NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068882

Metagenome / Metatranscriptome Family F068882

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068882
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 52 residues
Representative Sequence HAYARAAFYAGLAAWAWGELAGGVNWVRRALGAAGLVYVVVKVGAALGA
Number of Associated Samples 105
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 10.48 %
% of genes near scaffold ends (potentially truncated) 83.87 %
% of genes from short scaffolds (< 2000 bps) 95.16 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.71

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.452 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.290 % of family members)
Environment Ontology (ENVO) Unclassified
(40.323 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(55.645 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.84%    β-sheet: 0.00%    Coil/Unstructured: 44.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.71
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
f.72.1.1: Double antiporter-like subunits from respiratory complex Id3rkol_3rko0.80171
f.63.1.1: Claudind3jbre_3jbr0.79584
f.73.2.1: Respiratory complex I subunit NuoJ-liked4he8j_4he80.79524
f.13.1.0: automated matchesd5c1ma_5c1m0.78763
f.56.1.0: automated matchesd4al0a_4al00.78647


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF04248NTP_transf_9 21.77
PF13561adh_short_C2 2.42
PF00072Response_reg 1.61
PF028262-Hacid_dh_C 1.61
PF07080DUF1348 1.61
PF01872RibD_C 1.61
PF14026DUF4242 1.61
PF13191AAA_16 0.81
PF02909TetR_C_1 0.81
PF00583Acetyltransf_1 0.81
PF05222AlaDh_PNT_N 0.81
PF12680SnoaL_2 0.81
PF10057MpsC 0.81
PF02771Acyl-CoA_dh_N 0.81
PF02607B12-binding_2 0.81
PF00211Guanylate_cyc 0.81
PF04389Peptidase_M28 0.81
PF04072LCM 0.81
PF06724DUF1206 0.81
PF07110EthD 0.81
PF06348DUF1059 0.81
PF00313CSD 0.81
PF00296Bac_luciferase 0.81
PF07687M20_dimer 0.81
PF12681Glyoxalase_2 0.81
PF01553Acyltransferase 0.81
PF10442FIST_C 0.81
PF00857Isochorismatase 0.81
PF01047MarR 0.81
PF00112Peptidase_C1 0.81
PF01542HCV_core 0.81
PF00561Abhydrolase_1 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG2343Uncharacterized conserved protein, DUF427 familyFunction unknown [S] 21.77
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 1.61
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 1.61
COG3558Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamilyFunction unknown [S] 1.61
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.81
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.81
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.81
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.81
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.81
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.81
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.45 %
UnclassifiedrootN/A18.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111000|2209921816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium508Open in IMG/M
3300000955|JGI1027J12803_106439161Not Available841Open in IMG/M
3300000955|JGI1027J12803_107846675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1040Open in IMG/M
3300000956|JGI10216J12902_112970001All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300001305|C688J14111_10304830Not Available505Open in IMG/M
3300001686|C688J18823_10822160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales590Open in IMG/M
3300002568|C688J35102_117969500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300002568|C688J35102_118316374Not Available548Open in IMG/M
3300004081|Ga0063454_100396296Not Available921Open in IMG/M
3300004081|Ga0063454_101871566All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300004153|Ga0063455_101221406All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300004153|Ga0063455_101624878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium510Open in IMG/M
3300005327|Ga0070658_11593568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300005344|Ga0070661_101472605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300005347|Ga0070668_102117866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales519Open in IMG/M
3300005367|Ga0070667_100764708All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300005438|Ga0070701_11169528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium544Open in IMG/M
3300005441|Ga0070700_101056340Not Available671Open in IMG/M
3300005441|Ga0070700_101586400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium cosmicum559Open in IMG/M
3300005466|Ga0070685_10275219All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300005544|Ga0070686_100387260All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300005549|Ga0070704_100159785All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300005564|Ga0070664_100993366All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300005578|Ga0068854_102049601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300005587|Ga0066654_10319334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales838Open in IMG/M
3300005615|Ga0070702_101698296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300005719|Ga0068861_100562385All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300005719|Ga0068861_102101208All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300005834|Ga0068851_10801663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium585Open in IMG/M
3300005840|Ga0068870_11222311All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006034|Ga0066656_10449115All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300006058|Ga0075432_10300106All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300006358|Ga0068871_101683729All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300006797|Ga0066659_11221906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales627Open in IMG/M
3300006852|Ga0075433_10930596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales758Open in IMG/M
3300006954|Ga0079219_10487435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300009094|Ga0111539_10340406All Organisms → cellular organisms → Bacteria1746Open in IMG/M
3300009094|Ga0111539_11316733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium838Open in IMG/M
3300009098|Ga0105245_13230067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium505Open in IMG/M
3300009148|Ga0105243_11239621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria761Open in IMG/M
3300009156|Ga0111538_10404182All Organisms → cellular organisms → Bacteria1730Open in IMG/M
3300009177|Ga0105248_11547677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria751Open in IMG/M
3300009177|Ga0105248_13038217Not Available534Open in IMG/M
3300009789|Ga0126307_10260947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1393Open in IMG/M
3300010037|Ga0126304_10400278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria917Open in IMG/M
3300010042|Ga0126314_11287808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300010147|Ga0126319_1258596All Organisms → cellular organisms → Bacteria → Terrabacteria group1544Open in IMG/M
3300010301|Ga0134070_10190234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium749Open in IMG/M
3300010304|Ga0134088_10294714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium783Open in IMG/M
3300010371|Ga0134125_11889144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300010375|Ga0105239_12165553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300010375|Ga0105239_13289364All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300010399|Ga0134127_11384468Not Available774Open in IMG/M
3300011119|Ga0105246_12242407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300012045|Ga0136623_10201362All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300012093|Ga0136632_10253103Not Available797Open in IMG/M
3300012186|Ga0136620_10133878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1126Open in IMG/M
3300012187|Ga0136622_10119498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1117Open in IMG/M
3300012188|Ga0136618_10126377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1124Open in IMG/M
3300012200|Ga0137382_10167584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1497Open in IMG/M
3300012200|Ga0137382_10744685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300012212|Ga0150985_110933008Not Available587Open in IMG/M
3300012212|Ga0150985_120193328Not Available567Open in IMG/M
3300012350|Ga0137372_11059690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300012469|Ga0150984_118051129Not Available1110Open in IMG/M
3300012469|Ga0150984_120156639All Organisms → cellular organisms → Bacteria → Terrabacteria group573Open in IMG/M
3300012469|Ga0150984_123536228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria935Open in IMG/M
3300012680|Ga0136612_10000935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11814Open in IMG/M
3300012683|Ga0137398_11039839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae566Open in IMG/M
3300012961|Ga0164302_11625050Not Available538Open in IMG/M
3300012977|Ga0134087_10485365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300012987|Ga0164307_10983518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300012988|Ga0164306_10701317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum804Open in IMG/M
3300013306|Ga0163162_11805529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria699Open in IMG/M
3300013307|Ga0157372_11053624Not Available941Open in IMG/M
3300013308|Ga0157375_11331727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria845Open in IMG/M
3300014157|Ga0134078_10687811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300014325|Ga0163163_11249898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300015371|Ga0132258_10836297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2322Open in IMG/M
3300015372|Ga0132256_100985414Not Available958Open in IMG/M
3300017789|Ga0136617_11095002All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300017792|Ga0163161_11235639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300018081|Ga0184625_10040494All Organisms → cellular organisms → Bacteria2312Open in IMG/M
3300018429|Ga0190272_10038821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2658Open in IMG/M
3300018429|Ga0190272_11435620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300018432|Ga0190275_10243150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1731Open in IMG/M
3300018469|Ga0190270_10515743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1143Open in IMG/M
3300018469|Ga0190270_11957288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae644Open in IMG/M
3300018891|Ga0193610_1148451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300018920|Ga0190273_10652892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300018920|Ga0190273_12284221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300024055|Ga0247794_10109738All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300025908|Ga0207643_10258043All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300025908|Ga0207643_10917039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae567Open in IMG/M
3300025927|Ga0207687_11030933Not Available706Open in IMG/M
3300025932|Ga0207690_10285809All Organisms → cellular organisms → Bacteria → Proteobacteria1286Open in IMG/M
3300025941|Ga0207711_11708160Not Available573Open in IMG/M
3300025961|Ga0207712_11510807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes rishiriensis602Open in IMG/M
3300025961|Ga0207712_12028187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300025972|Ga0207668_11277174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes rishiriensis661Open in IMG/M
3300026035|Ga0207703_11741116Not Available599Open in IMG/M
3300026035|Ga0207703_11780426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300026075|Ga0207708_10396583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1140Open in IMG/M
3300026118|Ga0207675_100071457All Organisms → cellular organisms → Bacteria3245Open in IMG/M
3300026121|Ga0207683_10900053All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300027907|Ga0207428_10825720Not Available658Open in IMG/M
3300028379|Ga0268266_11454320All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300028381|Ga0268264_11141473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes rishiriensis788Open in IMG/M
3300028755|Ga0307316_10181570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium755Open in IMG/M
3300028791|Ga0307290_10351392Not Available540Open in IMG/M
3300028824|Ga0307310_10325810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium752Open in IMG/M
3300030336|Ga0247826_11039538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium652Open in IMG/M
3300031824|Ga0307413_11074480Not Available694Open in IMG/M
3300031873|Ga0315297_10391541Not Available1165Open in IMG/M
3300031901|Ga0307406_11836141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300031938|Ga0308175_102583883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300031939|Ga0308174_10825231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300031996|Ga0308176_10389906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1387Open in IMG/M
3300032080|Ga0326721_10412558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300032126|Ga0307415_101438698Not Available657Open in IMG/M
3300033551|Ga0247830_10624161All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300034006|Ga0334934_000685All Organisms → cellular organisms → Bacteria7484Open in IMG/M
3300034149|Ga0364929_0290344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300034384|Ga0372946_0568249Not Available549Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil6.45%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand5.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere4.03%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.23%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.23%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.42%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.61%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.61%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.61%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.81%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.81%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111000Soil microbial communities from Colorado Plateau, Greene Butte sample - Dark Crust, Colorado Plateau, Green ButteEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012187Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)EnvironmentalOpen in IMG/M
3300012188Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018891Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 18 hrs after wetting v1EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034006Biocrust microbial communities from Mojave Desert, California, United States - 30SMCEnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22100703822209111000SoilAAVTDGSARAYARAVFYAALAAWAWQELVGGVNWVRRAIGAAGLVYVVAKLATALGG
JGI1027J12803_10643916123300000955SoilAAFFTALAAWAWGEMATGANWVRRALGVAGLVYVVVKVGLALGA*
JGI1027J12803_10784667523300000955SoilWAWGEMAAGTNWVRRALGVAGLVYVVIKVGVALGA*
JGI10216J12902_11297000133300000956SoilATFYTGLAAWAWQELEDGVNWARRAIGAAGLIFVIARIAEALRT*
C688J14111_1030483023300001305SoilAVFYAGLAVWGWKELEDGANWLRRALGVGGVAYVVVKLGAALGG*
C688J18823_1082216023300001686SoilAPLLVALGGWVVAAVTHGSVHAYARAVFYAGLAVWGWKELEDGANWLRRALGVGGVAYVVVKLGAALGG*
C688J35102_11796950013300002568SoilVAAVSHGSVHSYARAAFYVGLAAWAWLELADGTNWARRVLGAAGLVYVVITIEAALAG*
C688J35102_11831637413300002568SoilHAYSRAAFYAALAAWAWAEAASGDNWFRRALGVGGLFYVIAKLAVAFGA*
Ga0063454_10039629623300004081SoilHAYARATFYTGLAAWAWIELTDGTNRFRRALGAVGLVYVVIKVGVALGA*
Ga0063454_10187156623300004081SoilAGLIVAALTDDPVRPYAHGVFYAGLAAWGYEELTAGANWFRRALGAGGLVYVVIRVGTALKS*
Ga0063455_10122140613300004153SoilGLAAWAWIELADGTNWFRRALGAGGLVYVVMKVGVALGA*
Ga0063455_10162487813300004153SoilHAYARSLFYAGLAVWAWEELVSGANWVRRALGAAGFVYVVAKLGAALGA*
Ga0070658_1159356813300005327Corn RhizosphereALGGWLAAVLTNGSSHAYARATFYSGLAAWAWEELADGTNWLRRAFGAAGLAYVIVKVGHALGA*
Ga0070661_10147260513300005344Corn RhizosphereMTDGSVHAYARAAFYAGLAAWAWEELVSGVNWVRRALGAGGLIYVVAKIAAALRA*
Ga0070668_10211786613300005347Switchgrass RhizosphereDALHDYARAAFYAGLAAWAWDELADGANWVRRALGAAGLVYVVVKVGAALGA*
Ga0070667_10076470823300005367Switchgrass RhizosphereGWLLAELTDGSVHAYARATFYAGLAAWAWEELAGGVNWVRRAFGLGGLVYVVVKVGEALGA*
Ga0070701_1116952813300005438Corn, Switchgrass And Miscanthus RhizosphereRAIAVMTDGSVHAYARAAFYAGLAAWATEELVSGLNWVRRALGAAGLIYVVNKVAAALRA
Ga0070700_10105634013300005441Corn, Switchgrass And Miscanthus RhizosphereAWAWAWAWAELVSGVNWVRRAIGAAGLVYVAGRVGAALEG*
Ga0070700_10158640013300005441Corn, Switchgrass And Miscanthus RhizosphereMTDGSVHAYARAAFYAGLAAWAWEELVSGVNWMRRALGAGGLIYVVAKIAAALRA*
Ga0070685_1027521913300005466Switchgrass RhizosphereALAGWLLAELTDGSVHAYARATFYAGLAAWAWEELAGGVNWVRRAFGLGGLVYVVVKVGEALGA*
Ga0070686_10038726013300005544Switchgrass RhizosphereAATDGSIHAYARSVFCAGLAVWAWEELVGGANWFRRALGAAGLVYVVVKLGAAFGA*
Ga0070704_10015978533300005549Corn, Switchgrass And Miscanthus RhizosphereALGGWLVAALTHGSVHAYARAAFYAGLTAWAWEELAEGVNWVRRALGAAGLVYVVVKVGAALGA*
Ga0070664_10099336633300005564Corn RhizosphereMTDGSVHAYARAAFYAGLAAWATEELVSGLNWVRRALGAAGLIYVVNKVAAALRA*
Ga0068854_10204960113300005578Corn RhizosphereGWLVAALTHGSVHAYARAAFYAGLTAWAWEELAEGVNWVRRALGAAGLVYVVVKVGAALGA*
Ga0066654_1031933423300005587SoilVALSGWLLAELTEGSVHFYARGAFYAALGVWAWEEATAGANWARRLLGAAGLVYVVVQIGLALGA*
Ga0070702_10169829613300005615Corn, Switchgrass And Miscanthus RhizosphereAYARAVFYAALAVWAWEELASGVNWARRVLGAAGLVFVVLRIGAALGG*
Ga0068861_10056238513300005719Switchgrass RhizosphereAAMTDGSVHAYARAAFYAGLAAWAWEELVSGVNWMRRALGAGGLIYVVAKIAAALRA*
Ga0068861_10210120813300005719Switchgrass RhizosphereYTALAAWAWTELADGTNWFRRALGAGGLVYVVIKIGVALGA*
Ga0068851_1080166313300005834Corn RhizosphereHAYARAAFYAGLAAWATEELVSGLNWVRRALGAGGLIYVVGKLAAALRA*
Ga0068870_1122231123300005840Miscanthus RhizosphereGLAAWAWEELTGGVNWLRRTFGAAGLVYVVVSIGAALKA*
Ga0066656_1044911513300006034SoilGLAAWAWEELTGGANWVRRALGVGGLIYVVVKVGAALGA*
Ga0075432_1030010613300006058Populus RhizosphereIHAYARSVFYAGLAVWAWEELVSGANWFRRSLGAAGLVYVVAKLGAAFAA*
Ga0068871_10168372923300006358Miscanthus RhizosphereVHAYARAAFYAGLTAWAWEELAEGVNWVRRALGAAGLVYVVVKVGAALGA*
Ga0066659_1122190623300006797SoilFYAGLAAWAWEELAGGVNWVRRSLGAAGLVYVVVKVGAALGA*
Ga0075433_1093059613300006852Populus RhizosphereRAAFYAGLSAWAWEELAGGVNWVRRALGAAGLVYVVVKVGAALGA*
Ga0079219_1048743523300006954Agricultural SoilVHFYARGAFYAALGVWAWEEVAAGANWARRLLGAAGLVYVVVKIGLALGA*
Ga0111539_1034040633300009094Populus RhizosphereWAWEELTGGVNWLRRVFGATGLIYVVVRIGSALDA*
Ga0111539_1131673323300009094Populus RhizosphereVALAGLLVAAVTDGSAHAYARAVFYAALAVWAWEELASGVNWARRVLGAAGLVFVVLRIGAALGG*
Ga0105245_1323006723300009098Miscanthus RhizosphereVALVGRAIAVMTDGSVHAYARAAFYAGLAAWAWEELVSGLNWVRRALGAAGLIYVAETVATALRA*
Ga0105243_1123962123300009148Miscanthus RhizosphereVALAGLLVSAVTDGSAHAYARAVFYAALAVWAWEELASGVNWARRVLGAAGLVFVVLRIGAALGG*
Ga0111538_1040418213300009156Populus RhizosphereAWAWEELAEGVNWVRRALGAAGLVYVVVKVGAALGA*
Ga0105248_1154767713300009177Switchgrass RhizosphereYAGLTAWAWEELAEGVNWVRRALGAAGLVYVVVKVGAALGA*
Ga0105248_1303821713300009177Switchgrass RhizosphereGWLVAALTDGSVHSYARAVFYAGLAIWAWEELVGGANWVRRALGAGGLFYVVVKVGAA*
Ga0126307_1026094733300009789Serpentine SoilGAWAWEELAGGVNWVRRVVGAGGLVYVVLRIGGELAGD*
Ga0126304_1040027833300010037Serpentine SoilLPNAPLWVALGGRTIAVMTGGSVHAYARAAFYAGLAAWAWEELVSGVNWVRRALGAAGLLYVVDKVAAALRA*
Ga0126314_1128780813300010042Serpentine SoilAHAYARAMFYAALGAWAWEELAGGVNWVRRVVGAGGLVYVVLRIGGELAGD*
Ga0126319_125859623300010147SoilGASLLASLTTGSVHFYARAAFYTGLAAWAWGELAAGANWARRALGAGGLVYLVVNLGIALGA*
Ga0134070_1019023413300010301Grasslands SoilTHGSAHAYARSTFYTGLAAWAWKEVADGTTWFRRVLGAGGLVYVVIKVGVALGA*
Ga0134088_1029471413300010304Grasslands SoilTFYTGLAAWAWKEVADGTTWFRRVLGAGGLVYVVIKVGVALGT*
Ga0134125_1188914423300010371Terrestrial SoilMTDGSVHAYARAAFYAGLAAWATEELVSGLNWVRRALGAGGLIYVVDKLAAALRA*
Ga0105239_1216555323300010375Corn RhizosphereLPNAPLWVALGGRAIAVMTDGSVHAYARAAFYAGLAAWAWDELVSGVNWVRRALGAAGLIYVAETVATALRA*
Ga0105239_1328936423300010375Corn RhizosphereHAYARATFYAGLAAWAWEELAGGVNWVRRAFGLGGLVYVVVKVGEALGA*
Ga0134127_1138446813300010399Terrestrial SoilAAMTDGSVHAYARAAFYAGLAAWATEELVSGLNWVRRALGAAGLIYVVNKVAAALRA*
Ga0105246_1224240723300011119Miscanthus RhizosphereMTDGSVHAYARAAFYAGLAAWATEELVSGLNWVRRALGAGGLIYVVGKLAAALRA*
Ga0136623_1020136213300012045Polar Desert SandAGLAAWAWTELAGGVNWVRRALGCAGLVYVVIKIGAALRA*
Ga0136632_1025310323300012093Polar Desert SandSVHAHAAFYAGLAAWAWTELAGGVNWVRRALGCAGLVYVVIKIGAALRA*
Ga0136620_1013387813300012186Polar Desert SandLPNAPLWVALGGRAIAVMTDGSVHAYACAAFYAGLAAWAWAELVSGVNWVRRALGAGGLIYVVDKVAAALRA*
Ga0136622_1011949823300012187Polar Desert SandLPNAPLWVALGGRAIAVMTDGSVHAYARAAFYAGLAAWAWAELVSGVNWVRRALGAGGLIYVVDKVAAALRA*
Ga0136618_1012637713300012188Polar Desert SandVMTDGSVHAYARAAFYAGLAAWAWAELVSGVNWVRRALGAGGLIYVVDKVAAALRA*
Ga0137382_1016758423300012200Vadose Zone SoilMDGPVHSYARAVFYAGLAGWAWEELLDGANWVRRALGAGGLVYVVVKVGAALGA*
Ga0137382_1074468523300012200Vadose Zone SoilHAYARAVFYAGLAAWAWEELAGGANWVRRALGAGGLVYVVVKVGAALGA*
Ga0150985_11093300823300012212Avena Fatua RhizosphereVAGLTAGSTHAYTRMTFYTGLAAWASIDLAVGANWYRRPLCAGGLVCVVVKVGDALGA*
Ga0150985_12019332813300012212Avena Fatua RhizosphereLFYAALAAWAWEELVGGANRVRRALGAAGFIYVVAKLGAALGA*
Ga0137372_1105969023300012350Vadose Zone SoilGLAAWAWEELTGGANWVRRALGAGGLFYVVVKVAAALGA*
Ga0150984_11805112943300012469Avena Fatua RhizosphereAWEEVSDGANWARRLLGAAGLVYVIAKVGAALSS*
Ga0150984_12015663923300012469Avena Fatua RhizosphereYVGLSAWGWEEVASGANWVRRSFGAAGLVYVIVEVGRAL*
Ga0150984_12353622833300012469Avena Fatua RhizosphereLVAAATHGSVHAYARSLFYAGLGAWAWEEPVSGANWVRRALGAAGFIYVVAKLGVALEA*
Ga0136612_1000093573300012680Polar Desert SandLPNAPLWVALGGQLVAEMTDGSVHAYARAAFYAGLAAWAWEELVSGVNWVRRALGAGGLIYVVDKVAAALRA*
Ga0137398_1103983923300012683Vadose Zone SoilAFFTALAAWAWGEVADGANWVRRALGVAGLVYVVIKVGMALGA*
Ga0164302_1162505013300012961SoilAYARAVFYAGLAAWAWAELIDGVNWVRRAIGAAGLVHVVARVGAGSKGDAW*
Ga0134087_1048536523300012977Grasslands SoilWAWKEVADGTTWFRRVLGAGGLVYVVIKVGVALGA*
Ga0164307_1098351823300012987SoilAGLTAWAWEELTGGVNWVRRALGAAGLVYVVVKVGAALGA*
Ga0164306_1070131733300012988SoilYVALTAWAWEEVTSGVNWARRLIGAAGLVFVVLRVGAALGA*
Ga0163162_1180552913300013306Switchgrass RhizosphereVGRAIAVMTDGSVHAYARAAFYAGLAAWATEELVSGLNWVRRALGAAGLIYVVNKVAAALRA*
Ga0157372_1105362423300013307Corn RhizosphereLWVALGGRAIAVMTDGSVHAYARAAFYAGLAAWAWAELVSGVNWVRRALGAAGLIYVAETVATALRA*
Ga0157375_1133172723300013308Miscanthus RhizosphereAGLLVAAATSGSVHAYARGVFYAGLAAWASEELIGGVNWVRRAIGAAGLVYVVARVGAALEG*
Ga0134078_1068781113300014157Grasslands SoilPLLAALGGWVIAELTDGSSHAYARAAFCVALAAWAWEELANGANWVRRALGAGGLLYVVVKVGAALGA*
Ga0163163_1124989813300014325Switchgrass RhizosphereRAAFYAGLTAWAWEELAEGVNWVRRALGAAGLVYVVVKVGAALGA*
Ga0132258_1083629723300015371Arabidopsis RhizosphereMGVEELTEGVNWVRRALGAAGLVYVVAKVGAALGA*
Ga0132256_10098541413300015372Arabidopsis RhizosphereYVGLAAWAWGELASGVNWVRRALGAGGLGYVVVKLGAAFGG*
Ga0136617_1109500223300017789Polar Desert SandLAAWAWTELAGGVNWVRRALGCAGLVYVVIKIGAALRA
Ga0163161_1123563923300017792Switchgrass RhizosphereAAFYAGLAAWASEELIGGVNWVRRAIGAAGLVYVVARVGAALEG
Ga0184625_1004049423300018081Groundwater SedimentMGGWLVAALTDGAVHSYARAAFYVGLAAWAWEELAGGVNWVRRALGAGGLVYVVVKVGAALGA
Ga0190272_1003882153300018429SoilVAQLPNAPLWVAFGGRAIAVMTDGSVHAYARAAFYAGLAAWAREELVSGVNWVRRALGAAGLIYVVDKVAEALRV
Ga0190272_1143562033300018429SoilNPQLWLALAGWVVALPTDGSVHAYARAAFYAGLAAWGLGELTSGINLARRAMGAAGLLYAVVKVADALGA
Ga0190275_1024315023300018432SoilVAAVTDGSVHSYARAAFYTGIAAWAWDELAGGANWVRRALGGAGLLYVVVKVATALGA
Ga0190270_1051574323300018469SoilAYARAVFYAALAAWAWQEMATGVNWARRLLGAAGLLLVVVRVGAAL
Ga0190270_1195728823300018469SoilTDGSVHAYARAAFYAGLAAWAWEELVSGVNWVRRALGAGGLIYVVVKVAAALRA
Ga0193610_114845113300018891SoilVVADGSVHAYARGLFYAALAAWAWQELVDGVNWVRRAIGAAGLVYVVVQVGAVVGG
Ga0190273_1065289223300018920SoilSVHSYARAAFYAGLAAWAWEEVVSGVNWVRRALGAGGLIYVVDKVAEALRV
Ga0190273_1228422113300018920SoilVWVALGGGAIAVMTDGSGQAYARAVFYAGLAVWAGEELVSGVNWVRRALGAGGLIYVVDKVAAALRA
Ga0247794_1010973813300024055SoilAAATHGSVHAYARSLFYAGFAAWAWEELVSGANWVRRALGAAGFIYVVAKLGVALEA
Ga0207643_1025804313300025908Miscanthus RhizosphereVALVGRAIAVMTDGSVHAYARAAFYAGLAAWATEELVSGLNWVRRALGAAGLIYVVNKVAAALRA
Ga0207643_1091703913300025908Miscanthus RhizosphereAAATDGSIHAYARSVFCAGLAVWAWEELVSGANWFRRALGVAGLVYVVAKLGAAFGA
Ga0207687_1103093323300025927Miscanthus RhizosphereALFYAGFAAWAWEELFSGANWVRRALGAAGFIYVVAKLGVALEA
Ga0207690_1028580933300025932Corn RhizosphereRAAFYAGLAAWAWDELADGANWVRRALGAAGLVYVVVKVGAALGA
Ga0207711_1170816013300025941Switchgrass RhizosphereSYARAVFYAGLAIWAWEELVGGANWVRRALGAGGLFYVVVKVGAA
Ga0207712_1151080713300025961Switchgrass RhizosphereHAYARAAFYAGLAAWAWGELAGGVNWVRRALGAAGLVYVVVKVGAALGA
Ga0207712_1202818713300025961Switchgrass RhizosphereDGSIHAYARAVFCAGLAVWAWEELVSGANWFRRALGAAGLVYVVVKLGAAFGA
Ga0207668_1127717423300025972Switchgrass RhizosphereLAAWAWGELAGGVNWVRRALGAAGLVYVVVKVGAALGA
Ga0207703_1174111613300026035Switchgrass RhizosphereTHGSVHAYARSLFYAGFAAWAWEELFSGANWVRRALGAAGFIYVVAKLGVALQA
Ga0207703_1178042623300026035Switchgrass RhizosphereAYARAVFYAGLAAWAWGELAGGVNWVRRALGAAGLVYVVVKVGAALGA
Ga0207708_1039658333300026075Corn, Switchgrass And Miscanthus RhizosphereVLTEGSAHAYARATFYTGLAAWAWLELADGTNWFRRALGAGGLVYVVMKVGVALGA
Ga0207675_10007145713300026118Switchgrass RhizosphereWAWEELTDGVNWLRRTVGAAGLAYAVVSIGSALKG
Ga0207683_1090005323300026121Miscanthus RhizosphereVAEATGDGAHDYARAVFYAGLTVWAWEELTDGDNLLRRALGAGGLAYVVAKVGAAL
Ga0207428_1082572023300027907Populus RhizosphereYARSVFYAGLAVWAWEELVSGANWFRRSLGAAGLVYVVAKLGAAFAA
Ga0268266_1145432023300028379Switchgrass RhizosphereVFLAGLAAWAWEELTGGVNWFRRVVGAAGLVYVVVSIGSALKR
Ga0268264_1114147323300028381Switchgrass RhizosphereAYARAAFYAGLAAWAWGELAGGVNWVRRALGAAGLVYVVVKVGAALGA
Ga0307316_1018157033300028755SoilTDGSLHFYARAVFYAGLAAWAWLELADGANWVRRALGAGGLVYVVVKVGAALGA
Ga0307290_1035139213300028791SoilFYAGLAAWAWEELAGGVNWVRRALGAGGLVYVVVKVGAALGA
Ga0307310_1032581013300028824SoilAALTDGSAHAYARAAFYAGLAAWAWEELAGGVNWVRRALGAGGLVYVVLKVGAAL
Ga0247826_1103953823300030336SoilPNAPLTVALGAWLVAALTNDAIHDYARAAFYAGLAAWAWGELAGGVNWVRRALGAAGLVYVVVKVGAALGA
Ga0307413_1107448013300031824RhizosphereSVHAYARAAFYAGLAAWAWQELVSGVNWVRRALGAAGLIYVVDKAAAALRA
Ga0315297_1039154113300031873SedimentLVAALTEGSVHAYARAVFYAGLAAWAWEELAGGANWVRRALGAGGLIYVVAKVGAALGA
Ga0307406_1183614123300031901RhizosphereALAAFYAGLAAWAWEELVSGVNWVRRALGAGGLIYVVDKAAAALRA
Ga0308175_10258388313300031938SoilAAWAWEELAGGVNWVRRALGCAGLVYVVVKIGAALRA
Ga0308174_1082523133300031939SoilVHAYARATFYTGLAAWAWLELTDGTNWFRRGLGAGGLVYVVIQVGAALGA
Ga0308176_1038990613300031996SoilLVALGGWLVAALADGSAHAYARATFYTGLAAWAWEELADGTNGLRRAFGAAGLGYVIVKVGHALGA
Ga0326721_1041255813300032080SoilARSLFYAGLAAWAWEEMVSGANWVRRALGAAGFIYVVAKLGAAFGA
Ga0307415_10143869813300032126RhizosphereAYARSLFYAGLAAWAWEEVVSGANWVRRALGAAGFIYVVAKLGAALGA
Ga0247830_1062416113300033551SoilAVMTDGSVHAYARAAFYAGLAAWAWEELVSGLNWVRRALGAAGLIYVVNKVAAALRA
Ga0334934_000685_2_1333300034006BiocrustRAAFYAGLSAWAWLELADGTNAARRAMGAAGLAYVVVRLGAAL
Ga0364929_0290344_17_2353300034149SedimentLPNAPLWVALGGRAIAVMSDGSVHAYARAAFYAGLAAWAWEELISGVNWVRRALGAAGLIYVVDKLAAALRA
Ga0372946_0568249_2_1723300034384SoilALTDGSVHFYARAALYASVSAWAWGELADGANWVRRALGAAGFVYVVVKLGTALGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.