NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068572

Metagenome / Metatranscriptome Family F068572

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068572
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 46 residues
Representative Sequence GPYIANMNAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR
Number of Associated Samples 112
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 0.00 %
% of genes from short scaffolds (< 2000 bps) 83.87 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (94.355 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater
(14.516 % of family members)
Environment Ontology (ENVO) Unclassified
(50.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(71.774 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.78%    β-sheet: 0.00%    Coil/Unstructured: 65.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF13550Phage-tail_3 5.65
PF00583Acetyltransf_1 4.84
PF09718Tape_meas_lam_C 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.19 %
UnclassifiedrootN/A0.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000176|TB03JUN2009E_c035829All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes667Open in IMG/M
3300000439|TBL_comb48_EPIDRAFT_1043076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1705Open in IMG/M
3300000553|TBL_comb47_HYPODRAFT_10080019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1743Open in IMG/M
3300000553|TBL_comb47_HYPODRAFT_10106923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1354Open in IMG/M
3300001523|JGI1221J15618_1121984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1160Open in IMG/M
3300001580|Draft_10475132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes504Open in IMG/M
3300001836|RCM27_1060583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes513Open in IMG/M
3300001848|RCM47_1168629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes627Open in IMG/M
3300002091|JGI24028J26656_1016354All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes788Open in IMG/M
3300002098|JGI24219J26650_1007097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2114Open in IMG/M
3300002220|MLSBCLC_10179238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2169Open in IMG/M
3300002476|metazooDRAFT_10781565All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes564Open in IMG/M
3300003375|JGI26470J50227_1031812All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1042Open in IMG/M
3300003375|JGI26470J50227_1040400All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes868Open in IMG/M
3300003785|Ga0007851_101183All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1679Open in IMG/M
3300003789|Ga0007835_1004064All Organisms → Viruses → Predicted Viral1561Open in IMG/M
3300003796|Ga0007865_1026079All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes535Open in IMG/M
3300003797|Ga0007846_1007771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1111Open in IMG/M
3300003812|Ga0007861_1003820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1554Open in IMG/M
3300004694|Ga0065170_1001571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3167Open in IMG/M
3300005527|Ga0068876_10187040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1205Open in IMG/M
3300005805|Ga0079957_1019460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4787Open in IMG/M
3300006100|Ga0007806_1047194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes832Open in IMG/M
3300006101|Ga0007810_1001005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes8257Open in IMG/M
3300006805|Ga0075464_10521162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes728Open in IMG/M
3300006863|Ga0075459_1018135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1166Open in IMG/M
3300006875|Ga0075473_10127993All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1014Open in IMG/M
3300006920|Ga0070748_1274406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes603Open in IMG/M
3300006920|Ga0070748_1364820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes508Open in IMG/M
3300007276|Ga0070747_1237523All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes635Open in IMG/M
3300007516|Ga0105050_10527965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes694Open in IMG/M
3300007559|Ga0102828_1013714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1693Open in IMG/M
3300007559|Ga0102828_1117907All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes653Open in IMG/M
3300007559|Ga0102828_1121807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes643Open in IMG/M
3300008107|Ga0114340_1235551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300008110|Ga0114343_1213152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes547Open in IMG/M
3300008266|Ga0114363_1012849All Organisms → Viruses → Predicted Viral4295Open in IMG/M
3300008448|Ga0114876_1240207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes572Open in IMG/M
3300009085|Ga0105103_10769872All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes557Open in IMG/M
3300009154|Ga0114963_10003903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes10203Open in IMG/M
3300009155|Ga0114968_10376354All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes779Open in IMG/M
3300009163|Ga0114970_10323983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes872Open in IMG/M
3300009165|Ga0105102_10608724All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes604Open in IMG/M
3300009165|Ga0105102_10723200All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes561Open in IMG/M
3300009183|Ga0114974_10115544All Organisms → Viruses → Predicted Viral1711Open in IMG/M
3300009183|Ga0114974_10612339All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes599Open in IMG/M
3300010160|Ga0114967_10333058All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes771Open in IMG/M
3300010966|Ga0137675_1003256All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1189Open in IMG/M
3300011995|Ga0153800_1029992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes571Open in IMG/M
3300012348|Ga0157140_10000631All Organisms → Viruses → Predicted Viral4278Open in IMG/M
3300012352|Ga0157138_1014892All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1264Open in IMG/M
3300013286|Ga0136641_1185254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes554Open in IMG/M
3300014819|Ga0119954_1084204All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes511Open in IMG/M
3300014960|Ga0134316_1024454All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes673Open in IMG/M
3300017716|Ga0181350_1059470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes999Open in IMG/M
3300017778|Ga0181349_1013784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3338Open in IMG/M
3300019784|Ga0181359_1200864All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
3300020205|Ga0211731_11313427All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes642Open in IMG/M
3300020705|Ga0214177_1008792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1308Open in IMG/M
3300020711|Ga0214237_1013977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1032Open in IMG/M
3300021115|Ga0214174_104726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1191Open in IMG/M
3300021121|Ga0214173_104014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1720Open in IMG/M
3300021125|Ga0214211_1001972All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2684Open in IMG/M
3300021136|Ga0214167_1050745All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes852Open in IMG/M
3300021138|Ga0214164_1053705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes871Open in IMG/M
3300021138|Ga0214164_1101777All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes538Open in IMG/M
3300021354|Ga0194047_10222360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes743Open in IMG/M
3300021519|Ga0194048_10133133All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes942Open in IMG/M
3300021519|Ga0194048_10235717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes670Open in IMG/M
3300021519|Ga0194048_10237746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes666Open in IMG/M
3300021956|Ga0213922_1095950All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes603Open in IMG/M
3300021962|Ga0222713_10264640All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1113Open in IMG/M
3300022179|Ga0181353_1117064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes640Open in IMG/M
3300022555|Ga0212088_10542031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes735Open in IMG/M
3300022844|Ga0222687_1011670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1872Open in IMG/M
3300023184|Ga0214919_10715389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes564Open in IMG/M
3300024306|Ga0255148_1027681All Organisms → Viruses → Predicted Viral1062Open in IMG/M
3300024354|Ga0255171_1047047All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes816Open in IMG/M
3300024509|Ga0255175_1042425All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes866Open in IMG/M
3300025369|Ga0208382_1013660All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1202Open in IMG/M
3300025383|Ga0208250_1031215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes839Open in IMG/M
3300025387|Ga0207959_1002063All Organisms → Viruses → Predicted Viral4394Open in IMG/M
3300025389|Ga0208257_1031355All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes785Open in IMG/M
3300025398|Ga0208251_1004343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3145Open in IMG/M
3300025400|Ga0208387_1026772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1003Open in IMG/M
3300025413|Ga0208614_1020410All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1089Open in IMG/M
3300025445|Ga0208424_1008251All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1166Open in IMG/M
3300025450|Ga0208744_1005233All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3118Open in IMG/M
3300025466|Ga0208497_1011720All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2238Open in IMG/M
3300025645|Ga0208643_1035014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1631Open in IMG/M
3300025732|Ga0208784_1100708All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes865Open in IMG/M
3300025761|Ga0256310_1041919All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes709Open in IMG/M
3300025887|Ga0208544_10187519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes863Open in IMG/M
3300025896|Ga0208916_10376121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes620Open in IMG/M
3300027129|Ga0255067_1049279All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes601Open in IMG/M
3300027151|Ga0255063_1095864All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes529Open in IMG/M
3300027193|Ga0208800_1033747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes688Open in IMG/M
3300027300|Ga0255140_1030113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1070Open in IMG/M
3300027302|Ga0255096_1009633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2427Open in IMG/M
3300027467|Ga0255154_1055294All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes889Open in IMG/M
3300027529|Ga0255077_1048792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes786Open in IMG/M
3300027597|Ga0255088_1057888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes755Open in IMG/M
3300027649|Ga0208960_1091000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage846Open in IMG/M
3300027741|Ga0209085_1002661All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes10070Open in IMG/M
3300027764|Ga0209134_10345799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300027793|Ga0209972_10114425All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1336Open in IMG/M
3300027896|Ga0209777_10053883All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3622Open in IMG/M
3300027896|Ga0209777_11091357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes540Open in IMG/M
3300027969|Ga0209191_1301924All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes593Open in IMG/M
3300027976|Ga0209702_10054076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2244Open in IMG/M
3300028108|Ga0256305_1054834All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes991Open in IMG/M
3300031758|Ga0315907_10813597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes696Open in IMG/M
3300031787|Ga0315900_10017881All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes8349Open in IMG/M
3300031787|Ga0315900_10174859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1944Open in IMG/M
3300032053|Ga0315284_11012459All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes935Open in IMG/M
3300032275|Ga0315270_10169957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1323Open in IMG/M
3300032560|Ga0316223_1136158All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes831Open in IMG/M
3300032676|Ga0316229_1313169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes570Open in IMG/M
3300033996|Ga0334979_0389350All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes773Open in IMG/M
3300034061|Ga0334987_0838398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes507Open in IMG/M
3300034104|Ga0335031_0106548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1972Open in IMG/M
3300034106|Ga0335036_0896072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes504Open in IMG/M
3300034116|Ga0335068_0428690All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes627Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater14.52%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater9.68%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater6.45%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.45%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater4.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.84%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater3.23%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.23%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.23%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.42%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.42%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.42%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic1.61%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.61%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.61%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton1.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater1.61%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments1.61%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.81%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater0.81%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.81%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.81%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.81%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water0.81%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.81%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.81%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.81%
HypersalineEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000176Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300000439Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300000553Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300001523Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micronEnvironmentalOpen in IMG/M
3300001580Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6EngineeredOpen in IMG/M
3300001836Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3aEnvironmentalOpen in IMG/M
3300001848Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3aEnvironmentalOpen in IMG/M
3300002091Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenomeEnvironmentalOpen in IMG/M
3300002098Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenomeEnvironmentalOpen in IMG/M
3300002220Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011EngineeredOpen in IMG/M
3300002476Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012EnvironmentalOpen in IMG/M
3300003375Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6EnvironmentalOpen in IMG/M
3300003785Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08EnvironmentalOpen in IMG/M
3300003789Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08EnvironmentalOpen in IMG/M
3300003796Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09EnvironmentalOpen in IMG/M
3300003797Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07EnvironmentalOpen in IMG/M
3300003812Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08EnvironmentalOpen in IMG/M
3300004694Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006100Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09EnvironmentalOpen in IMG/M
3300006101Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010966Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016EnvironmentalOpen in IMG/M
3300011995Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012348Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44EnvironmentalOpen in IMG/M
3300012352Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37EnvironmentalOpen in IMG/M
3300013286Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23YEnvironmentalOpen in IMG/M
3300014819Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011AEnvironmentalOpen in IMG/M
3300014960Surface water microbial communities from Bangladesh - BaraHaldiaSW0709EnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020705Freshwater microbial communities from Trout Bog Lake, WI - 27AUG2007 epilimnionEnvironmentalOpen in IMG/M
3300020711Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 hypolimnionEnvironmentalOpen in IMG/M
3300021115Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021121Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021125Freshwater microbial communities from Trout Bog Lake, WI - 11AUG2009 epilimnionEnvironmentalOpen in IMG/M
3300021136Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnionEnvironmentalOpen in IMG/M
3300021138Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300021354Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5mEnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300022844Saline water microbial communities from Ace Lake, Antarctica - #1163EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300023700Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024306Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300024354Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8dEnvironmentalOpen in IMG/M
3300024509Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8dEnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025383Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025387Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025389Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025398Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025400Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025413Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025445Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025450Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025466Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025761Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027129Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8hEnvironmentalOpen in IMG/M
3300027151Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027300Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8dEnvironmentalOpen in IMG/M
3300027302Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8dEnvironmentalOpen in IMG/M
3300027467Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8hEnvironmentalOpen in IMG/M
3300027529Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8hEnvironmentalOpen in IMG/M
3300027597Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8dEnvironmentalOpen in IMG/M
3300027649Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028108Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032560Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009EnvironmentalOpen in IMG/M
3300032676Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TB03JUN2009E_03582913300000176FreshwaterYIANMSAIDTQSSVQFLAKNKTAVWAANQSAQQSLPATR*
TBL_comb48_EPIDRAFT_104307613300000439FreshwaterSAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR*
TBL_comb47_HYPODRAFT_1008001943300000553FreshwaterYNGPYIASMSAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR*
TBL_comb47_HYPODRAFT_1010692333300000553FreshwaterVMGGSNQPSVMYNGPYIANMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR*
JGI1221J15618_112198413300001523HypersalineYNGPVIQNMQAIDTQSGIQFLAKNKMTIWSMNQSANRSIPAGR*
Draft_1047513213300001580Hydrocarbon Resource EnvironmentsNLSAIDTQSGMQFLMKNKESIWSANQSASRGLPASR*
RCM27_106058323300001836Marine PlanktonNGPYIASMSAIDTQSATQFLARNKAAVWAANQSAQRSVPVSR*
RCM47_116862923300001848Marine PlanktonYIANMSAIDTQSAQQFLAKNRNSVFAANQSALRSLPVSR*
JGI24028J26656_101635423300002091LenticIANMSAIDTQSAMAFIAKNQNSIWAANQAAQRSLPQSR*
JGI24219J26650_100709753300002098LenticNMSAIDTQSATQFLAKNKQGVWAANQSAQLSLPQSR*
MLSBCLC_1017923813300002220Hydrocarbon Resource EnvironmentsPNQQMNNFQQQPQIVYNGPYIQNMSAIDTQSATQFLSRNKEAVYAANLSAGRSVPTSR*
metazooDRAFT_1078156513300002476LakeAGAMGGAPQAVYNGPYIANMSAIDTQSAVQFLARNKMAVYSANMSASRSVPTSTR*
JGI26470J50227_103181233300003375FreshwaterYNGPYIANMSAIDTQSAMSFIAKNQNSIWAANQAAQRSLPQSR*
JGI26470J50227_104040013300003375FreshwaterPNNSLSSSMGSQPQIVYNGPYIANMSAIDTQTSVQFLAKNKTAVWAANQSAQQSLPQSR*
Ga0007851_10118313300003785FreshwaterDVMGGSNQPSVMYNGPYIANMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR*
Ga0007835_100406443300003789FreshwaterGQSVTYNGPYIASMQAIDTQSATTFLARNKTAVWAANQSAQRSLPQSR*
Ga0007865_102607913300003796FreshwaterVMNSSSGGVTYNGPYIANMSAIDTQSATQFLARNQTAVWSANQAAQRGLPSSR*
Ga0007846_100777113300003797FreshwaterVMGGSNQPSVVYNGPYIQQMSAIDTQSATQFLARNQNAVWAANQSAQRSLPQSR*
Ga0007861_100382013300003812FreshwaterQSVTYNGPYIASMQAIDTQSATTFLAKNKTAVWAANQSAQRSLPQSR*
Ga0065170_100157113300004694FreshwaterPYIASMQAIDTQSATQFLARNKTAVWAANQSAQRSLPQSR*
Ga0068876_1018704013300005527Freshwater LakeMGGQTINYNGPIIQNMNAIDTQSGLQFLAKNKQGVFAAYQSANRSIPMSR*
Ga0079957_101946013300005805LakeGPYIANMQAIDTQSATQFLATNKQAVWSANQSAQRGLPQSR*
Ga0007806_104719423300006100FreshwaterMSGSQQPATVYNGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR*
Ga0007810_1001005113300006101FreshwaterSSSMGNQAQIVYNGPYIANMSAIDTQSSVQFLAKNKTAVWAANQSAQQSLPATR*
Ga0075464_1052116213300006805AqueousTTVNYNGPYIASMSAVDTQSGVQFLAKNKQAVWATYQSANRSIPMSR*
Ga0075459_101813533300006863AqueousGQPQVVYNGPYIANMQAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR*
Ga0075473_1012799313300006875AqueousGQPQMVINGPYIENMSAIDTQSGQQFLAKNKNTIWAAYQSANRTVPLSR*
Ga0070748_127440623300006920AqueousPYIANMSAIDTQSGAQFLAKNKQAVWATYQSANRSIPVTR*
Ga0070748_136482013300006920AqueousIANMSAIDTQTGVQFLAKNKQTIWASYQSANRSVPVSR*
Ga0070747_123752313300007276AqueousQQLSSMNGQPSVVYNGPYIANMQAIDTQSGVQFLAKNKMTIWSLNQSANRSIPAGR*
Ga0105050_1052796523300007516FreshwaterPVIQNMQAIDTQSGIQFLAKNKMTIWSMNQSANRSIPAGR*
Ga0102828_101371413300007559EstuarineIASMSAIDTQSATQFLSQNKQTIWAVNQSASRSMPTSR*
Ga0102828_111790713300007559EstuarineVVYNGPYIANMSAIDTQSAAQFLAKNKEAVWGANQSAQRSLPQSR*
Ga0102828_112180723300007559EstuarineVFNGPYIANMSAIDTQSGIQFLAKNKMTIWSMNQSANRSVPAGR*
Ga0114340_123555123300008107Freshwater, PlanktonGQTINYNGPIIQNMSAIDTQSGLQFLAKNKQGVFAAYQSANRSIPVSR*
Ga0114343_121315213300008110Freshwater, PlanktonNLSAIDTQSALQFLSQNKQAIYAANQSAARSVPTSR*
Ga0114363_101284923300008266Freshwater, PlanktonMNAIDTQSGLQFLAKNKQGVFAAYQSANRSIPMSR*
Ga0114876_124020723300008448Freshwater LakeIIQNMSAIDTQSGVAFLSKNKQAVWAANQSAQRSLPVSR*
Ga0105103_1076987223300009085Freshwater SedimentLSSMSGQPQVVYNGPYIANMQAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR*
Ga0114963_10003903123300009154Freshwater LakePTINYNGPYIASMSAIDTQSGLQFLAKNKQSVWAAYQSANRSVPMSR*
Ga0114968_1037635423300009155Freshwater LakeGQTVNYNGPYIASMSAIDTQSATQFLSQNKQTIWAVNQSASRSMPTSR*
Ga0114970_1032398313300009163Freshwater LakeAMGGSQVVYNGPYIAQMNAIDTQSATQFLSKNKQAVWAANQSASRGVPASRA*
Ga0105102_1060872413300009165Freshwater SedimentIANMSAIDTQSATQFLATNKQAVWSANQSAQRGLPQSR*
Ga0105102_1072320023300009165Freshwater SedimentPVVEHLSAIDTQSGMQFLMKNKESIWSANQSASRGLPASR*
Ga0114974_1011554413300009183Freshwater LakeTVNYNGPYIASMSAIDTQSATQFLSQNKQTIWAVNQSASRSMPTSR*
Ga0114974_1061233913300009183Freshwater LakeNQPQVVYNGPYIANMSAIDTQSGLQFLAKNKQGVWAANQSAQRSLPQSR*
Ga0114967_1033305813300010160Freshwater LakeNGPYIQNMSAIDTQSSIQFLAKNKQAVWSANQSAQRSLPQSR*
Ga0137675_100325633300010966Pond Fresh WaterGPYIASMQAIDTQSGIQFLAKNKMTIWSMNQSANRSIPAGR*
Ga0153800_102999213300011995FreshwaterYNGPYIASMSAIDTQSATQFLSRNKQAVFAANQSATRSLPQSR*
Ga0157140_1000063153300012348FreshwaterYIANMSAIDTQSGMQFLMQNKQSIWAANQSAQRSLPVSK*
Ga0157138_101489233300012352FreshwaterNKMLGAMSNNQPQVVYNGPYIANMSAIDTQSATQFLAKNKQTIWAVNQSAQRSLPVSK*
Ga0136641_118525413300013286FreshwaterIANMSAIDTQTGLQFLAKNKQGVWAANQSAQRGIPQSR*
Ga0119954_108420413300014819FreshwaterGQLSGMMGNQPQVVYNGPYIANMSAIDTQSAAQFLAKNKMSVWAANQSANRSIPVSR*
Ga0134316_102445423300014960Surface WaterGGGQQIIYNGPYIANMSAIDTQSASQFLAKNKDAVWAANQSANRSIPSSR*
Ga0181350_105947013300017716Freshwater LakeMSASDTQSAAQFLAKNKEAVWGANQSAQRSLPQSR
Ga0181349_101378453300017778Freshwater LakeQVVYNGPYIASMSAIDTQSATQFLSRNKQAVFAANQSATRSLPQSR
Ga0181359_120086423300019784Freshwater LakeDGNYIANMSAIDTQSGMAFLAKNKDTIWAAYQSANRSVPISR
Ga0211731_1131342723300020205FreshwaterGPVIQNMQAIDTQSGLQFLAKNKMNIWAINQSASRSIATSR
Ga0214177_100879233300020705FreshwaterQPATVYNGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR
Ga0214237_101397713300020711FreshwaterMSAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR
Ga0214174_10472613300021115FreshwaterMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR
Ga0214173_10401413300021121FreshwaterDVMGGSNQPSVMYNGPYIANMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR
Ga0214211_100197253300021125FreshwaterPYIQQMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR
Ga0214167_105074523300021136FreshwaterSGGGITYNGPYIGQMSAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR
Ga0214164_105370523300021138FreshwaterSALSANSGGGITYNGPYIGQMSAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR
Ga0214164_110177723300021138FreshwaterPATVYNGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR
Ga0194047_1022236023300021354Anoxic Zone FreshwaterANMSAIDTQSAMQFLASNKMAIWSANQSASRSIPASR
Ga0194048_1013313313300021519Anoxic Zone FreshwaterPYIANMSAIDTQSSLQFLAKNKQGVWAANQSAQRSLPQSR
Ga0194048_1023571713300021519Anoxic Zone FreshwaterSQPQVVYNGPYIANMNAIDTQSGTQFLAKNKQAVWSANQSAQRSLPQSR
Ga0194048_1023774613300021519Anoxic Zone FreshwaterGPYIANMSAIDTQSATDFLAKNKMTIWAVNQSANRSIPTSR
Ga0213922_109595013300021956FreshwaterMGGGPQVVYNGPYIANMNAIDTQSATQFLAKNKQAVWSANQSAQRSFPQSR
Ga0222713_1026464013300021962Estuarine WaterNMSAIDTQSGLQFLAKNKQGVWAANQSAQRSLPQSR
Ga0181353_111706413300022179Freshwater LakeANMSAIDTQSATQFLASNKQTIWAAYQSANRMVPISR
Ga0212088_1054203113300022555Freshwater Lake HypolimnionYNGPYIGQMSAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR
Ga0222687_101167013300022844Saline WaterIQNMQAIDTQSGIQFLAKNKMTIWSMNQSANRSIPAGR
Ga0214919_1071538923300023184FreshwaterTVVPNNQLSSHLGQGAQNVFNGPYIANMSAIDTQSSMQFISKNKEMIWAANQSASRSLQASR
Ga0228707_102034733300023700FreshwaterVFNQMLGGGGQTVNYNGPYIANMSAIDTQSSIQFLSKNKQAVWAANQSAQRALPVSR
Ga0255148_102768113300024306FreshwaterIQSMIAIDTQTGVQFLVKNKQTIWAANQSAQRALPASR
Ga0255171_104704723300024354FreshwaterGPYIANMNAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR
Ga0255175_104242523300024509FreshwaterKLTSMGGGPQVVYNGPYIANMNAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR
Ga0208382_101366013300025369FreshwaterVYNGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR
Ga0208250_103121513300025383FreshwaterDAMSGSQQPATVYNGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR
Ga0207959_100206313300025387FreshwaterPYIASMQAIDTQSATTFLAKNKTAVWAANQSAQRSLPQSR
Ga0208257_103135523300025389FreshwaterVMNSSSGGVTYNGPYIANMSAIDTQSATQFLARNQVAVWSANQAAQRGLPQSR
Ga0208251_100434313300025398FreshwaterLSSSMGNQAQIVYNGPYIANMSAIDTQSSVQFLAKNKTAVWAANQSAQQSLPATR
Ga0208387_102677233300025400FreshwaterMYNGPYIANMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR
Ga0208614_102041013300025413FreshwaterAQIVYNGPYIANMSAIDTQSSVQFLAKNKTAVWAANQSAQQSLPATR
Ga0208424_100825133300025445AqueousGQPQVVYNGPYIANMQAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR
Ga0208744_100523353300025450FreshwaterNSLSASMGNQAQIVYNGPYIANMSAIDTQSSVQFLAKNKTAVWAANQSAQQSLPATR
Ga0208497_101172013300025466FreshwaterTYNGPYIASMSAIDTQSALQFIAKNQNSIWAANQAAQRSLPQSR
Ga0208643_103501413300025645AqueousTVNYNGPYIASMSAVDTQSGVQFLAKNKQAVWATYQSANRSIPMSR
Ga0208784_110070813300025732AqueousMGQPQMVINGPYIENMSAIDTQSGQQFLAKNKNTIWAAYQSANRTVPLSR
Ga0256310_104191913300025761FreshwaterNMSAIDTQSAAQFLAKNKMSVWSANQSASRSVPTSK
Ga0208544_1018751913300025887AqueousGGTTVNYNGPYIASMSAVDTQSGVQFLAKNKQAVWATYQSANRSIPMSR
Ga0208916_1037612123300025896AqueousNLASSMGNGGQTVNYNGPYIANMSAIDTQSGMQFLAKNKQTIWASYQSANRSVPVSR
Ga0255067_104927913300027129FreshwaterHALAGAMGGQVINYNGPIIQNMSAIDTQSGIAFLAKNKQAVWAANQSAQRSLPVSR
Ga0255063_109586423300027151FreshwaterTINYNAPYIANMSAIDTQSGVQFLAKNKEAVWSANQSASRGLPTSR
Ga0208800_103374723300027193EstuarineGQTVNYNGPYIASMSAIDTQSATQFLSQNKQTIWAVNQSASRSMPTSR
Ga0255140_103011323300027300FreshwaterNGPIIQNMSAIDTQSGLQFLAKNKQGVFAAYQSANRSIPVSR
Ga0255096_100963353300027302FreshwaterINYNGPIIQNMSAIDTQSGIAFLAKNKQAVWAANQSAQRSLPVSR
Ga0255154_105529413300027467FreshwaterLASMMGSGQTINYNGPFIQQMSAIDTQSGIQFLTQNKQAVWAANQSAQRSLPVSR
Ga0255077_104879213300027529FreshwaterSSAMSGGPQVVYNGPYIASMSAIDTQSATQFLSRNKQAVFAANQSATRSLPQSRS
Ga0255088_105788823300027597FreshwaterPYIANMSAIDTQSGVQFLAKNKEAVWSANQSASRGLPTSR
Ga0208960_109100023300027649Freshwater LenticTYIANMSAIDTQSATQFLASNKNTIWAAYQSANRSVPISR
Ga0209085_1002661113300027741Freshwater LakePTINYNGPYIASMSAIDTQSGLQFLAKNKQSVWAAYQSANRSVPMSR
Ga0209134_1034579923300027764Freshwater LakeANMQAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR
Ga0209972_1011442513300027793Freshwater LakeMQAIDTQSATQFLARNKEAVYAANLSATRSLPASR
Ga0209777_1005388313300027896Freshwater Lake SedimentSMGSQPQIVYNGPYIANMSAIDTQTSVQFLAKNKTAVWAANQSAQQSLPQSR
Ga0209777_1109135713300027896Freshwater Lake SedimentNGPYIANMSAIDTQSATQFLANNKQAVWSANISAQRGLPQSR
Ga0209191_130192423300027969Freshwater LakeVNSLMGNQPQVVYNGPYIANMSAIDTQSGLQFLAKNKQGVWAANQSAQRSLPQSR
Ga0209702_1005407653300027976FreshwaterVTYNGPVIQNMQAIDTQSGIQFLAKNKMTIWSMNQSANRSIPAGR
Ga0256305_105483413300028108FreshwaterGPYIENMSAIDTQSAAQFLAKNKMSVWSANQSASRSVPTSK
Ga0315907_1081359713300031758FreshwaterGSQPQVVYNAPVVQNLSAIDTQSALQFLSQNKQAIYAANQSAARSVPTSR
Ga0315900_10017881113300031787FreshwaterMGGQTINYNGPIIQNMNAIDTQSGLQFLAKNKQGVFAAYQSANRSIPMSR
Ga0315900_1017485913300031787FreshwaterINYNGPIIQNMNAIDTQSGLQFLAKNKQGVFAAYQSANRSIPTSR
Ga0315284_1101245933300032053SedimentNMSAIDTQSGIQFLSKNKETIWSANQSAQRSLPQGR
Ga0315270_1016995713300032275SedimentNHQLSLGGGGGGTTVNYNGPYIASMSAVDTQSGVQFLAKNKQAVWATYQSANRSIPMSR
Ga0316223_113615823300032560FreshwaterSNQPSVMYNGPYIANMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR
Ga0316229_131316923300032676FreshwaterNGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR
Ga0334979_0389350_601_7563300033996FreshwaterMGNQPQIVYNGPYIANMSAIDTQSATQFLATNKQAVWSANQSAQRGLPQSR
Ga0334987_0838398_2_1243300034061FreshwaterPYIANMQAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR
Ga0335031_0106548_1777_19353300034104FreshwaterMMGGGGGLTVNGNYIANMSAIDTQSATQFLASNKQTIWAAYQSANRMVPISR
Ga0335036_0896072_301_4593300034106FreshwaterMGGGPQVVYNGPYIANMQAIDTQSSIQFLAKNKDAVWAANQSAQRSLPQSRA
Ga0335068_0428690_3_1763300034116FreshwaterIAPSLAGMQQPQVVYNGPYIENMSAIDTQSAAQFLSKNKMSVWAANKSADRSVPVSR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.