Basic Information | |
---|---|
Family ID | F068517 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 40 residues |
Representative Sequence | MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQPSK |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.87 % |
% of genes near scaffold ends (potentially truncated) | 22.58 % |
% of genes from short scaffolds (< 2000 bps) | 72.58 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.194 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.097 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.032 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.290 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF02737 | 3HCDH_N | 34.68 |
PF00696 | AA_kinase | 19.35 |
PF13840 | ACT_7 | 8.87 |
PF01842 | ACT | 6.45 |
PF01494 | FAD_binding_3 | 4.84 |
PF00753 | Lactamase_B | 4.84 |
PF01717 | Meth_synt_2 | 2.42 |
PF13185 | GAF_2 | 1.61 |
PF02518 | HATPase_c | 1.61 |
PF14079 | DUF4260 | 0.81 |
PF13561 | adh_short_C2 | 0.81 |
PF13847 | Methyltransf_31 | 0.81 |
PF04279 | IspA | 0.81 |
PF14833 | NAD_binding_11 | 0.81 |
PF00171 | Aldedh | 0.81 |
PF14534 | DUF4440 | 0.81 |
PF13763 | DUF4167 | 0.81 |
PF13924 | Lipocalin_5 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 34.68 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 34.68 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 34.68 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 34.68 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 34.68 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 34.68 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 34.68 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 9.68 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 4.84 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 4.84 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 4.84 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 2.42 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.81 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.81 |
COG2917 | Intracellular septation protein A | Cell cycle control, cell division, chromosome partitioning [D] | 0.81 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.81 % |
Unclassified | root | N/A | 24.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004092|Ga0062389_102228178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 721 | Open in IMG/M |
3300004092|Ga0062389_103371993 | Not Available | 599 | Open in IMG/M |
3300004092|Ga0062389_103378317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 598 | Open in IMG/M |
3300004635|Ga0062388_100041465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2924 | Open in IMG/M |
3300005332|Ga0066388_100024324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5452 | Open in IMG/M |
3300005332|Ga0066388_102256484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 984 | Open in IMG/M |
3300005339|Ga0070660_101956966 | Not Available | 500 | Open in IMG/M |
3300005363|Ga0008090_15489000 | Not Available | 756 | Open in IMG/M |
3300005435|Ga0070714_100172494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1964 | Open in IMG/M |
3300005436|Ga0070713_100945801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 830 | Open in IMG/M |
3300005531|Ga0070738_10010650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8253 | Open in IMG/M |
3300005534|Ga0070735_10681078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 608 | Open in IMG/M |
3300005537|Ga0070730_10441614 | Not Available | 839 | Open in IMG/M |
3300005541|Ga0070733_10029963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3393 | Open in IMG/M |
3300005541|Ga0070733_10526094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 792 | Open in IMG/M |
3300005591|Ga0070761_10872717 | Not Available | 568 | Open in IMG/M |
3300005602|Ga0070762_10286007 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300005610|Ga0070763_10278741 | Not Available | 913 | Open in IMG/M |
3300005764|Ga0066903_100443320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2165 | Open in IMG/M |
3300005764|Ga0066903_106432601 | Not Available | 613 | Open in IMG/M |
3300005921|Ga0070766_10138469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 1479 | Open in IMG/M |
3300006893|Ga0073928_10053201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3634 | Open in IMG/M |
3300006893|Ga0073928_10139319 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
3300009521|Ga0116222_1202747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 854 | Open in IMG/M |
3300009632|Ga0116102_1171488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 590 | Open in IMG/M |
3300009633|Ga0116129_1122013 | Not Available | 747 | Open in IMG/M |
3300009672|Ga0116215_1088669 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1387 | Open in IMG/M |
3300009764|Ga0116134_1032950 | Not Available | 2047 | Open in IMG/M |
3300009824|Ga0116219_10034590 | Not Available | 3034 | Open in IMG/M |
3300010373|Ga0134128_11043206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 903 | Open in IMG/M |
3300010379|Ga0136449_100045480 | All Organisms → cellular organisms → Bacteria | 10030 | Open in IMG/M |
3300010379|Ga0136449_100722608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1665 | Open in IMG/M |
3300010396|Ga0134126_11473062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 751 | Open in IMG/M |
3300010398|Ga0126383_10412656 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 1390 | Open in IMG/M |
3300010398|Ga0126383_11917563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 680 | Open in IMG/M |
3300012989|Ga0164305_11442511 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300014168|Ga0181534_10948794 | Not Available | 517 | Open in IMG/M |
3300014169|Ga0181531_10747806 | Not Available | 609 | Open in IMG/M |
3300014199|Ga0181535_10034782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3676 | Open in IMG/M |
3300014200|Ga0181526_10981515 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300014501|Ga0182024_10025101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10546 | Open in IMG/M |
3300014501|Ga0182024_10092317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4450 | Open in IMG/M |
3300014501|Ga0182024_10797503 | Not Available | 1151 | Open in IMG/M |
3300014654|Ga0181525_10005424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9504 | Open in IMG/M |
3300015372|Ga0132256_102462764 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300016445|Ga0182038_11585704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 589 | Open in IMG/M |
3300017943|Ga0187819_10182776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 1241 | Open in IMG/M |
3300017944|Ga0187786_10594076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 519 | Open in IMG/M |
3300017946|Ga0187879_10047585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2533 | Open in IMG/M |
3300017955|Ga0187817_10244856 | Not Available | 1142 | Open in IMG/M |
3300017970|Ga0187783_10117037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1964 | Open in IMG/M |
3300017970|Ga0187783_10205149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1447 | Open in IMG/M |
3300017970|Ga0187783_10468133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 914 | Open in IMG/M |
3300017970|Ga0187783_10495229 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300017972|Ga0187781_10001126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 20083 | Open in IMG/M |
3300017972|Ga0187781_10732021 | Not Available | 716 | Open in IMG/M |
3300017975|Ga0187782_10870307 | Not Available | 698 | Open in IMG/M |
3300017975|Ga0187782_11186285 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300017988|Ga0181520_10030320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5700 | Open in IMG/M |
3300017988|Ga0181520_10358798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 1070 | Open in IMG/M |
3300018001|Ga0187815_10120101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1110 | Open in IMG/M |
3300018008|Ga0187888_1016452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4042 | Open in IMG/M |
3300018014|Ga0187860_1004250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10844 | Open in IMG/M |
3300018020|Ga0187861_10253133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 767 | Open in IMG/M |
3300018033|Ga0187867_10511177 | Not Available | 660 | Open in IMG/M |
3300018047|Ga0187859_10128560 | Not Available | 1337 | Open in IMG/M |
3300018062|Ga0187784_10165946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1803 | Open in IMG/M |
3300018085|Ga0187772_10019586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3864 | Open in IMG/M |
3300018086|Ga0187769_11474600 | Not Available | 514 | Open in IMG/M |
3300018090|Ga0187770_11014428 | Not Available | 668 | Open in IMG/M |
3300020582|Ga0210395_10001998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15901 | Open in IMG/M |
3300021088|Ga0210404_10479891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 701 | Open in IMG/M |
3300021171|Ga0210405_10499711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 953 | Open in IMG/M |
3300021180|Ga0210396_10671420 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300021402|Ga0210385_10924988 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300021402|Ga0210385_11296655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 558 | Open in IMG/M |
3300021405|Ga0210387_11571007 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300021406|Ga0210386_11618559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
3300021420|Ga0210394_11203741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 650 | Open in IMG/M |
3300021474|Ga0210390_10135724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 2068 | Open in IMG/M |
3300021474|Ga0210390_11446004 | Not Available | 546 | Open in IMG/M |
3300022557|Ga0212123_10161483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1714 | Open in IMG/M |
3300025320|Ga0209171_10265342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 932 | Open in IMG/M |
3300025898|Ga0207692_10521312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 756 | Open in IMG/M |
3300025929|Ga0207664_10816902 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300027641|Ga0208827_1110818 | Not Available | 803 | Open in IMG/M |
3300027854|Ga0209517_10049261 | Not Available | 3204 | Open in IMG/M |
3300027855|Ga0209693_10186033 | Not Available | 1023 | Open in IMG/M |
3300027867|Ga0209167_10042528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2214 | Open in IMG/M |
3300027889|Ga0209380_10341004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 880 | Open in IMG/M |
3300027894|Ga0209068_10430935 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300027905|Ga0209415_10291344 | Not Available | 1418 | Open in IMG/M |
3300027965|Ga0209062_1025505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3401 | Open in IMG/M |
3300028906|Ga0308309_11441006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 589 | Open in IMG/M |
3300030043|Ga0302306_10042410 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
3300030659|Ga0316363_10072561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1580 | Open in IMG/M |
3300030730|Ga0307482_1107720 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300031234|Ga0302325_10017811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14993 | Open in IMG/M |
3300031234|Ga0302325_11098422 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300031573|Ga0310915_10956810 | Not Available | 599 | Open in IMG/M |
3300031708|Ga0310686_102990738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 28530 | Open in IMG/M |
3300031708|Ga0310686_114015144 | Not Available | 566 | Open in IMG/M |
3300031708|Ga0310686_116986730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1298 | Open in IMG/M |
3300031719|Ga0306917_10219134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1448 | Open in IMG/M |
3300031777|Ga0318543_10334652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 678 | Open in IMG/M |
3300031823|Ga0307478_10310046 | Not Available | 1294 | Open in IMG/M |
3300031890|Ga0306925_10972402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 868 | Open in IMG/M |
3300031941|Ga0310912_11361425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 537 | Open in IMG/M |
3300031947|Ga0310909_10033015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3861 | Open in IMG/M |
3300031954|Ga0306926_10562402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1396 | Open in IMG/M |
3300032076|Ga0306924_10078690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3692 | Open in IMG/M |
3300032160|Ga0311301_10061560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8182 | Open in IMG/M |
3300032515|Ga0348332_12600908 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300032515|Ga0348332_13911384 | Not Available | 662 | Open in IMG/M |
3300032515|Ga0348332_14309342 | Not Available | 757 | Open in IMG/M |
3300032770|Ga0335085_10002733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 32221 | Open in IMG/M |
3300032805|Ga0335078_10056083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5808 | Open in IMG/M |
3300032805|Ga0335078_10069088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5169 | Open in IMG/M |
3300032805|Ga0335078_10490016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1583 | Open in IMG/M |
3300032892|Ga0335081_12004198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 617 | Open in IMG/M |
3300032895|Ga0335074_10056038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5402 | Open in IMG/M |
3300032955|Ga0335076_10207835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1859 | Open in IMG/M |
3300033134|Ga0335073_10020003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9334 | Open in IMG/M |
3300033134|Ga0335073_11412371 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.10% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 10.48% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.06% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.26% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.65% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.65% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.03% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.23% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.23% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.42% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.42% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.42% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.42% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.42% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.61% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.61% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062389_1022281782 | 3300004092 | Bog Forest Soil | MPILLWIALWSSMTGVATGWQETMLPIRVRGKDRRDQPTD* |
Ga0062389_1033719931 | 3300004092 | Bog Forest Soil | MHALMWIAFWSSWMEVARGWQETVSPIRSVVEDRHDRLWQACRAD* |
Ga0062389_1033783172 | 3300004092 | Bog Forest Soil | MPILLWIAFWSSMTGVANGWQETMLPIRVKWKDRRDQPSK* |
Ga0062388_1000414652 | 3300004635 | Bog Forest Soil | MPILMWIAFWSNVMGIAAGWQETALPIRVRVKDRRDRPTSSTT* |
Ga0066388_1000243243 | 3300005332 | Tropical Forest Soil | MPILLWIAFWSSMTGVASGWQETVLPIRVKGTDHRDHPGDT* |
Ga0066388_1022564842 | 3300005332 | Tropical Forest Soil | MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQSSK* |
Ga0070660_1019569662 | 3300005339 | Corn Rhizosphere | MPILLWIAFWSSMTGIANGWQETVLPIRVKGKDRRDHPSE* |
Ga0008090_154890001 | 3300005363 | Tropical Rainforest Soil | MPILLWIAFWSSMTGVASSWQEMMLPIRVKGKDRRDQPTE* |
Ga0070714_1001724942 | 3300005435 | Agricultural Soil | MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPGDS* |
Ga0070713_1009458011 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPGTS* |
Ga0070738_100106505 | 3300005531 | Surface Soil | MPILLWIAVWCNLTGIAAGWQETVSPIQASDEARRDRRTA* |
Ga0070735_106810782 | 3300005534 | Surface Soil | MPILMWIAFWSGMTGVANGWQETMLPIRVQVEDRRDRASK* |
Ga0070730_104416142 | 3300005537 | Surface Soil | MPILLWIAFWSSMTGVANGWQETMLPIRVKGKDRRDQPSK* |
Ga0070733_100299633 | 3300005541 | Surface Soil | MPLLMWIAFWSNLTGIAMGWQETALPIRVRNKDRRDRPTD* |
Ga0070733_105260942 | 3300005541 | Surface Soil | MPILMWIAFWSNVMGIAAGWQETALPIRVRAKDRRDRSTSSPT* |
Ga0070761_108727171 | 3300005591 | Soil | MPILLWIAFWSSMTGVVRGWQETMLPIRMKVTDRRDQPTE* |
Ga0070762_102860072 | 3300005602 | Soil | MPILLWIAFWSSMTGVASGWQETVLPVRVKAKDRRDHRPSE* |
Ga0070763_102787411 | 3300005610 | Soil | MPVLMWIAFWSNVMGIAAGWQETALPIRMRAKDRRDRSTSS* |
Ga0066903_1004433202 | 3300005764 | Tropical Forest Soil | MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDWSSE* |
Ga0066903_1064326011 | 3300005764 | Tropical Forest Soil | QFDPPRSKVMPILLWIAFWSSMTGVASSWQETMLPIRVKGKDRRDQPSE* |
Ga0070766_101384692 | 3300005921 | Soil | MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQPSK* |
Ga0073928_100532012 | 3300006893 | Iron-Sulfur Acid Spring | MPILLWIAFWSSMMGVATGWQETMLPIRVKVTGRRDQPTE* |
Ga0073928_101393193 | 3300006893 | Iron-Sulfur Acid Spring | MPILLWIALWSSMTGVATGWRETMLPIRVRGKDRRDQPTD* |
Ga0116222_12027471 | 3300009521 | Peatlands Soil | MPILLWIAFWSSMTGIANGWQETVLPVRVKAKDRRDQPGE* |
Ga0116102_11714881 | 3300009632 | Peatland | MRILMWIAFWSSLMGVATSWQGTALPIRVKGNDRRDRP |
Ga0116129_11220131 | 3300009633 | Peatland | MAMPALMWVAFWSNLMGVAVGSQETMSPISVRVKDRRDRLIK* |
Ga0116215_10886691 | 3300009672 | Peatlands Soil | PILLWIAFWSSMTGIANGWQETVLPVRVKAKDRRDQPGE* |
Ga0116134_10329502 | 3300009764 | Peatland | MPILLWIALWSSMMGVAMGWQESMLPIRVRITDCRDRLTE* |
Ga0116219_100345903 | 3300009824 | Peatlands Soil | MELVMPILLWIAFWSNLMGIAAGWQETASPIRVTVKDRRDHSAK* |
Ga0134128_110432062 | 3300010373 | Terrestrial Soil | MPILLWIAFWYSMTGVASGWQETMLPIRVKGKDRRDHPGDS* |
Ga0136449_10004548010 | 3300010379 | Peatlands Soil | MSILLWIAFWSSMTGVAMGWQETAPPIRVRVTDRRHRPAE* |
Ga0136449_1007226082 | 3300010379 | Peatlands Soil | MPILLWIAFWSSMTAVAMGRQETALPIRVRVTDRRDHPAV* |
Ga0134126_114730622 | 3300010396 | Terrestrial Soil | MWIALWSSLLGVATGWQETALPIRVGAKDRRDYRKN |
Ga0126383_104126562 | 3300010398 | Tropical Forest Soil | GQFDPPSSKVMPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQSSK* |
Ga0126383_119175632 | 3300010398 | Tropical Forest Soil | MPILLWIAFWSSMTGVASGWQETVLPIRVKGTDHRD |
Ga0164305_114425111 | 3300012989 | Soil | KVMPILLWIAFWSSMTGVASGWQETMLPIRVKRKDRRDQPSK* |
Ga0181534_109487941 | 3300014168 | Bog | MPVLMWVAFWSSLLRVTLGWQETMLPVRIGVKDRRDRPAD* |
Ga0181531_107478061 | 3300014169 | Bog | MYILLWIAFWSSMTGVTAGWQETMLPIRVKATDRRDRPT* |
Ga0181535_100347826 | 3300014199 | Bog | MPALLWIAFWSNLMGVAMGWQETTLPIRLRDNDRRDRPTNQRSN* |
Ga0181526_109815152 | 3300014200 | Bog | MPALLWIAFWSNLTGVARGWQETALPIRVGGDDHRDHPAK* |
Ga0182024_1002510112 | 3300014501 | Permafrost | MPILLWIAFWSSMAGVAIGWQETPMPIRVRVTDRRDRPTA* |
Ga0182024_100923176 | 3300014501 | Permafrost | MPALLWIAFWSNLMGVAMGWHETVLPIRVRVNDRRDRPTR* |
Ga0182024_107975032 | 3300014501 | Permafrost | MPILMWIAFWSNIMGIAAGWQETALPIRVRAKDRRDHSTD* |
Ga0181525_100054249 | 3300014654 | Bog | MPALLWIAFWSNLMGVASGWQETALPIRVGVNDRRDRPTK* |
Ga0132256_1024627641 | 3300015372 | Arabidopsis Rhizosphere | MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRD |
Ga0182038_115857042 | 3300016445 | Soil | MPILLWIAFWSSMTGVASGWQETVLPIRVKGTDHRDHPGD |
Ga0187819_101827762 | 3300017943 | Freshwater Sediment | MPILLWIAFWSSMTGIANGWQETVLPVRVKAKYRRDQPGE |
Ga0187786_105940761 | 3300017944 | Tropical Peatland | MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPDNS |
Ga0187879_100475852 | 3300017946 | Peatland | MPALLWIAFWSNLMGVAMGWQETVLPIRVRVNDRRDRPTR |
Ga0187817_102448563 | 3300017955 | Freshwater Sediment | MPILLWIAFWSSMTGVANGWQETMLPIRVRGKDRRDQPSK |
Ga0187783_101170372 | 3300017970 | Tropical Peatland | MPILLWIAFWSSLTGVANGWQETMLPIRVRETDRRDQPTE |
Ga0187783_102051492 | 3300017970 | Tropical Peatland | MPVLLWIAFWSNLTGIARGWQETALPIRVRDKDRRDHPTD |
Ga0187783_104681332 | 3300017970 | Tropical Peatland | MPVLLWIAFWSNLTGVALGWQETALPIRVRVTDRRDHPEK |
Ga0187783_104952292 | 3300017970 | Tropical Peatland | MPVLMWIAFWSNLTGIATAWQETVLPIRVRDKDRRDRPTN |
Ga0187781_1000112614 | 3300017972 | Tropical Peatland | MPILLWITFWSSMTGVANGWQETMLPIRVKGEDRRDQPHE |
Ga0187781_107320212 | 3300017972 | Tropical Peatland | MPVLLWIAFWSNLTGVALGWQETALPIRVRVTDRRDHPDK |
Ga0187782_108703072 | 3300017975 | Tropical Peatland | MRVLMWIAFWLNLTGIATAWQETVLPIRVRDKDRRDRPTN |
Ga0187782_111862851 | 3300017975 | Tropical Peatland | KFDPRKEHVMPVLLWIAFWSNLTGVALGWQETALPIRVRVTDRRDHPDK |
Ga0181520_100303203 | 3300017988 | Bog | MPALLWIAFWSNLMGVAMGWQETTLPIRLRDNDRRDRPTNQRSN |
Ga0181520_103587982 | 3300017988 | Bog | MYILLWIAFWSSMTGVTAGWQETMLPIRVKATDRRDRPT |
Ga0187815_101201012 | 3300018001 | Freshwater Sediment | MPFLLWIAFWSSMTGIANGWQETVLPVRVKAKYRRDQPGE |
Ga0187888_10164523 | 3300018008 | Peatland | MPILLWIAFWSSMTGVAMGWQETALPIRVRVTDRRHRPAE |
Ga0187860_10042502 | 3300018014 | Peatland | MSILLWIAFWSSMTGVAMGWQETAPPIRVRVTDRRHRPAE |
Ga0187861_102531332 | 3300018020 | Peatland | MSILLWIAFWSSMTGVAMGWQETTPPIRVRVTDRRHRPAE |
Ga0187867_105111772 | 3300018033 | Peatland | MPLLMWIALWSGLLGVANGWQETVLPVRVGTKDRRDHRPS |
Ga0187859_101285601 | 3300018047 | Peatland | ERVVPMLMWIALWSSLLGVASGWQETASPVRVWAKDRRDHRPN |
Ga0187784_101659462 | 3300018062 | Tropical Peatland | MPILLWIAFWSSLTGVATGWQDTMLPIRVKETDRRDQPTD |
Ga0187772_100195864 | 3300018085 | Tropical Peatland | MPALLWIAFWSNLTGVAVGWQETALPIRVRDKDRRDQPTN |
Ga0187769_114746001 | 3300018086 | Tropical Peatland | MPILLWIAFWSNLTGLLACWRETALPIGAGKEDRRDHTNK |
Ga0187770_110144282 | 3300018090 | Tropical Peatland | MWIALWSSLLGMASGWQETALPVRVGAKDRRDHQQN |
Ga0210395_1000199811 | 3300020582 | Soil | MPILLWIAFWSSMTGVVRGWQETMLPIRMKVTDRRDQPTE |
Ga0210404_104798911 | 3300021088 | Soil | MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQPSK |
Ga0210405_104997111 | 3300021171 | Soil | MPILLWIAFWSSMTGIASGWQETMLPIRVKGKDRRDQSNE |
Ga0210396_106714202 | 3300021180 | Soil | MPILLWIAFWSSVTGIAKGWQETVLPVRVKVRDRRDQPPK |
Ga0210385_109249882 | 3300021402 | Soil | MPLLMWIALWSGLLGVANGWQETMLPVRVGTKDRRDR |
Ga0210385_112966551 | 3300021402 | Soil | MQFDSQKEHAMPILLWVALWSSMTGVAKGWQETMLPIRVKVKDRRDQPTE |
Ga0210387_115710071 | 3300021405 | Soil | MPILLWIAFWSSMTGVANGWQETMLPIRVKGKDRRDQP |
Ga0210386_116185591 | 3300021406 | Soil | WIAFWSSVTGIAKGWQETVLPVRVKVRDRRDQPPK |
Ga0210394_112037412 | 3300021420 | Soil | MPILLWVALWSSMTGVAKGWQETMLPISVKVKVKDRRD |
Ga0210390_101357241 | 3300021474 | Soil | PILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQPSK |
Ga0210390_114460042 | 3300021474 | Soil | LWIAFWSSMTGVVKGWQETVLPIRVKVTDRRDQPTE |
Ga0212123_101614831 | 3300022557 | Iron-Sulfur Acid Spring | MPILLWIAFWSSMMGVATGWQETMLPIRVKVTGRRDQPTE |
Ga0209171_102653422 | 3300025320 | Iron-Sulfur Acid Spring | MENVMPILLWIAFWSSMMGVATGWQETMLPIRVKVTGRRDQPTE |
Ga0207692_105213122 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPGD |
Ga0207664_108169022 | 3300025929 | Agricultural Soil | PILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPGDS |
Ga0208827_11108182 | 3300027641 | Peatlands Soil | MPILLWIAFWSSMTGIANGWQETVLPVRVKAKDRRDQPGE |
Ga0209517_100492612 | 3300027854 | Peatlands Soil | MPALLWIAFWSNLMGVAMGWQETALPIRVRVKDRRDRSR |
Ga0209693_101860332 | 3300027855 | Soil | MPVLMWIAFWSNVMGIAAGWQETALPIRMRAKDRRDRSTSS |
Ga0209167_100425282 | 3300027867 | Surface Soil | MPLLMWIAFWSNLTGIAMGWQETALPIRVRNKDRRDRPTD |
Ga0209380_103410043 | 3300027889 | Soil | MPILLWIAFWSSMTGVANGWQETMLPIRVKGKDRRDQPSK |
Ga0209068_104309352 | 3300027894 | Watersheds | MPILLWIAFWSSMTGVANGWQETMLPIHVKGKDRRDQPSK |
Ga0209415_102913441 | 3300027905 | Peatlands Soil | MELVMPILLWIAFWSNLMGIAAGWQETASPIRVTVKDRRDHSAK |
Ga0209062_10255053 | 3300027965 | Surface Soil | MPILLWIAVWCNLTGIAAGWQETVSPIQASDEARRDRRTA |
Ga0308309_114410061 | 3300028906 | Soil | MPILMWIAFWSNVMGIAAGWQETALPIRMRAKDRRD |
Ga0302306_100424101 | 3300030043 | Palsa | MPMLMWIALWSNLLGVASGWQETASPVRLWAKDRRDHRSN |
Ga0316363_100725611 | 3300030659 | Peatlands Soil | MSILLWIAFWSSMTGVAMGWQETAPPIRVRVTDRRH |
Ga0307482_11077202 | 3300030730 | Hardwood Forest Soil | SKVMPILLWIAFWSSMTGVAKGWQETMLPIRVKGKDRRDQPSK |
Ga0302325_1001781111 | 3300031234 | Palsa | MPALLWIAFWSNLMGVAMGWHETVLPIRVRVNDRRDRPTR |
Ga0302325_110984222 | 3300031234 | Palsa | MPMLMWIALWSSLLGVASGWQETASPVRLLARDRRDHRPN |
Ga0310915_109568101 | 3300031573 | Soil | MPILLWIAFWSSMTGVASSWQETMLPIRVKGKDRRDQPTE |
Ga0310686_10299073819 | 3300031708 | Soil | MPILLWIAFWSSMTGVAKGWQETVLPIRVKVTDRRDQPTE |
Ga0310686_1140151441 | 3300031708 | Soil | MPILMWIAFWSNMMGVAAGWQETALPIRVTAKDRRDRSTSSTSIGHS |
Ga0310686_1169867302 | 3300031708 | Soil | MPVLLWIAFWSSMSGIAMGWQETALPVRIKDKGRHDRPVT |
Ga0306917_102191342 | 3300031719 | Soil | MPILLWIAFWSSMTGVASSWQETMLPIRVKGKDRRDPPSE |
Ga0318543_103346522 | 3300031777 | Soil | MPILLWIAFWSSMTGVASGWQETLLPIRVKGTDHRDHPGDT |
Ga0307478_103100462 | 3300031823 | Hardwood Forest Soil | MPILLWIAFWSSMTGVAKGWQETTLPIRVKVTDRRDQPTE |
Ga0306925_109724022 | 3300031890 | Soil | MVMPILLWIAFWSSMTGVASGWQETVLPVRLKAKDRRDRTSE |
Ga0310912_113614252 | 3300031941 | Soil | MPILLWIAFWSSMTGVASGWQETVLPVRLKAKDRRDRTSE |
Ga0310909_100330153 | 3300031947 | Soil | MPILLWIAFWSSMTGVASSWQETMLPIRVKRKDRRDQPTE |
Ga0306926_105624022 | 3300031954 | Soil | MPILLWIAFWSSMTGVASGWQETVLPIRVKGTDHRDHPGDT |
Ga0306924_100786901 | 3300032076 | Soil | MPILLWIAFWSSMTGVASGWQETVLPIRVKGTDHRDHP |
Ga0311301_100615602 | 3300032160 | Peatlands Soil | MSILLWIAFWSNLMGIAAGWQETASPIRVRAKDRRDRSAK |
Ga0348332_126009081 | 3300032515 | Plant Litter | ERVMPILLWIAFWSSMTGVAKGWQETVLPIRVKVTDRRDQPTE |
Ga0348332_139113841 | 3300032515 | Plant Litter | AKEARMPLLMWIAFWSNLTGIAMGWQETALPIRVRNKDRRDRPTD |
Ga0348332_143093421 | 3300032515 | Plant Litter | MLMWIALWSSLLGVASGWQETASPVRVWAKDRRDHRPN |
Ga0335085_1000273321 | 3300032770 | Soil | MPILIWITFWSNLMGIAAGWQETASPIRVRAKNGRDHSAD |
Ga0335078_100560836 | 3300032805 | Soil | MPILLWIAFWSNLTGIAAGWQETVLPVRVRGKDRRDHPAK |
Ga0335078_100690883 | 3300032805 | Soil | MPALMWIAFWSSLMGVATGWQETALPIRVRAMDRRDRPTK |
Ga0335078_104900163 | 3300032805 | Soil | MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPGNS |
Ga0335081_120041982 | 3300032892 | Soil | MSVLLWIAFWSNLTGIAMGWQETALPIRVRDKDRRDRSTD |
Ga0335074_100560384 | 3300032895 | Soil | MPALLWIAFWSNLTGVAMGWQETALPIRVRAKDRRDPPAE |
Ga0335076_102078352 | 3300032955 | Soil | MPILLWIAMWSSMTGVAKGWQDTILPIRVKVTDRRDQLTEK |
Ga0335073_100200033 | 3300033134 | Soil | MPMLMWIALWSSLLGVVSGWQETALPVRVGAKDRRDHRLT |
Ga0335073_114123712 | 3300033134 | Soil | MPILLWIAMWSSMTGVAKGWQDTVLPIRVKVTDRRDQLTEK |
⦗Top⦘ |