Basic Information | |
---|---|
Family ID | F068658 |
Family Type | Metagenome |
Number of Sequences | 124 |
Average Sequence Length | 46 residues |
Representative Sequence | LDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.81 % |
% of genes near scaffold ends (potentially truncated) | 99.19 % |
% of genes from short scaffolds (< 2000 bps) | 91.94 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.129 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (28.226 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.581 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.484 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.99% β-sheet: 0.00% Coil/Unstructured: 63.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF13561 | adh_short_C2 | 9.68 |
PF01402 | RHH_1 | 3.23 |
PF00106 | adh_short | 2.42 |
PF07858 | LEH | 2.42 |
PF13505 | OMP_b-brl | 2.42 |
PF10604 | Polyketide_cyc2 | 2.42 |
PF00891 | Methyltransf_2 | 1.61 |
PF04075 | F420H2_quin_red | 1.61 |
PF13701 | DDE_Tnp_1_4 | 1.61 |
PF02452 | PemK_toxin | 1.61 |
PF01370 | Epimerase | 1.61 |
PF00582 | Usp | 0.81 |
PF13564 | DoxX_2 | 0.81 |
PF13432 | TPR_16 | 0.81 |
PF00583 | Acetyltransf_1 | 0.81 |
PF13462 | Thioredoxin_4 | 0.81 |
PF02601 | Exonuc_VII_L | 0.81 |
PF00903 | Glyoxalase | 0.81 |
PF13298 | LigD_N | 0.81 |
PF07681 | DoxX | 0.81 |
PF04986 | Y2_Tnp | 0.81 |
PF04191 | PEMT | 0.81 |
PF14891 | Peptidase_M91 | 0.81 |
PF01258 | zf-dskA_traR | 0.81 |
PF01381 | HTH_3 | 0.81 |
PF13560 | HTH_31 | 0.81 |
PF09859 | Oxygenase-NA | 0.81 |
PF07690 | MFS_1 | 0.81 |
PF14532 | Sigma54_activ_2 | 0.81 |
PF00171 | Aldedh | 0.81 |
PF16864 | Dimerisation2 | 0.81 |
PF13590 | DUF4136 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG3631 | Ketosteroid isomerase-related protein | General function prediction only [R] | 2.42 |
COG4308 | Limonene-1,2-epoxide hydrolase LimA/EphG | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.42 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 1.61 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.81 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.81 |
COG1570 | Exonuclease VII, large subunit | Replication, recombination and repair [L] | 0.81 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.81 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.81 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.81 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.13 % |
Unclassified | root | N/A | 8.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000550|F24TB_11969175 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 548 | Open in IMG/M |
3300004000|Ga0055458_10132479 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300004268|Ga0066398_10180827 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300005093|Ga0062594_101845061 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300005166|Ga0066674_10117098 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300005166|Ga0066674_10447438 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
3300005172|Ga0066683_10120564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1599 | Open in IMG/M |
3300005172|Ga0066683_10726799 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 585 | Open in IMG/M |
3300005172|Ga0066683_10754665 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
3300005174|Ga0066680_10450068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
3300005178|Ga0066688_10135593 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
3300005181|Ga0066678_10391623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 920 | Open in IMG/M |
3300005332|Ga0066388_104041894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 748 | Open in IMG/M |
3300005332|Ga0066388_106780385 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300005340|Ga0070689_101239699 | Not Available | 670 | Open in IMG/M |
3300005446|Ga0066686_10483800 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300005457|Ga0070662_100104928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2145 | Open in IMG/M |
3300005459|Ga0068867_101433958 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
3300005467|Ga0070706_101017204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 764 | Open in IMG/M |
3300005471|Ga0070698_101314959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 673 | Open in IMG/M |
3300005518|Ga0070699_100932623 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 795 | Open in IMG/M |
3300005526|Ga0073909_10458939 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300005536|Ga0070697_100510532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1052 | Open in IMG/M |
3300005536|Ga0070697_100694272 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300005545|Ga0070695_100740916 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300005545|Ga0070695_100833808 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
3300005549|Ga0070704_101458732 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 629 | Open in IMG/M |
3300005552|Ga0066701_10894105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
3300005553|Ga0066695_10658419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 619 | Open in IMG/M |
3300005559|Ga0066700_10054328 | Not Available | 2475 | Open in IMG/M |
3300005559|Ga0066700_10180027 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1450 | Open in IMG/M |
3300005569|Ga0066705_10209013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1224 | Open in IMG/M |
3300005574|Ga0066694_10617081 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
3300005764|Ga0066903_105889903 | Not Available | 643 | Open in IMG/M |
3300005764|Ga0066903_109089117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 502 | Open in IMG/M |
3300005764|Ga0066903_109113983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 502 | Open in IMG/M |
3300005937|Ga0081455_10335878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
3300006034|Ga0066656_10182437 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1328 | Open in IMG/M |
3300006794|Ga0066658_10602102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
3300006796|Ga0066665_10187972 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
3300006796|Ga0066665_10505849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 989 | Open in IMG/M |
3300006796|Ga0066665_11439310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
3300006797|Ga0066659_10066788 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
3300006797|Ga0066659_10338452 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300006797|Ga0066659_10398282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1082 | Open in IMG/M |
3300006852|Ga0075433_10742917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 858 | Open in IMG/M |
3300006854|Ga0075425_102973043 | Not Available | 519 | Open in IMG/M |
3300006871|Ga0075434_101835022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 613 | Open in IMG/M |
3300006904|Ga0075424_100298427 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
3300006969|Ga0075419_11186153 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 563 | Open in IMG/M |
3300007255|Ga0099791_10332997 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 726 | Open in IMG/M |
3300009012|Ga0066710_100668942 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300009012|Ga0066710_100890617 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300009012|Ga0066710_101507936 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300009012|Ga0066710_102761046 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300009038|Ga0099829_11471150 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300009100|Ga0075418_12364180 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300009137|Ga0066709_101794704 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300009137|Ga0066709_104047752 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300009156|Ga0111538_13842585 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300010046|Ga0126384_12066292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 546 | Open in IMG/M |
3300010304|Ga0134088_10247723 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300010304|Ga0134088_10305547 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300010320|Ga0134109_10125583 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300010320|Ga0134109_10249395 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300010333|Ga0134080_10054329 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300010333|Ga0134080_10510718 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300010397|Ga0134124_12964795 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300010403|Ga0134123_10702491 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300011442|Ga0137437_1317314 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300012198|Ga0137364_11424354 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
3300012199|Ga0137383_10887750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
3300012202|Ga0137363_11213929 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 641 | Open in IMG/M |
3300012205|Ga0137362_10059261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3143 | Open in IMG/M |
3300012206|Ga0137380_10847583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 787 | Open in IMG/M |
3300012208|Ga0137376_10277421 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300012211|Ga0137377_10156586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → Rhodovulum strictum | 2183 | Open in IMG/M |
3300012211|Ga0137377_10438266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1245 | Open in IMG/M |
3300012361|Ga0137360_10284663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1368 | Open in IMG/M |
3300012361|Ga0137360_10359397 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
3300012362|Ga0137361_10498604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1118 | Open in IMG/M |
3300012923|Ga0137359_10031355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4564 | Open in IMG/M |
3300012930|Ga0137407_11305304 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300012975|Ga0134110_10049789 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
3300012975|Ga0134110_10064281 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300014150|Ga0134081_10264372 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300014157|Ga0134078_10270232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 720 | Open in IMG/M |
3300014301|Ga0075323_1138067 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300015358|Ga0134089_10442609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
3300016422|Ga0182039_10765894 | Not Available | 855 | Open in IMG/M |
3300017654|Ga0134069_1156365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 764 | Open in IMG/M |
3300017657|Ga0134074_1042890 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300017657|Ga0134074_1067384 | Not Available | 1215 | Open in IMG/M |
3300018431|Ga0066655_10133132 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
3300018433|Ga0066667_10188365 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
3300018433|Ga0066667_11722133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 563 | Open in IMG/M |
3300019487|Ga0187893_10062799 | All Organisms → cellular organisms → Bacteria | 3608 | Open in IMG/M |
3300025910|Ga0207684_11108020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
3300025934|Ga0207686_11735024 | Not Available | 516 | Open in IMG/M |
3300026277|Ga0209350_1081137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 871 | Open in IMG/M |
3300026308|Ga0209265_1138871 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300026324|Ga0209470_1021451 | All Organisms → cellular organisms → Bacteria | 3476 | Open in IMG/M |
3300026327|Ga0209266_1011366 | All Organisms → cellular organisms → Bacteria | 5142 | Open in IMG/M |
3300026327|Ga0209266_1063093 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1759 | Open in IMG/M |
3300026335|Ga0209804_1266430 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300026523|Ga0209808_1088606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1322 | Open in IMG/M |
3300026530|Ga0209807_1116649 | Not Available | 1108 | Open in IMG/M |
3300026532|Ga0209160_1227107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
3300026536|Ga0209058_1098968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1481 | Open in IMG/M |
3300026537|Ga0209157_1264992 | Not Available | 656 | Open in IMG/M |
3300026538|Ga0209056_10237423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1304 | Open in IMG/M |
3300027748|Ga0209689_1060574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2076 | Open in IMG/M |
3300027821|Ga0209811_10157121 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300028589|Ga0247818_10673887 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 716 | Open in IMG/M |
3300028812|Ga0247825_10834890 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
3300030336|Ga0247826_11174710 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300031781|Ga0318547_10185809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1236 | Open in IMG/M |
3300031835|Ga0318517_10540579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 524 | Open in IMG/M |
3300031896|Ga0318551_10718264 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300032090|Ga0318518_10555460 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300032180|Ga0307471_100352411 | Not Available | 1582 | Open in IMG/M |
3300032256|Ga0315271_11500755 | Not Available | 581 | Open in IMG/M |
3300032829|Ga0335070_10253639 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
3300033433|Ga0326726_10860169 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 28.23% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.10% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.29% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.26% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.42% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.81% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.81% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F24TB_119691751 | 3300000550 | Soil | MSMNTEITVMERILRALMEANREEEGLPVSMSDKKSEPLPS* |
Ga0055458_101324792 | 3300004000 | Natural And Restored Wetlands | AGTLDSLMSMNNEITTMERILRALMEANREEEAAGGDAKKSGPLAS* |
Ga0066398_101808271 | 3300004268 | Tropical Forest Soil | GTLDSLMSMNTEITVMERILRALMDANREEEATVPAAADAKKSEKPLPS* |
Ga0062594_1018450611 | 3300005093 | Soil | GTLDSLMSMNTEITVMERILRALMEANREEEGLPVSMSDKKSEPLPS* |
Ga0066674_101170983 | 3300005166 | Soil | GDSSNEEQWAGTLDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0066674_104474381 | 3300005166 | Soil | DSSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEGSTSLMVPDKQSEPLLS* |
Ga0066683_101205643 | 3300005172 | Soil | SSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS* |
Ga0066683_107267991 | 3300005172 | Soil | SSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESTSLMVPDKQSEPLLS* |
Ga0066683_107546653 | 3300005172 | Soil | SSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS* |
Ga0066680_104500681 | 3300005174 | Soil | EQWAGTLDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0066688_101355931 | 3300005178 | Soil | GTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS* |
Ga0066678_103916231 | 3300005181 | Soil | DSSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESSLLMVPDKQSEPLLS* |
Ga0066388_1040418941 | 3300005332 | Tropical Forest Soil | MNSEITVMERILRALMEANREEEAASPAVAAKKSEPLPS* |
Ga0066388_1067803852 | 3300005332 | Tropical Forest Soil | MNSEITVMERILRALMEANQEEDSAAVAAPAKKSEPLPS* |
Ga0070689_1012396991 | 3300005340 | Switchgrass Rhizosphere | LMAMNSEITVMERILRALMEANREEEAASPAVSAKKSEPLPS* |
Ga0066686_104838001 | 3300005446 | Soil | GTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS* |
Ga0070662_1001049284 | 3300005457 | Corn Rhizosphere | SLMAMNSEITVMERILRALMEANREEEAASPAVAAKKSEPLPS* |
Ga0068867_1014339582 | 3300005459 | Miscanthus Rhizosphere | EHWAGTLDSLMSMNTEITVMERILRALMEANREEEGLPVSVPDKKSEPLPS* |
Ga0070706_1010172042 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DSLMSMNTEITVMERILRALMEANREEESSTAVPDKKSEPLPS* |
Ga0070698_1013149591 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0070699_1009326231 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LMSMNTEITVMERILRALMEANREEEGLPVSMSDKKSEPLPS* |
Ga0073909_104589391 | 3300005526 | Surface Soil | GTLDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0070697_1005105321 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LDSLMSMNTEITVMERILRALMEANREEESSLSVPDKKSEPLPS* |
Ga0070697_1006942721 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DSQNEEHWAGTLDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0070695_1007409161 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | SLMAMNTEITVMEKILRALMEANREEESPSLMAPDKKSEPLPS* |
Ga0070695_1008338081 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TLDSLMSMNTEITVMERILRALMEANREEEGLPVSVPDKKSEPLPS* |
Ga0070704_1014587322 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | GTLDSLMSMNTEITVMERILRALMEANREEEGLPVSVPDKKSEPLPS* |
Ga0066701_108941051 | 3300005552 | Soil | NTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0066695_106584192 | 3300005553 | Soil | TEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS* |
Ga0066700_100543281 | 3300005559 | Soil | MNTEITVMERILRALMEANREEESSIAVPDKKSEPLPS* |
Ga0066700_101800272 | 3300005559 | Soil | EITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0066705_102090131 | 3300005569 | Soil | AMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS* |
Ga0066694_106170812 | 3300005574 | Soil | DSSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS* |
Ga0066903_1058899032 | 3300005764 | Tropical Forest Soil | MNSEITVMERILRALMDANREEETLVAAPSDKKSEPLPS* |
Ga0066903_1090891171 | 3300005764 | Tropical Forest Soil | EHWAGTLDSLMSMNSEITVMERILRALMEANQEEESATVPASAKKSEPLPS* |
Ga0066903_1091139831 | 3300005764 | Tropical Forest Soil | NMNTEITVMERILRALMDANREEESVAVAPPTKKSEPLPS* |
Ga0081455_103358781 | 3300005937 | Tabebuia Heterophylla Rhizosphere | PFPRPSKGPVMNMNTEITVMERILRALMEANREEELQASPTAKKSEPLPS* |
Ga0066656_101824372 | 3300006034 | Soil | LDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0066658_106021021 | 3300006794 | Soil | AVLSNGDSSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS* |
Ga0066665_101879724 | 3300006796 | Soil | AGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS* |
Ga0066665_105058493 | 3300006796 | Soil | AGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLPS* |
Ga0066665_114393101 | 3300006796 | Soil | SLMAMNTEITVMEKILRALMEANREEESPSLMVPEKKSEPLPS* |
Ga0066659_100667883 | 3300006797 | Soil | DSSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS* |
Ga0066659_103384521 | 3300006797 | Soil | NTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS* |
Ga0066659_103982821 | 3300006797 | Soil | GDSSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEGSTSLMVPDKQSEPLLS* |
Ga0075433_107429172 | 3300006852 | Populus Rhizosphere | MNSEITVMERILRALMEANREEEAATPVLPAKKSEPLPS* |
Ga0075425_1029730431 | 3300006854 | Populus Rhizosphere | MNSEITVMERILRALMEANREEEAASPAVSAKKSEPLPS* |
Ga0075434_1018350222 | 3300006871 | Populus Rhizosphere | TLDSLMAMNSEITVMERILRALMEANREEEAASPAVSAKKSEPLPS* |
Ga0075424_1002984271 | 3300006904 | Populus Rhizosphere | TLDSLMAMNSEITVMERILRALMEANREEEAATPVLPAKKSEPLPS* |
Ga0075419_111861531 | 3300006969 | Populus Rhizosphere | LMSMNTEITVMERILRALMEANREEEGLPVSVPDKKSEPLPS* |
Ga0099791_103329971 | 3300007255 | Vadose Zone Soil | NTEITVMEKILRALMEANREEESPSLMLPDKESEPLLS* |
Ga0066710_1006689423 | 3300009012 | Grasslands Soil | AGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS |
Ga0066710_1008906173 | 3300009012 | Grasslands Soil | TLDSLMCMNSEITVMEKILRALMEANREEDASQIASPDKKSEPLPS |
Ga0066710_1015079362 | 3300009012 | Grasslands Soil | NTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS |
Ga0066710_1027610461 | 3300009012 | Grasslands Soil | ITVMEKILRALMEANREEESPSLMVPDKQSEPLLS |
Ga0099829_114711502 | 3300009038 | Vadose Zone Soil | AMNTEITVMEKILRALMEANREEESPSLMVPDKKSESLLS* |
Ga0075418_123641801 | 3300009100 | Populus Rhizosphere | LDSLMSMNTEITVMERILRALMEANREEEGLPVSMSDKKSEPLPS* |
Ga0066709_1017947042 | 3300009137 | Grasslands Soil | LTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS* |
Ga0066709_1040477522 | 3300009137 | Grasslands Soil | DRRHGGSLAGRVESPAAMNTGIPVREKILRAVMEANGEEESPSLVVHDKKSEPLPS* |
Ga0111538_138425851 | 3300009156 | Populus Rhizosphere | MNTEITVMERILRALMEANREEEGLPVSVPDKKSEPLPS* |
Ga0126384_120662922 | 3300010046 | Tropical Forest Soil | EITVMERILRALMEANREEEITATTSPAKKTEPLPS* |
Ga0134088_102477232 | 3300010304 | Grasslands Soil | SNGDSSNEEQWAGTLDSLMAMHTGITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0134088_103055471 | 3300010304 | Grasslands Soil | TEITVMEKILRALMEANREEESTSLMVPDKQSEPLLS* |
Ga0134109_101255833 | 3300010320 | Grasslands Soil | EAQWAGTHDSLTAMNTEIPVMEKILRAWMEANREEESPSLMVPDKLSEPLLS* |
Ga0134109_102493951 | 3300010320 | Grasslands Soil | EITVMEKILRALMEANREEDASQIASPDKKSEPLPS* |
Ga0134080_100543294 | 3300010333 | Grasslands Soil | NEEQWAGTLDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0134080_105107181 | 3300010333 | Grasslands Soil | SLMCMNGEITVMEKILRALMEANREEDSSQIASPDKKSEPLPS* |
Ga0134124_129647951 | 3300010397 | Terrestrial Soil | GTLDSLMSMNSEITVMEKILRALMEANREEEGTPLSVPDKKSDPLPS* |
Ga0134123_107024911 | 3300010403 | Terrestrial Soil | WAGTLDSLMNMNTEITVMERILRALMEANREEELQASPTAKKSEPLPS* |
Ga0137437_13173142 | 3300011442 | Soil | LDSLMNMNTEITVMERILRALMEANREEELQASPAAKKSEPLPS* |
Ga0137364_114243542 | 3300012198 | Vadose Zone Soil | AGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS* |
Ga0137383_108877501 | 3300012199 | Vadose Zone Soil | TEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0137363_112139291 | 3300012202 | Vadose Zone Soil | DSLTAINTEITVMEKILRALMEANREEESPSLMVPDEQSEPLLS* |
Ga0137362_100592619 | 3300012205 | Vadose Zone Soil | AGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPVLS* |
Ga0137380_108475832 | 3300012206 | Vadose Zone Soil | WAGTLDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0137376_102774213 | 3300012208 | Vadose Zone Soil | TEITVMEKILRALMEANREEGSTSLMVPDKQSEPLLS* |
Ga0137377_101565861 | 3300012211 | Vadose Zone Soil | GDSSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS* |
Ga0137377_104382661 | 3300012211 | Vadose Zone Soil | SNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS* |
Ga0137360_102846631 | 3300012361 | Vadose Zone Soil | TVMEKILRALMEANREEESPSLMVPDKQSEPVLS* |
Ga0137360_103593972 | 3300012361 | Vadose Zone Soil | WAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKESEPLLS* |
Ga0137361_104986041 | 3300012362 | Vadose Zone Soil | QWAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS* |
Ga0137359_100313552 | 3300012923 | Vadose Zone Soil | VAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS* |
Ga0137407_113053041 | 3300012930 | Vadose Zone Soil | SSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLPS* |
Ga0134110_100497894 | 3300012975 | Grasslands Soil | ITVMEKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0134110_100642811 | 3300012975 | Grasslands Soil | DSLTAMNTEITVMEKILRALMEANREEGSPSLMVPDKQSEPLLS* |
Ga0134081_102643723 | 3300014150 | Grasslands Soil | GDSSDEAQWAGTHDSLTAMNTEITVMEKILRALMEANREEESASLMVPDKQSEPLLS* |
Ga0134078_102702323 | 3300014157 | Grasslands Soil | EEQWADTLDSLTAMNTEITVMEKILRALMEANREEESASLMVRDKQSEPLLS* |
Ga0075323_11380673 | 3300014301 | Natural And Restored Wetlands | MNMSTEITVMERILRALMEANREEELSRGPAAKKSEPLPS* |
Ga0134089_104426091 | 3300015358 | Grasslands Soil | NGDSSNEEQWAGTLDSLMAMNTEITVMGKILRALMEANREEESPSLMVPDKKSEPLPS* |
Ga0182039_107658941 | 3300016422 | Soil | NTEITVMERILRALMEANQEEETGAVQTAAKKSEPLPS |
Ga0134069_11563651 | 3300017654 | Grasslands Soil | EEQWAGTPDSLTAMNTEITVMEKILRALMEANREEESSSLMVPDKQSEPLLS |
Ga0134074_10428903 | 3300017657 | Grasslands Soil | DSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS |
Ga0134074_10673844 | 3300017657 | Grasslands Soil | DSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS |
Ga0066655_101331322 | 3300018431 | Grasslands Soil | AMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS |
Ga0066667_101883653 | 3300018433 | Grasslands Soil | MCMNSEITVMEKILRALMEANREEDASQIASPDKKSEPLPS |
Ga0066667_117221331 | 3300018433 | Grasslands Soil | NTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS |
Ga0187893_100627991 | 3300019487 | Microbial Mat On Rocks | SLMNMNTEITVMERILRALMEANREEELSTGSATKKSEPLPS |
Ga0207684_111080201 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PDEHWAGTLDSLMSMNTEITVMERILRALMEANREEESSTAVPDKKSEPLPS |
Ga0207686_117350241 | 3300025934 | Miscanthus Rhizosphere | LMAMNSEITVMERILRALMEANREEEAASPAVSAKKSEPLPS |
Ga0209350_10811371 | 3300026277 | Grasslands Soil | GTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS |
Ga0209265_11388711 | 3300026308 | Soil | EAQWAGTHDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKLSEPLLS |
Ga0209470_10214518 | 3300026324 | Soil | GDSSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS |
Ga0209266_10113661 | 3300026327 | Soil | GDSSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESTSLMVPDKQSEPLLS |
Ga0209266_10630933 | 3300026327 | Soil | GDSSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLLS |
Ga0209804_12664301 | 3300026335 | Soil | EITVMERILRALMEANREEESSIAVPDKKSEPLPS |
Ga0209808_10886064 | 3300026523 | Soil | AMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS |
Ga0209807_11166494 | 3300026530 | Soil | TEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS |
Ga0209160_12271071 | 3300026532 | Soil | SLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLLS |
Ga0209058_10989683 | 3300026536 | Soil | DSSNEEQWAGTLDSLTAMNTEITVMEKILRALMEANREEESASLMVPDKQSEPLLS |
Ga0209157_12649921 | 3300026537 | Soil | EITVMEKILRALMEANREEESPSLMVPDKKSEPLPS |
Ga0209056_102374234 | 3300026538 | Soil | WAGTLDSLTAMNTEITVMEKILRALMEANREEESPSLMVPDKQSEPLPS |
Ga0209689_10605741 | 3300027748 | Soil | EEQWAGTLDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS |
Ga0209811_101571212 | 3300027821 | Surface Soil | GTLDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS |
Ga0247818_106738872 | 3300028589 | Soil | SLMSMNTEITVMERILRALMEANREEEGLPISMSDKKSEPLPS |
Ga0247825_108348902 | 3300028812 | Soil | GTLDSLMSMNTEITVMERILRALMEANREEEGLPVSVPDKKSEPLPS |
Ga0247826_111747102 | 3300030336 | Soil | TLDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS |
Ga0318547_101858091 | 3300031781 | Soil | EHWAGTLDSLMNMNTEITVMERILRALMEANQEEESGAVPTAAKKSEPLPS |
Ga0318517_105405791 | 3300031835 | Soil | GTLDGLMNMNTEITVMERILRALMDANREEESVAVAPPTKKSEPLPS |
Ga0318551_107182641 | 3300031896 | Soil | LMNMNTEITVMERILRALLEANQEEVAGTVPTAAKKSEPLPS |
Ga0318518_105554601 | 3300032090 | Soil | MNTEITVMERILRALMEANQEEETGAAPTAAKKSEPLPS |
Ga0307471_1003524113 | 3300032180 | Hardwood Forest Soil | NGDSSNEEQWAGTLDSLMAMNTEITVMEKILRALMEANREEESPSLMVPDKKSEPLPS |
Ga0315271_115007551 | 3300032256 | Sediment | DSLMTMNQEITVMERILRALMEANREEETSPMATPDKKSDPLPS |
Ga0335070_102536391 | 3300032829 | Soil | EITIMERILRALMEANREEETAAPLAVPGKKNEPLPS |
Ga0326726_108601691 | 3300033433 | Peat Soil | EITVMERILRALMDANREEETAANAGPDKKSEPVPS |
⦗Top⦘ |