Basic Information | |
---|---|
Family ID | F068721 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 43 residues |
Representative Sequence | MKRYWNKFLNWLLPNRRQRLLAEIMKRDQELGLYDETFNTKEK |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 7.38 % |
% of genes near scaffold ends (potentially truncated) | 40.32 % |
% of genes from short scaffolds (< 2000 bps) | 71.77 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (57.258 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (23.387 % of family members) |
Environment Ontology (ENVO) | Unclassified (59.677 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (75.806 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.62% β-sheet: 0.00% Coil/Unstructured: 63.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF00271 | Helicase_C | 4.03 |
PF08299 | Bac_DnaA_C | 2.42 |
PF01914 | MarC | 2.42 |
PF13392 | HNH_3 | 1.61 |
PF04024 | PspC | 1.61 |
PF10985 | DUF2805 | 1.61 |
PF01503 | PRA-PH | 1.61 |
PF13873 | Myb_DNA-bind_5 | 1.61 |
PF03061 | 4HBT | 1.61 |
PF13481 | AAA_25 | 0.81 |
PF00149 | Metallophos | 0.81 |
PF00293 | NUDIX | 0.81 |
PF06508 | QueC | 0.81 |
PF00535 | Glycos_transf_2 | 0.81 |
PF00041 | fn3 | 0.81 |
PF01471 | PG_binding_1 | 0.81 |
PF02195 | ParBc | 0.81 |
PF00722 | Glyco_hydro_16 | 0.81 |
PF01521 | Fe-S_biosyn | 0.81 |
PF03721 | UDPG_MGDP_dh_N | 0.81 |
PF00303 | Thymidylat_synt | 0.81 |
PF08241 | Methyltransf_11 | 0.81 |
PF01844 | HNH | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 2.42 |
COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 2.42 |
COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.81 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.81 |
COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.81 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.81 |
COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.81 |
COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.81 |
COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.81 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.81 |
COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.81 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 57.26 % |
All Organisms | root | All Organisms | 42.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000116|DelMOSpr2010_c10044997 | Not Available | 1966 | Open in IMG/M |
3300000116|DelMOSpr2010_c10069355 | Not Available | 1440 | Open in IMG/M |
3300000116|DelMOSpr2010_c10191204 | Not Available | 663 | Open in IMG/M |
3300000116|DelMOSpr2010_c10225099 | Not Available | 585 | Open in IMG/M |
3300000117|DelMOWin2010_c10201524 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 612 | Open in IMG/M |
3300000929|NpDRAFT_10226401 | Not Available | 590 | Open in IMG/M |
3300000947|BBAY92_10112327 | Not Available | 723 | Open in IMG/M |
3300001533|MLSed_10186938 | Not Available | 831 | Open in IMG/M |
3300003216|JGI26079J46598_1007513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3504 | Open in IMG/M |
3300003216|JGI26079J46598_1013516 | All Organisms → cellular organisms → Bacteria | 2331 | Open in IMG/M |
3300003346|JGI26081J50195_1067188 | Not Available | 699 | Open in IMG/M |
3300003617|JGI26082J51739_10030799 | All Organisms → Viruses → Predicted Viral | 2013 | Open in IMG/M |
3300003621|JGI26083J51738_10084572 | Not Available | 691 | Open in IMG/M |
3300005528|Ga0068872_10112872 | All Organisms → Viruses → Predicted Viral | 1612 | Open in IMG/M |
3300006750|Ga0098058_1173401 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium psychrophilum | 566 | Open in IMG/M |
3300006752|Ga0098048_1000340 | Not Available | 23530 | Open in IMG/M |
3300006789|Ga0098054_1012396 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3493 | Open in IMG/M |
3300006793|Ga0098055_1005671 | All Organisms → cellular organisms → Bacteria | 5992 | Open in IMG/M |
3300006793|Ga0098055_1283234 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300006802|Ga0070749_10003081 | All Organisms → cellular organisms → Bacteria | 11190 | Open in IMG/M |
3300006802|Ga0070749_10246223 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
3300006802|Ga0070749_10280316 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 938 | Open in IMG/M |
3300006802|Ga0070749_10477134 | Not Available | 681 | Open in IMG/M |
3300006802|Ga0070749_10796330 | Not Available | 502 | Open in IMG/M |
3300006810|Ga0070754_10085151 | Not Available | 1587 | Open in IMG/M |
3300006810|Ga0070754_10175255 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1012 | Open in IMG/M |
3300006810|Ga0070754_10306410 | Not Available | 711 | Open in IMG/M |
3300006868|Ga0075481_10160741 | Not Available | 815 | Open in IMG/M |
3300006916|Ga0070750_10005688 | All Organisms → cellular organisms → Bacteria | 6753 | Open in IMG/M |
3300006916|Ga0070750_10167698 | Not Available | 987 | Open in IMG/M |
3300006919|Ga0070746_10102045 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
3300006924|Ga0098051_1000102 | Not Available | 31189 | Open in IMG/M |
3300006925|Ga0098050_1000105 | Not Available | 30940 | Open in IMG/M |
3300006990|Ga0098046_1001575 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 7865 | Open in IMG/M |
3300007344|Ga0070745_1245991 | Not Available | 648 | Open in IMG/M |
3300007346|Ga0070753_1028131 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2430 | Open in IMG/M |
3300007346|Ga0070753_1246817 | Not Available | 648 | Open in IMG/M |
3300007538|Ga0099851_1138326 | Not Available | 912 | Open in IMG/M |
3300007539|Ga0099849_1006647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 5254 | Open in IMG/M |
3300007539|Ga0099849_1174085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300007539|Ga0099849_1334425 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300007542|Ga0099846_1272229 | Not Available | 584 | Open in IMG/M |
3300007609|Ga0102945_1059639 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 729 | Open in IMG/M |
3300007640|Ga0070751_1272714 | Not Available | 637 | Open in IMG/M |
3300008259|Ga0114841_1143819 | Not Available | 956 | Open in IMG/M |
3300009149|Ga0114918_10348155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300009433|Ga0115545_1037795 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1911 | Open in IMG/M |
3300009436|Ga0115008_10612161 | Not Available | 785 | Open in IMG/M |
3300009443|Ga0115557_1027432 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2760 | Open in IMG/M |
3300009484|Ga0127411_1002109 | Not Available | 6505 | Open in IMG/M |
3300009544|Ga0115006_10758449 | Not Available | 854 | Open in IMG/M |
3300010150|Ga0098056_1076324 | Not Available | 1148 | Open in IMG/M |
3300010296|Ga0129348_1296210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300010354|Ga0129333_11637031 | Not Available | 525 | Open in IMG/M |
3300011268|Ga0151620_1167562 | Not Available | 671 | Open in IMG/M |
3300013004|Ga0164293_10528980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
3300016741|Ga0182079_1139940 | Not Available | 553 | Open in IMG/M |
3300017708|Ga0181369_1023583 | All Organisms → Viruses → Predicted Viral | 1481 | Open in IMG/M |
3300017722|Ga0181347_1193831 | Not Available | 537 | Open in IMG/M |
3300017818|Ga0181565_10041732 | All Organisms → Viruses → Predicted Viral | 3339 | Open in IMG/M |
3300017818|Ga0181565_10148042 | All Organisms → Viruses → Predicted Viral | 1642 | Open in IMG/M |
3300017963|Ga0180437_10328883 | Not Available | 1156 | Open in IMG/M |
3300017971|Ga0180438_11376118 | Not Available | 504 | Open in IMG/M |
3300017987|Ga0180431_10694184 | Not Available | 689 | Open in IMG/M |
3300017989|Ga0180432_10308657 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1205 | Open in IMG/M |
3300018080|Ga0180433_10160957 | Not Available | 1861 | Open in IMG/M |
3300018417|Ga0181558_10644255 | Not Available | 542 | Open in IMG/M |
3300018876|Ga0181564_10109434 | All Organisms → Viruses → Predicted Viral | 1714 | Open in IMG/M |
3300019737|Ga0193973_1015046 | Not Available | 833 | Open in IMG/M |
3300019747|Ga0193978_1004706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1331 | Open in IMG/M |
3300020165|Ga0206125_10093657 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
3300020166|Ga0206128_1005329 | All Organisms → cellular organisms → Bacteria | 9629 | Open in IMG/M |
3300020182|Ga0206129_10144006 | Not Available | 1142 | Open in IMG/M |
3300020185|Ga0206131_10341078 | Not Available | 650 | Open in IMG/M |
3300020506|Ga0208091_1001483 | All Organisms → Viruses | 3690 | Open in IMG/M |
3300021356|Ga0213858_10115941 | Not Available | 1308 | Open in IMG/M |
3300021356|Ga0213858_10348038 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 701 | Open in IMG/M |
3300021364|Ga0213859_10188637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 959 | Open in IMG/M |
3300021368|Ga0213860_10086663 | Not Available | 1362 | Open in IMG/M |
3300021958|Ga0222718_10515964 | Not Available | 575 | Open in IMG/M |
3300021960|Ga0222715_10071517 | All Organisms → Viruses → Predicted Viral | 2317 | Open in IMG/M |
3300021963|Ga0222712_10360518 | Not Available | 894 | Open in IMG/M |
3300021964|Ga0222719_10527485 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 703 | Open in IMG/M |
3300022053|Ga0212030_1003922 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
3300022065|Ga0212024_1089837 | Not Available | 547 | Open in IMG/M |
3300022187|Ga0196899_1157398 | Not Available | 627 | Open in IMG/M |
3300022928|Ga0255758_10191531 | Not Available | 961 | Open in IMG/M |
3300023087|Ga0255774_10074073 | All Organisms → Viruses → Predicted Viral | 2010 | Open in IMG/M |
3300023105|Ga0255782_10054735 | All Organisms → Viruses → Predicted Viral | 2215 | Open in IMG/M |
3300023273|Ga0255763_1277641 | Not Available | 609 | Open in IMG/M |
3300024247|Ga0228675_1067433 | Not Available | 716 | Open in IMG/M |
(restricted) 3300024255|Ga0233438_10001774 | Not Available | 22722 | Open in IMG/M |
(restricted) 3300024255|Ga0233438_10163883 | Not Available | 942 | Open in IMG/M |
3300024319|Ga0228670_1001006 | Not Available | 13476 | Open in IMG/M |
(restricted) 3300024340|Ga0255042_10077516 | Not Available | 892 | Open in IMG/M |
3300025070|Ga0208667_1011010 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
3300025083|Ga0208791_1000332 | Not Available | 23025 | Open in IMG/M |
3300025084|Ga0208298_1000036 | Not Available | 56342 | Open in IMG/M |
3300025108|Ga0208793_1000037 | Not Available | 92305 | Open in IMG/M |
3300025608|Ga0209654_1000618 | Not Available | 33209 | Open in IMG/M |
3300025608|Ga0209654_1155044 | Not Available | 550 | Open in IMG/M |
3300025617|Ga0209138_1039242 | All Organisms → Viruses → Predicted Viral | 1818 | Open in IMG/M |
3300025617|Ga0209138_1134662 | Not Available | 660 | Open in IMG/M |
3300025636|Ga0209136_1019952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2703 | Open in IMG/M |
3300025646|Ga0208161_1001898 | Not Available | 10853 | Open in IMG/M |
3300025684|Ga0209652_1023485 | Not Available | 2932 | Open in IMG/M |
3300025684|Ga0209652_1027965 | Not Available | 2528 | Open in IMG/M |
3300025769|Ga0208767_1074657 | All Organisms → Viruses → Predicted Viral | 1453 | Open in IMG/M |
3300025879|Ga0209555_10322915 | Not Available | 584 | Open in IMG/M |
3300025889|Ga0208644_1152627 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1056 | Open in IMG/M |
3300025897|Ga0209425_10100115 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1723 | Open in IMG/M |
3300026097|Ga0209953_1005897 | All Organisms → Viruses → Predicted Viral | 2819 | Open in IMG/M |
3300026097|Ga0209953_1039484 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 705 | Open in IMG/M |
3300027157|Ga0255204_1086014 | Not Available | 549 | Open in IMG/M |
3300027833|Ga0209092_10522037 | Not Available | 604 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1108284 | Not Available | 1339 | Open in IMG/M |
3300028297|Ga0228617_1121741 | Not Available | 612 | Open in IMG/M |
3300031758|Ga0315907_10208897 | All Organisms → Viruses → Predicted Viral | 1633 | Open in IMG/M |
3300031963|Ga0315901_10348949 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
3300032277|Ga0316202_10172224 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300032277|Ga0316202_10187529 | Not Available | 960 | Open in IMG/M |
3300032277|Ga0316202_10469976 | Not Available | 590 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 23.39% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.71% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 10.48% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.26% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.65% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.03% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 4.03% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.23% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 3.23% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 2.42% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.42% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.61% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.61% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.61% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.61% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.61% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.81% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.81% |
Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 0.81% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.81% |
Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.81% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.81% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.81% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.81% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.81% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
3300003621 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
3300009484 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 12m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300016741 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019737 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MG | Environmental | Open in IMG/M |
3300019747 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_5-6_MG | Environmental | Open in IMG/M |
3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
3300023273 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG | Environmental | Open in IMG/M |
3300024247 | Seawater microbial communities from Monterey Bay, California, United States - 36D_r | Environmental | Open in IMG/M |
3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025684 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300027157 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h | Environmental | Open in IMG/M |
3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300028297 | Seawater microbial communities from Monterey Bay, California, United States - 18D | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSpr2010_100449975 | 3300000116 | Marine | MKKHYNKFLNWVSPKRRKRLLIEIIKGDEDLGLYDETFKTKER* |
DelMOSpr2010_100693554 | 3300000116 | Marine | MKRYWNKFLNWLLPNRRQRLLAEMMKKDQELGLYDETFKTKER* |
DelMOSpr2010_101912044 | 3300000116 | Marine | HQREMKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFNTKER* |
DelMOSpr2010_102250992 | 3300000116 | Marine | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQELGLYDETFKPKRDE* |
DelMOWin2010_102015242 | 3300000117 | Marine | MKRYWNKFLNWLLSNRRERLLSEIMKQDQELGLYDEPFKTKER* |
NpDRAFT_102264012 | 3300000929 | Freshwater And Marine | MRRYWNKFLNWLMPSRRERLLTKMMKQDQELGLYDDEKIY* |
BBAY92_101123272 | 3300000947 | Macroalgal Surface | MKRYWNKLLNWLLPNRRERLLTEIMKRDQELGLYEEPFNTKER* |
MLSed_101869383 | 3300001533 | Benthic | VKRYWNRFLNWLIPNRRQKILAEMMRKDQEDGLYNEKFK* |
JGI26079J46598_10075134 | 3300003216 | Marine | MKRYWNKFLNWLIPNRRQRLLRKIMEQDQELGLYDETFNTKER* |
JGI26079J46598_10135167 | 3300003216 | Marine | MRRYWNKFLNWLIPNRRQKILIKMMKESQEMGLYDEPFNTKER* |
JGI26081J50195_10671883 | 3300003346 | Marine | YWNKFLNWLIPNRRQKILIKMMKESQEMGLYDEPFNTKER* |
JGI26082J51739_100307995 | 3300003617 | Marine | MKKYWNKFLNWLIPSRRGRLLAEIMKRDQELGLYDETFNTKER* |
JGI26083J51738_100845723 | 3300003621 | Marine | MKRYWNKFLNWLIPSRRGRLLAEIMKQDQELGLYDETFKTKER* |
Ga0068872_101128722 | 3300005528 | Freshwater Lake | MRRYWNKFLNWLIPNRRERLLTEMMLRDQELGLYDEPVKTKEK* |
Ga0098058_11734013 | 3300006750 | Marine | MRRYWNKFLNWLIPRRRARLLAEIMKRDQELGLYDETFNTKEK* |
Ga0098048_100034058 | 3300006752 | Marine | MINSGREMKRYWNKFLNWLIPSRREKLLVKIMKQDQELGLYDKTSNTKER* |
Ga0098054_10123962 | 3300006789 | Marine | MRRYWNKFLNWLIPKRRARLLAEIMKRDQELGLYDETFNTKDDTSKGIN* |
Ga0098055_100567117 | 3300006793 | Marine | MRRYWNKFLNWLIPKRRARLLAEIMKRDQELGLYDETF |
Ga0098055_12832343 | 3300006793 | Marine | MKRYWNKFLNWLLPNRRQRLLAEIMKRDQELGLYDETFNTKEK* |
Ga0070749_1000308134 | 3300006802 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQELGLYDETFKTKER* |
Ga0070749_102462231 | 3300006802 | Aqueous | QREMKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFNTKEK* |
Ga0070749_102803161 | 3300006802 | Aqueous | NKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFKTKER* |
Ga0070749_104771341 | 3300006802 | Aqueous | IKRYWNKFLNLLLPNRRQRLLAEIMKKDQKSGLYDETFNTKEK* |
Ga0070749_107963302 | 3300006802 | Aqueous | MKKHYNKFLNWVSPKRRKRLLTEIIKGDEDLGLYDETFNTKER* |
Ga0070754_100851518 | 3300006810 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDE |
Ga0070754_101752551 | 3300006810 | Aqueous | REMKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFKTKER* |
Ga0070754_103064101 | 3300006810 | Aqueous | QREMTRYWNKFLNWLLPNRRERLLAEIMKRDQELGLYNETFNTKEK* |
Ga0075481_101607413 | 3300006868 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFKTKER* |
Ga0070750_1000568820 | 3300006916 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQELGLYDE |
Ga0070750_101676983 | 3300006916 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFNTKEK* |
Ga0070746_101020457 | 3300006919 | Aqueous | MKRYWNKFLNWLLPNRRERLLAEIMKRDQELGLYDEPFNTKEKS* |
Ga0098051_10001022 | 3300006924 | Marine | MRRYWNKFLNWLIPKRRARLLAEIMKRDQELGLYDETFKTKDDTER* |
Ga0098050_10001051 | 3300006925 | Marine | MRRYWNKFLNWLIPKRRARLLAEIMKRDQELGLYDETFNTKDDTSK |
Ga0098046_100157517 | 3300006990 | Marine | WNKFLNWLIPRRRARLLAEIMKRDQELGLYDETFNTKEK* |
Ga0070745_12459914 | 3300007344 | Aqueous | REMKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFNTKEK* |
Ga0070753_10281315 | 3300007346 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETCKTKER* |
Ga0070753_12468171 | 3300007346 | Aqueous | QREMKRYWNKFLNWLLPNRRERLLAEIMKRDQELGLYDEPFNTKENS* |
Ga0099851_11383264 | 3300007538 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFNTKERCLKKKDNIG |
Ga0099849_100664714 | 3300007539 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQELGLYDET |
Ga0099849_11740852 | 3300007539 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFNTKER* |
Ga0099849_13344251 | 3300007539 | Aqueous | NKREMKRYWNKFLNWLLPNRRQRLLAEIMKKDQELGLYDETFKTKER* |
Ga0099848_10034634 | 3300007541 | Aqueous | MSKFERFYNKLLNKIFPNRRSRLIFEIMKRDQELGLYDETFKQEEQ* |
Ga0099846_12722291 | 3300007542 | Aqueous | KFLNWLIPSRRRRILTEMTGKDQELGLYDEPFNTNEK* |
Ga0102945_10596393 | 3300007609 | Pond Water | MVGLNFKKYWNKFLNWLIPNRREKLLIKMMKDAEELGLYDEPFNTK |
Ga0070751_12727141 | 3300007640 | Aqueous | MKKCWNKFLNWLIPSRRRRILTEMTRKDQELGLYDEP |
Ga0114841_11438193 | 3300008259 | Freshwater, Plankton | RYWNKFLNWLIPNRRERLLTEMMLRDQELGLYDEPVKTKEK* |
Ga0114918_103481551 | 3300009149 | Deep Subsurface | FLNWIIPNRRQKLLYKIMKMDQELGLYDEPSNKKDEKI* |
Ga0115545_10377951 | 3300009433 | Pelagic Marine | NKFLNWLLPNRRERLLAEIMKRDQELGLYDEPFNIKER* |
Ga0115008_106121613 | 3300009436 | Marine | MKKYWNKFLNWLIPSRRGRLLAEIMKRDQELGLYNETFYAKEK* |
Ga0115557_10274329 | 3300009443 | Pelagic Marine | MKRYWNKFLNWLLPNRRERLLAEIMKRDQELGLYDEPFNTKER* |
Ga0127411_10021091 | 3300009484 | Meromictic Pond | MKKYWNKFLNWLIPSRRRRILTEMTRKDQELGLYDEPFNTNEK* |
Ga0115006_107584493 | 3300009544 | Marine | MKKYWNKFLNWLIPSRRGRLLDEIMKRDQELGLYDKTFNTKENEL* |
Ga0098056_10763245 | 3300010150 | Marine | WNKFLNWLIPSRRGRLLAEIMKRDQELGLYDETFNTKEK* |
Ga0129348_12962101 | 3300010296 | Freshwater To Marine Saline Gradient | REMKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFNTKER* |
Ga0129333_116370312 | 3300010354 | Freshwater To Marine Saline Gradient | LCIMKKCWNKFLNWLIPCRRRRILTEMTRKDQELGLYDEPFNTKEK* |
Ga0151620_11675622 | 3300011268 | Freshwater | MKKYWNKFLNLLIPNRRERLLTEMMLRDQELGLYDEPVKTKEK* |
Ga0164293_105289802 | 3300013004 | Freshwater | MRYWNRFLNWLIPNRRERLLKQMIKESEELGLYDETFNTNEK* |
Ga0182079_11399401 | 3300016741 | Salt Marsh | WNKFLNWLIPNRRARLLAEIMKRDQELGLYDETFNTKEI |
Ga0181369_10235835 | 3300017708 | Marine | MRRYWNKFLNWLIPRRRARLLAEIMKRDQELGLWDETFNTKEI |
Ga0181347_11938312 | 3300017722 | Freshwater Lake | MRRYWNKFLNWLIPNRRKRLLTEMMLRDQELGLYDEPVTSKRNDI |
Ga0181565_100417325 | 3300017818 | Salt Marsh | MRRYWNRFLNWLIPSRKERLLTKMMKQDQELGLYAKTFKIKEK |
Ga0181565_101480423 | 3300017818 | Salt Marsh | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFKTKER |
Ga0180437_103288835 | 3300017963 | Hypersaline Lake Sediment | MRINFKKYWNKFLNWLIPNRREKLLIKMMRDAEEMGLYDEPFNNK |
Ga0180438_113761182 | 3300017971 | Hypersaline Lake Sediment | MKRYWNKFLNWLIPKRRERLLAKIMKLDQDLGLYDEQLKQNKYE |
Ga0180431_106941844 | 3300017987 | Hypersaline Lake Sediment | MKRYWNKFLNWLIPKRRERLLAKIMKLDQDLGLYDE |
Ga0180432_103086572 | 3300017989 | Hypersaline Lake Sediment | MKLKKLNRFWNRILNWVIPNRRARLLGEIMKMDQELGLYDETMKTKEK |
Ga0180433_101609574 | 3300018080 | Hypersaline Lake Sediment | MKRYWNKFLNWIIPNRRERLLSKIIKLDQELDLYDEPSNKPKPR |
Ga0181558_106442554 | 3300018417 | Salt Marsh | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFKTK |
Ga0181564_101094341 | 3300018876 | Salt Marsh | MKRYWNKFLNWLLPNRRQRLLAEIMKQDQELGLYDEPF |
Ga0193973_10150465 | 3300019737 | Sediment | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQELGLYDETFKTKER |
Ga0193978_10047061 | 3300019747 | Sediment | KFLNWLLPNRRQRLLAEIMKKDQELGLYDETFKTKER |
Ga0206125_100936572 | 3300020165 | Seawater | MKRYWNKFLNWLLPNRRQRLLAEIMKRDQELGLYEETFNTKER |
Ga0206128_100532918 | 3300020166 | Seawater | MKKYWNKFLNWLIPSRRGRLLAEIMKRDQELGLYDETFNTKER |
Ga0206129_101440064 | 3300020182 | Seawater | MKRYWNKFLNWLLPNRRKRLLAEIMKRDQELGLYNEPFNTKEE |
Ga0206131_103410784 | 3300020185 | Seawater | MKRYWNKFLNWLLPNRRKRLLAEIMKRDQELGLYN |
Ga0208091_10014837 | 3300020506 | Freshwater | MRYWNRFLNWLIPNRRERLLKQMIKESEELGLYDETFNTNEK |
Ga0213858_101159414 | 3300021356 | Seawater | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQELGLYDETFNTKER |
Ga0213858_103480381 | 3300021356 | Seawater | KRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFKTKER |
Ga0213859_101886371 | 3300021364 | Seawater | MRKHKKYWNRFLNWLFPGRRARILSEMMKRDQELGLYDEVTFQ |
Ga0213860_100866636 | 3300021368 | Seawater | PTNNKHQREMKRYWNKFLNWLLPNRRQRLLAEIMKKDQELGLYDETFNTKER |
Ga0222718_105159642 | 3300021958 | Estuarine Water | MKKHYNKFLNWLFPKRRKRLLIEIIKGDEDLGLYDETFKTKER |
Ga0222715_100715174 | 3300021960 | Estuarine Water | MKRYWNKFLNWLIPNRRARLLAEIMKRDQDLGLYDETFNTKER |
Ga0222712_103605182 | 3300021963 | Estuarine Water | KKYWNKFLNLLIPNRRERLLTEMMLRDQELGLYDEPVKTKEK |
Ga0222719_105274853 | 3300021964 | Estuarine Water | MKRYWNKFLNWLIPNRRARLLAEIMKRDQELGLYDETFN |
Ga0212030_10039224 | 3300022053 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEMMKKDQELGLYDETFKTKER |
Ga0212024_10898373 | 3300022065 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEIMKQDQELGLYDEPFNTKER |
Ga0212031_10281292 | 3300022176 | Aqueous | MSKFERFYNKLLNKIFPNRRSRLIFEIMKRDQELGLYDETFKQEEQ |
Ga0196899_11573981 | 3300022187 | Aqueous | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFNTKEK |
Ga0255758_101915311 | 3300022928 | Salt Marsh | MKRYWNKFLNWLLPNRRERLLAEIMKRDQELGLYNETFNTKEK |
Ga0255774_100740731 | 3300023087 | Salt Marsh | KFLNWLLPNRRQRLLAEIMKKDQESGLYDETFKTKER |
Ga0255782_100547351 | 3300023105 | Salt Marsh | EMRRYWNRFLNWLIPSRKERLLTKMMKQDQELGLYAKTFKIKEK |
Ga0255763_12776411 | 3300023273 | Salt Marsh | YWNKFLNWLLPNRRERLLAEIMKRDQELGLYNETFNTKEK |
Ga0228675_10674331 | 3300024247 | Seawater | MRRYWNKFLNWLIPRRRARLLAEIMKRDQELGLYDETFNTNER |
(restricted) Ga0233438_1000177450 | 3300024255 | Seawater | MKKYWNKFLNWLIPSRRGRLLAEIMKRDQELGLYEETFKTKRDEGFETTI |
(restricted) Ga0233438_101638832 | 3300024255 | Seawater | MKKYWNKFLNWLIPSRRGRLLAEIMKQDQELGLYDETFKTKRNET |
Ga0228670_100100622 | 3300024319 | Seawater | MRRYWNKFLNWLIPNRRQKILIKMMKESQEMGLYDETFNTKEK |
(restricted) Ga0255042_100775163 | 3300024340 | Seawater | MKKYWNKFLNWLIPNRREKLLSKIMKIDQELGLYDEPLNKEYESNK |
Ga0208667_10110104 | 3300025070 | Marine | MRRYWNKFLNWLIPRRRARLLAEIMKRDQELGLYDETFNTKEK |
Ga0208791_100033257 | 3300025083 | Marine | MKKYWNKFLNWLIPSRRGRLLAEIMKRDQELGLYDET |
Ga0208298_10000361 | 3300025084 | Marine | MRRYWNKFLNWLIPKRRARLLAEIMKRDQELGLYDETFNTKDDTSKGIN |
Ga0208793_100003779 | 3300025108 | Marine | MRRYWNKFLNWLIPKRRARLLAEIMKRDQELGLYDETFKTKDDTER |
Ga0209654_10006182 | 3300025608 | Marine | MKRYWNKLLNWLLSNRREKFLGEIMKRDQELGLYEETSKTKEK |
Ga0209654_11550443 | 3300025608 | Marine | MKKYWNKFLNWLIPSRRGRLLAEIMKRDQELGLYDETFNTKEK |
Ga0209138_10392422 | 3300025617 | Marine | MKRYWNKFLNWLIPSRRGRLLAEIMKRDEELGLYDETFNTKEK |
Ga0209138_11346621 | 3300025617 | Marine | MKRYWNKFLNWLIPSRRGRLLAEIIKQDQELGLYDETFNTK |
Ga0209136_10199524 | 3300025636 | Marine | MKRYWNKFLNWLIPNRRQRLLRKIMEQDQELGLYDETFNTKER |
Ga0208161_10018986 | 3300025646 | Aqueous | MKRYWNKFLNWIIPNRRQRLLSKIMKMDQELGLYDEPFNKEDEKI |
Ga0209652_10234853 | 3300025684 | Marine | MRRYWNKFLNWLIPNRRQKILIKMMKESQEMGLYDEPFNTKER |
Ga0209652_10279652 | 3300025684 | Marine | MKKYWNKFLNWLIPSRRGRLLAEIVKRDQELGLYDETFNTKEK |
Ga0208767_10746575 | 3300025769 | Aqueous | MKRYWNKFLNWLLPNRRERLLAEIMKRDQELGLYDEPFNTKEKS |
Ga0209555_103229153 | 3300025879 | Marine | REMKKYWNKFLNWLIPSRRGRLLAEIMKRDQELGLYDETFNTKER |
Ga0208644_11526275 | 3300025889 | Aqueous | QREMKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFKTKER |
Ga0209425_101001154 | 3300025897 | Pelagic Marine | MKRYWNKFLNWLLPNRRERLLAEIMKRDQELGLYDEPFNIKER |
Ga0209953_10058974 | 3300026097 | Pond Water | MRINFKKYWNKFLNWLIPNRREKLLIKMMKDAEELGLYDEPFNTKEK |
Ga0209953_10394841 | 3300026097 | Pond Water | MVGLNFKKYWNKFLNWLIPNRREKLLIKMMKDAEELGLYDEPFNTKE |
Ga0255204_10860142 | 3300027157 | Freshwater | MRRYWNKFLNWLIPNRRKRLLTEMMLRDQELGLYDEPVT |
Ga0209092_105220373 | 3300027833 | Marine | MKKYWNKFLNWLIPSRRGRLLAEIMKRDQELGLYNETFNTKEK |
(restricted) Ga0247837_11082843 | 3300027970 | Freshwater | MKKYWNKFLNLLIPNRRERLLTEMMLRDQELGLYDEPVKTKEK |
Ga0228617_11217413 | 3300028297 | Seawater | MRRYWNKFLNWLLPNRRERLLAEIMKRDQELGLYDETFKTKER |
Ga0315907_102088974 | 3300031758 | Freshwater | MRRYWNKFLNWLIPNRRERLLTEMMLRDQELGLYDEPVTSKRNDII |
Ga0315901_103489491 | 3300031963 | Freshwater | MRRYWNKFLNWLIPNRRKRLLTEMMLRDQELGLYDEPVKTKEK |
Ga0316202_101722245 | 3300032277 | Microbial Mat | MKKYWNKFLNWLLPNRRERLLAEIMKRDQELGLYDEPFNTKEKS |
Ga0316202_101875291 | 3300032277 | Microbial Mat | MKRYWNKFLNWLLPNRRERLLAEIMKRDQELGLYDETFNTKENE |
Ga0316202_104699763 | 3300032277 | Microbial Mat | MKRYWNKFLNWLLPNRRQRLLAEIMKKDQESGLYDETFNSKER |
⦗Top⦘ |