2703 0.81
PF13407Peripla_BP_4 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG3142Copper homeostasis protein CutCInorganic ion transport and metabolism [P] 36.29
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 4.84
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.23
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 1.61
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 1.61
COG2321Predicted metalloproteaseGeneral function prediction only [R] 1.61
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.81
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.81
COG1937DNA-binding transcriptional regulator, FrmR familyTranscription [K] 0.81
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.81
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 0.81
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.81
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 0.81
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.81
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.81
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.23 %
UnclassifiedrootN/A21.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E01CMT7BAll Organisms → cellular organisms → Bacteria534Open in IMG/M
3300001593|JGI12635J15846_10611095All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300001593|JGI12635J15846_10669318All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300001593|JGI12635J15846_10870001Not Available515Open in IMG/M
3300005332|Ga0066388_100068168All Organisms → cellular organisms → Bacteria3842Open in IMG/M
3300005332|Ga0066388_102575077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium926Open in IMG/M
3300005437|Ga0070710_10806027All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300005447|Ga0066689_10184030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1260Open in IMG/M
3300005467|Ga0070706_101844543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Thermohalobacteraceae → Clostridiisalibacter → Clostridiisalibacter paucivorans549Open in IMG/M
3300005537|Ga0070730_10446154All Organisms → cellular organisms → Bacteria → Acidobacteria834Open in IMG/M
3300005538|Ga0070731_10094074All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1985Open in IMG/M
3300005557|Ga0066704_10725165Not Available624Open in IMG/M
3300005566|Ga0066693_10321716All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005576|Ga0066708_10299216All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1030Open in IMG/M
3300005587|Ga0066654_10118359All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300005712|Ga0070764_10110297All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300005764|Ga0066903_103146333All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium893Open in IMG/M
3300006031|Ga0066651_10772059Not Available520Open in IMG/M
3300006237|Ga0097621_101944972All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300006755|Ga0079222_10107658Not Available1483Open in IMG/M
3300006806|Ga0079220_10441716All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300007258|Ga0099793_10016158All Organisms → cellular organisms → Bacteria2990Open in IMG/M
3300007258|Ga0099793_10620780Not Available542Open in IMG/M
3300007819|Ga0104322_130500All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300009012|Ga0066710_104862396Not Available503Open in IMG/M
3300009038|Ga0099829_10846671All Organisms → cellular organisms → Bacteria → Acidobacteria759Open in IMG/M
3300009038|Ga0099829_11721587Not Available515Open in IMG/M
3300009088|Ga0099830_10456336All Organisms → cellular organisms → Bacteria → Acidobacteria1038Open in IMG/M
3300009088|Ga0099830_11622022All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300009088|Ga0099830_11868797All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300009090|Ga0099827_11574973Not Available572Open in IMG/M
3300010048|Ga0126373_10842791All Organisms → cellular organisms → Bacteria → Proteobacteria980Open in IMG/M
3300010048|Ga0126373_11390885Not Available767Open in IMG/M
3300010361|Ga0126378_11669394All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300010366|Ga0126379_11857525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300010376|Ga0126381_103595812All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300010880|Ga0126350_10133694All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300012096|Ga0137389_11630138All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300012189|Ga0137388_10951987All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300012202|Ga0137363_10067860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2614Open in IMG/M
3300012205|Ga0137362_11083620Not Available681Open in IMG/M
3300012206|Ga0137380_10135855All Organisms → cellular organisms → Bacteria2243Open in IMG/M
3300012206|Ga0137380_10181453All Organisms → cellular organisms → Bacteria1914Open in IMG/M
3300012361|Ga0137360_10028537All Organisms → cellular organisms → Bacteria3833Open in IMG/M
3300012361|Ga0137360_10936519All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300012362|Ga0137361_11338438Not Available640Open in IMG/M
3300012363|Ga0137390_11600831All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012925|Ga0137419_10950137All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300012944|Ga0137410_10094993All Organisms → cellular organisms → Bacteria2202Open in IMG/M
3300012971|Ga0126369_10104051All Organisms → cellular organisms → Bacteria → Acidobacteria2577Open in IMG/M
3300012975|Ga0134110_10138870All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300013307|Ga0157372_10537053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1363Open in IMG/M
3300014495|Ga0182015_10950294All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300015264|Ga0137403_10016179All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8074Open in IMG/M
3300016294|Ga0182041_10353822All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300017995|Ga0187816_10103270All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300018060|Ga0187765_10653688All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300018085|Ga0187772_10714085All Organisms → cellular organisms → Bacteria → Acidobacteria719Open in IMG/M
3300020579|Ga0210407_10249586All Organisms → cellular organisms → Bacteria → Acidobacteria1382Open in IMG/M
3300020579|Ga0210407_10745847All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300020579|Ga0210407_10916683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium671Open in IMG/M
3300020580|Ga0210403_10192111All Organisms → cellular organisms → Bacteria1675Open in IMG/M
3300020581|Ga0210399_11035498All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300020581|Ga0210399_11536302Not Available515Open in IMG/M
3300020583|Ga0210401_10554059Not Available1012Open in IMG/M
3300020583|Ga0210401_10864638All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300021046|Ga0215015_10064053Not Available1342Open in IMG/M
3300021086|Ga0179596_10431028Not Available666Open in IMG/M
3300021180|Ga0210396_10005288All Organisms → cellular organisms → Bacteria12513Open in IMG/M
3300021404|Ga0210389_11506770All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae511Open in IMG/M
3300021405|Ga0210387_11737273Not Available527Open in IMG/M
3300021420|Ga0210394_10183547All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300021420|Ga0210394_10228881All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300021432|Ga0210384_10913234All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300021477|Ga0210398_10405008All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1112Open in IMG/M
3300021478|Ga0210402_10545489All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300021478|Ga0210402_11689933All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300022508|Ga0222728_1026066Not Available877Open in IMG/M
3300023259|Ga0224551_1084961All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300025157|Ga0209399_10397458Not Available535Open in IMG/M
3300025501|Ga0208563_1024369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1546Open in IMG/M
3300025812|Ga0208457_1049374All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium884Open in IMG/M
3300025912|Ga0207707_10207214All Organisms → cellular organisms → Bacteria1709Open in IMG/M
3300025939|Ga0207665_10166429All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1589Open in IMG/M
3300025939|Ga0207665_10663586Not Available818Open in IMG/M
3300025939|Ga0207665_11538828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300026035|Ga0207703_10805425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria897Open in IMG/M
3300026331|Ga0209267_1117221All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300026342|Ga0209057_1080269All Organisms → cellular organisms → Bacteria1383Open in IMG/M
3300027521|Ga0209524_1124454Not Available537Open in IMG/M
3300027605|Ga0209329_1033894All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300027643|Ga0209076_1060137All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300027660|Ga0209736_1185321Not Available544Open in IMG/M
3300027671|Ga0209588_1085841All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300027678|Ga0209011_1063507Not Available1109Open in IMG/M
3300027701|Ga0209447_10010781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2637Open in IMG/M
3300027846|Ga0209180_10032624All Organisms → cellular organisms → Bacteria → Proteobacteria2812Open in IMG/M
3300027857|Ga0209166_10347123All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300027875|Ga0209283_10057624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2486Open in IMG/M
3300027875|Ga0209283_10175922All Organisms → cellular organisms → Bacteria → Acidobacteria1421Open in IMG/M
3300027908|Ga0209006_10617079All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300028047|Ga0209526_10366504All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium962Open in IMG/M
3300028536|Ga0137415_10571655Not Available940Open in IMG/M
3300028759|Ga0302224_10071301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1316Open in IMG/M
3300029636|Ga0222749_10093868All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1399Open in IMG/M
3300030580|Ga0311355_10019914All Organisms → cellular organisms → Bacteria → Acidobacteria8371Open in IMG/M
3300031236|Ga0302324_100394347All Organisms → cellular organisms → Bacteria → Acidobacteria2068Open in IMG/M
3300031543|Ga0318516_10278498All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300031573|Ga0310915_10813895Not Available657Open in IMG/M
3300031719|Ga0306917_10769163All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300031754|Ga0307475_10141565All Organisms → cellular organisms → Bacteria1905Open in IMG/M
3300031820|Ga0307473_10983610All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300031962|Ga0307479_10217950All Organisms → cellular organisms → Bacteria1881Open in IMG/M
3300031962|Ga0307479_11372172All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium666Open in IMG/M
3300032001|Ga0306922_10591897All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300032770|Ga0335085_10287303All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1956Open in IMG/M
3300032782|Ga0335082_11493870All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300032783|Ga0335079_10551407Not Available1222Open in IMG/M
3300032805|Ga0335078_12366223All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300032892|Ga0335081_10169149All Organisms → cellular organisms → Bacteria3086Open in IMG/M
3300032898|Ga0335072_11557380Not Available560Open in IMG/M
3300032954|Ga0335083_10715389All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300032955|Ga0335076_11632729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil22.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.26%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.03%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.23%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.42%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.42%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.61%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.81%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Permafrost SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.81%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007819Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022508Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300025157Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes)EnvironmentalOpen in IMG/M
3300025501Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025812Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_089397502189573000Grass SoilISNEPQTVVHQVQQNVRDVAREVPGDDLDVPTFLRRQAQKA
JGI12635J15846_1061109513300001593Forest SoilGREMEEPMPRQQTLPNVVHQVQQNVRDVSHEVPADDLDVPTFLRRQAQKA*
JGI12635J15846_1066931823300001593Forest SoilEPPQQVNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA*
JGI12635J15846_1087000113300001593Forest SoilPPAQVVHHAQVQPPAREVHQDMDDLDVPTFLRRQAQKA*
Ga0066388_10006816843300005332Tropical Forest SoilEATSEPAPPQPQQQQLPNVVHQVQQNVRDIQPEVRADDLDVPTFLRRQAQKA*
Ga0066388_10257507733300005332Tropical Forest SoilREMPEPPMPVQPTLPNVVHQVHQNVRDVGAEVPADDLDVPTFLRRQAQKV*
Ga0070710_1080602723300005437Corn, Switchgrass And Miscanthus RhizospherePPAQVAPQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA*
Ga0066689_1018403023300005447SoilWKAAREERTVVEQVAHNVGEALHEVPLDDLDVPTFLRRQAQKA*
Ga0070706_10184454313300005467Corn, Switchgrass And Miscanthus RhizospherePPPANVVHQVQQNVQEVSREVPVDDLDVPTFLRRQAQKA*
Ga0070730_1044615413300005537Surface SoilVAPQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA*
Ga0070731_1009407413300005538Surface SoilQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA*
Ga0066704_1072516513300005557SoilEERTVVEQVAHNVGEALHEVPLDDLDVPTFLRRQAQKA*
Ga0066693_1032171623300005566SoilAGREMMEPPMPAIQQPANVVHQVQQSVCDVSQEVPTDDLDVPTFLRRQAQKA*
Ga0066708_1029921613300005576SoilANVVHQVQQSVCDVSQEVPTDDLDVPTFLRRQAQKA*
Ga0066654_1011835913300005587SoilVHEPANVVHQGQQNVRDVSPEVPPDDLDVPTFLRRQAQKA*
Ga0070764_1011029713300005712SoilQQQTLPNVVHQVQQNIRDVSREVPADDLDVPTFLRRQAQKA*
Ga0066903_10314633323300005764Tropical Forest SoilANVVHQVQQNVHEVSQEVPAVDDLDVPTFLRRQAQKV*
Ga0066651_1077205923300006031SoilKAGREIMEPPMQQPANVVHQVQQNVREVSPEVPADDLDVPTFLRRQAQKA*
Ga0097621_10194497223300006237Miscanthus RhizospherePNVVHQVQQNVRDVSRDVPADDLDVPTFLRRQAQKA*
Ga0079222_1010765833300006755Agricultural SoilVHQVQQNVREFSQEVPATDDLDVPTFLRRQAQKA*
Ga0079220_1044171613300006806Agricultural SoilMPDMPVQQALPNVVHQVQENVREVGQDVPSDDLDVPTFLRRHAQKA*
Ga0099793_1001615863300007258Vadose Zone SoilSVVHQVAQNVREVSPEVPKDDLDVPTFLRRQAQKA*
Ga0099793_1062078013300007258Vadose Zone SoilNVVHQVQQNVREVSQDVPSDDLDVPTFLRRQAQRA*
Ga0104322_13050033300007819Permafrost SoilPAPVVHHAQVPQPAREVHQDVDDLDVPTFLRRQAQKA*
Ga0066710_10486239613300009012Grasslands SoilMEPPMPAIQQPANVVHQVQQSVCDVSQEVPGDDLDVPTFLRRQAQKA
Ga0099829_1084667113300009038Vadose Zone SoilQSQHQPANVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA*
Ga0099829_1172158713300009038Vadose Zone SoilNVVHQVQQNVREVSQDVPSDDLDVPTFLRRQAQKA*
Ga0099830_1045633613300009088Vadose Zone SoilPEPPQSHHQPANVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA*
Ga0099830_1162202213300009088Vadose Zone SoilREIPEEPMHHATSNVVHQVQQNVREVSHEVPADDLDVPTFLRRQAQKA*
Ga0099830_1186879723300009088Vadose Zone SoilVVHQVQQNVREVSQDVPADDLDVPTFLRRQAQKA*
Ga0099827_1157497313300009090Vadose Zone SoilVVEQVAHNVGEALHEVPLDDLDVPTFLRRQAQKA*
Ga0126373_1084279113300010048Tropical Forest SoilPGPQPQPAAVVNQVQLESVRELSHEVPADDLDVPTFLRRQAQKA*
Ga0126373_1139088513300010048Tropical Forest SoilANAVQQQVSKNVREASPEVPKDDLDVPTFMRRQAQKA*
Ga0126378_1166939423300010361Tropical Forest SoilVVHQVAQNVREVAPEVPKDDLDVPTFLRRQAQKA*
Ga0126379_1185752513300010366Tropical Forest SoilPMQPANVVHQVQQNVRDVSPEVPADDLDVPTFLRRQAQKA*
Ga0126381_10359581213300010376Tropical Forest SoilMQPANVVHQVQQNVRDVSPEVPADDLDVPTFLRRQAQKA*
Ga0126350_1013369423300010880Boreal Forest SoilGREVEEPVPQQQTLPNVVHQVQQNVRDVSHEVPADDLDVPTFLRRQAQKA*
Ga0137389_1163013813300012096Vadose Zone SoilMQQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA*
Ga0137388_1095198713300012189Vadose Zone SoilQQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA*
Ga0137363_1006786033300012202Vadose Zone SoilEITEAPMQQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA*
Ga0137362_1108362013300012205Vadose Zone SoilESQTVVHQVQQNVRDVAQDVPADDLDVPTFLRRQAQKA*
Ga0137380_1013585513300012206Vadose Zone SoilVVHQVQQNVHDVGHDVPADDLDVPTFLRRQAQKA*
Ga0137380_1018145333300012206Vadose Zone SoilPDEPVQRAVPNVVHQVQQNVRDVSPDVPADDLDVPTFLRRQAQKA*
Ga0137360_1002853713300012361Vadose Zone SoilEEPVHHATSNVVHQVQQNVREVSHDVPVDDLDVPTFLRRQAQKA*
Ga0137360_1093651913300012361Vadose Zone SoilQANVVHQVQENVREVGREVPADDLDVPTFLRRHAQKA*
Ga0137361_1133843823300012362Vadose Zone SoilLPNVVHQVQQNVREVGQDVPSDDLDVPTFLRRQAQKA*
Ga0137390_1160083113300012363Vadose Zone SoilEQQTVVHQVQQNVRDVAREVPGDDLDVPTFLRRQAQKA*
Ga0137419_1095013713300012925Vadose Zone SoilSPQQQQLPNIVHQVQQNVRDVSHEVPADDLDVPTFLRRQAQKA*
Ga0137410_1009499313300012944Vadose Zone SoilTSNVVHQVQQNVREVSHEVPADDLDVPTFLRRQAQKA*
Ga0126369_1010405143300012971Tropical Forest SoilSPNAPNVVHQVTQTVREAAPEMPKDDLDVPTFLRRQAQKA*
Ga0134110_1013887013300012975Grasslands SoilVVHQVQQNVREVGQDVPADDLDVPTFLRRQAQKA*
Ga0157372_1053705313300013307Corn RhizospherePPPQPTPNVVHQVQENVREVSRETPAMDDLDVPTFLRRAQKA*
Ga0182015_1095029423300014495PalsaSRNVSEVVHQVARNVSDVREVPADDLDVPTFLRRQAQKA*
Ga0137403_1001617913300015264Vadose Zone SoilVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA*
Ga0182041_1035382233300016294SoilPPANAVQQQVSKNVREASPEVPKDDLDVPTFMRRQAQKA
Ga0187816_1010327013300017995Freshwater SedimentNVVHQVTQNVRESAHEVPKDDLDVPTFLRRQAQKA
Ga0187765_1065368813300018060Tropical PeatlandELPAPPPNVVHQVAQNVRDVAPEVPKDDLDVPTFLRRQAQKA
Ga0187772_1071408513300018085Tropical PeatlandGREVPMAPEQTNVVQQVAHNVADVAPEMAADDLDVPTFLRRQAKAGA
Ga0210407_1024958613300020579SoilVNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA
Ga0210407_1074584713300020579SoilNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA
Ga0210407_1091668313300020579SoilPQQVNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA
Ga0210403_1019211133300020580SoilSVVHQVAQNVREVSPEVPKDDLDVPTFLRRQAQKA
Ga0210399_1103549813300020581SoilLPEPPQQVNVVHQVQENVREVGREVPADDLDVPTFLRRHAQTA
Ga0210399_1153630213300020581SoilNVVHQVQQNIRDVSQDVPADDLDVPTFLRRQAQKA
Ga0210401_1055405913300020583SoilISDVPEPPQPQQHVNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA
Ga0210401_1086463813300020583SoilQQTNVVQQVSRNVADVRSEVPADDLDVPTFLRRQAQKA
Ga0215015_1006405313300021046SoilQPQQANVVHQVQENVREVGREVPADDLDVPTFLRRHAQKA
Ga0179596_1043102823300021086Vadose Zone SoilMPAQHDLPNVVHQVQQNVREVSQAVPSDDLDVPTFLRRQAQKA
Ga0210396_1000528813300021180SoilANVVHQVQQPVREVSREVPAVDDLDVPTFLRRQAQKA
Ga0210389_1150677013300021404SoilNIVHSQHAREVARDVAPEPSKDDLDVPTFLRRQAQKA
Ga0210387_1173727323300021405SoilEQPPAQVAPQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA
Ga0210394_1018354713300021420SoilAPPQTNVVQQVARNVSDVVPEMPSDDLDVPTFLRRQAKAGA
Ga0210394_1022888133300021420SoilPPANVVHQVQQPVREVSREVPAVDDLDVPTFLRRQAQKA
Ga0210384_1091323413300021432SoilAPQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA
Ga0210398_1040500843300021477SoilRNVNEVVHQVARNVSQVHEVPADDLDVPTFLRRQAQKA
Ga0210402_1054548933300021478SoilNAANVVHQVQQNIREVSHEVPADDLDVPTFLRRQAQKA
Ga0210402_1168993313300021478SoilKAGRDIPEAPVQQAPPNIVHQVQQNVREVNHDVPADDLDVPTFLRRQAQKA
Ga0222728_102606613300022508SoilQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA
Ga0224551_108496123300023259SoilVSEVVHQVARNVSDVREVPADDLDVPTFLRRQAQKA
Ga0209399_1039745813300025157Thermal SpringsVSARSNSSVVDEVTRNVSGLAHDVAADDLDVPTFLRRQASKA
Ga0208563_102436913300025501PeatlandNVVHQVAQNVREAAQEVPKDDLDVPTFLRRQAQKA
Ga0208457_104937413300025812PeatlandNVVHQVAQNVRDAAQEVPKDDLDVPTFLRRQAQKA
Ga0207707_1020721433300025912Corn RhizosphereNVVHQVQQNVRDVSRDVPADDLDVPTFLRRQAQKA
Ga0207665_1016642933300025939Corn, Switchgrass And Miscanthus RhizosphereSESQTVVHQVQQNVRDVAQDVPADDLDVPTFLRRQAQKA
Ga0207665_1066358633300025939Corn, Switchgrass And Miscanthus RhizosphereKVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA
Ga0207665_1153882823300025939Corn, Switchgrass And Miscanthus RhizosphereHEVNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA
Ga0207703_1080542523300026035Switchgrass RhizosphereVVHEAPQTVVHQVQQNVRDVAHEVPADDLDVPTFLRRQATQKA
Ga0209267_111722133300026331SoilKTWKAGREIPDMPMQQALPNAVHQVQQSVREVSPDVPADDLDVPTFLRRQAQKA
Ga0209057_108026933300026342SoilEPPMPAIQQSANVVHQVQQSVCDVSQEVPTDDLDVPTFLRRQAQKA
Ga0209524_112445423300027521Forest SoilQKPSFLPKTWKAGREVAEEPPPQPPNVVHQVQQNVPEVSREVPAPVDDLDVPTFLRRQAQKA
Ga0209329_103389443300027605Forest SoilPANVVHQVQQNVREVSREVPAVDDLDIPTFLRRQAQKA
Ga0209076_106013713300027643Vadose Zone SoilMHHATSNVVHQVQQNVREVSHEVPADDLDVPTFLRRQAQKA
Ga0209736_118532113300027660Forest SoilWKAGREVAEEPPPQPPNVVHQVQQNVPEVSREVPAPVDDLDVPTFLRRQAQKA
Ga0209588_108584113300027671Vadose Zone SoilHQANVVHQVQENVREVGREVPADDLDVPTFLRRHAQKA
Ga0209011_106350713300027678Forest SoilQQPHQQANVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA
Ga0209447_1001078143300027701Bog Forest SoilQQLPNVVHQVNENVREVSREVSREVPSDDLDVPTFMRRQAQKA
Ga0209180_1003262413300027846Vadose Zone SoilEITEAPMQQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA
Ga0209166_1034712323300027857Surface SoilEPPQQQPQQQANVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA
Ga0209283_1005762433300027875Vadose Zone SoilPMQQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA
Ga0209283_1017592223300027875Vadose Zone SoilMQQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA
Ga0209006_1061707913300027908Forest SoilVPNVVHQVQENVRDVSRDTPAMDDLDVPTFLRRAQKA
Ga0209526_1036650413300028047Forest SoilPAHVAPQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA
Ga0137415_1057165523300028536Vadose Zone SoilQPHEVNIVHQVQENVREVAREVPADDLDVPTFLRRHAQKA
Ga0302224_1007130133300028759PalsaSEVVHQVARNVSDVREVPADDLDVPTFLRRQAQKA
Ga0222749_1009386813300029636SoilPNIVHQVQQNIREVNHEVPADDLDVPTFLRRQAQKA
Ga0311355_1001991413300030580PalsaVSRNVSEVVHQVARNVSDVREVPADDLDVPTFLRRQAQKA
Ga0302324_10039434733300031236PalsaPNVVHHQVHENVREVSREVNREVPSDDLDVPTFMRRQAQKA
Ga0318516_1027849823300031543SoilLQPPANAVQQVSKNVREASPEVPKDDLDVPTFLRRQAQKA
Ga0310915_1081389523300031573SoilSIVNQVKQNVREVAPETHKDDLDVPTFLRRQAQKA
Ga0306917_1076916323300031719SoilGNVVHQVAKNVREAAPEAPKDDLDVPTFLRRQAQKA
Ga0307475_1014156513300031754Hardwood Forest SoilPPQQVNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA
Ga0307473_1098361013300031820Hardwood Forest SoilSNEQQTVVHQVQQNVRDVAREVPGDDLDVPTFLRRQAQKA
Ga0307479_1021795013300031962Hardwood Forest SoilGRDVPEPPQPPQQANIVHEVQENVREVGREVPADDLDVPTFLRRHAQKA
Ga0307479_1137217213300031962Hardwood Forest SoilQTVVHQVQQNVRDVAREVPGADLDVPTFLRRQAQKA
Ga0306922_1059189713300032001SoilPPANVVHQVAKNVREASPEVPKDDLDVPTFLRRQAQKA
Ga0335085_1028730313300032770SoilGAPLAQQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA
Ga0335082_1149387023300032782SoilPLAQQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA
Ga0335079_1055140723300032783SoilPSVVHQVAQNVRESAHEMPKDDLDVPTFLRRQAQKA
Ga0335078_1236622323300032805SoilAAPPNVVHQVAQNVRETAHEVPKDDLDVPTFLRRQAQKA
Ga0335081_1016914913300032892SoilVVQQVSRNVGDVLPEMPADDLDVPTFLRRQAHKAGA
Ga0335072_1155738023300032898SoilPNVVNQVKQNVREVREVTPEVAKDDLDVPTFLRRQAQKA
Ga0335083_1071538923300032954SoilWKVEPEIAEAEPAPPPPQQVPNVVHQVQENVREVSREAAMDDLDVPTFLRRAQKA
Ga0335076_1163272913300032955SoilPPPQQVPNVVHQVQENVREVSREAAMDDLDVPTFLRRAQKA
Ga0335077_1156923913300033158SoilQELPVAPPNVVHQVAQNVREVAPDVPKDDLDVPTFLRRQAQKA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.