NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068387

Metagenome / Metatranscriptome Family F068387

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068387
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 174 residues
Representative Sequence IALRFGVIDEVSKDLFRESQFLKVAARRSLQCITGLLLVMGVLLAVYAPGDNSAKWYAGIFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRSAFGIALGLGILTSVDLAFSALRAEFASEVGAEFLDLLITGTYLVCVSIWIGYLLAPELEPASVAAVPHEEVETWNRELQQLLKQ
Number of Associated Samples 108
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.58 %
% of genes from short scaffolds (< 2000 bps) 91.94 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(15.323 % of family members)
Environment Ontology (ENVO) Unclassified
(51.613 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.774 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 70.59%    β-sheet: 0.00%    Coil/Unstructured: 29.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF02700PurS 4.84
PF13522GATase_6 3.23
PF01058Oxidored_q6 1.61
PF00248Aldo_ket_red 0.81
PF13565HTH_32 0.81
PF01343Peptidase_S49 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG1828Phosphoribosylformylglycinamidine (FGAM) synthase, PurS subunitNucleotide transport and metabolism [F] 4.84
COG0377NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductaseEnergy production and conversion [C] 1.61
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.61
COG1740Ni,Fe-hydrogenase I small subunitEnergy production and conversion [C] 1.61
COG1941Coenzyme F420-reducing hydrogenase, gamma subunitEnergy production and conversion [C] 1.61
COG3260Ni,Fe-hydrogenase III small subunitEnergy production and conversion [C] 1.61

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001154|JGI12636J13339_1017536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71038Open in IMG/M
3300001170|JGI12704J13340_1008105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7915Open in IMG/M
3300002245|JGIcombinedJ26739_100756669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7851Open in IMG/M
3300004080|Ga0062385_11125246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7533Open in IMG/M
3300004092|Ga0062389_103009277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7630Open in IMG/M
3300004152|Ga0062386_100944893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7713Open in IMG/M
3300004476|Ga0068966_1293373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7969Open in IMG/M
3300004612|Ga0068961_1312804All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83512Open in IMG/M
3300005176|Ga0066679_10119738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71621Open in IMG/M
3300005602|Ga0070762_10009722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter4795Open in IMG/M
3300005938|Ga0066795_10055311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71171Open in IMG/M
3300006059|Ga0075017_101580423All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7517Open in IMG/M
3300006102|Ga0075015_100118718All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71347Open in IMG/M
3300006162|Ga0075030_101353563All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7558Open in IMG/M
3300009089|Ga0099828_11353259All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7629Open in IMG/M
3300009089|Ga0099828_11636267All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7567Open in IMG/M
3300009090|Ga0099827_10886442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7773Open in IMG/M
3300009518|Ga0116128_1153865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7657Open in IMG/M
3300009519|Ga0116108_1097584All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7891Open in IMG/M
3300009520|Ga0116214_1369293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7557Open in IMG/M
3300009522|Ga0116218_1329334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7683Open in IMG/M
3300009524|Ga0116225_1502512All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7539Open in IMG/M
3300009525|Ga0116220_10326903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7678Open in IMG/M
3300009552|Ga0116138_1029669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71641Open in IMG/M
3300009615|Ga0116103_1158833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7543Open in IMG/M
3300009641|Ga0116120_1030107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71931Open in IMG/M
3300009643|Ga0116110_1272885All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7539Open in IMG/M
3300009665|Ga0116135_1065298All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71280Open in IMG/M
3300009683|Ga0116224_10289305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7780Open in IMG/M
3300009762|Ga0116130_1227820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7591Open in IMG/M
3300010343|Ga0074044_10488123All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7805Open in IMG/M
3300010343|Ga0074044_10505576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7789Open in IMG/M
3300010343|Ga0074044_11074502All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7527Open in IMG/M
3300011083|Ga0138560_1101695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71135Open in IMG/M
3300011088|Ga0138576_1275969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7501Open in IMG/M
3300011120|Ga0150983_15206578All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7528Open in IMG/M
3300014158|Ga0181521_10435177All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7639Open in IMG/M
3300014159|Ga0181530_10106072All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71670Open in IMG/M
3300014162|Ga0181538_10380099All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7755Open in IMG/M
3300014164|Ga0181532_10034949All Organisms → cellular organisms → Bacteria → Acidobacteria3441Open in IMG/M
3300014169|Ga0181531_10946855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7540Open in IMG/M
3300014201|Ga0181537_10544684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7793Open in IMG/M
3300014655|Ga0181516_10531636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7604Open in IMG/M
3300017823|Ga0187818_10496951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7547Open in IMG/M
3300017929|Ga0187849_1246822All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7681Open in IMG/M
3300017929|Ga0187849_1324828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7572Open in IMG/M
3300017934|Ga0187803_10314191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7626Open in IMG/M
3300017938|Ga0187854_10184483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7930Open in IMG/M
3300017942|Ga0187808_10500376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7563Open in IMG/M
3300017943|Ga0187819_10681070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7580Open in IMG/M
3300017943|Ga0187819_10761597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7544Open in IMG/M
3300017972|Ga0187781_11346555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7527Open in IMG/M
3300018009|Ga0187884_10412916All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7543Open in IMG/M
3300018013|Ga0187873_1059907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71608Open in IMG/M
3300018015|Ga0187866_1285738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7582Open in IMG/M
3300018019|Ga0187874_10253092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7722Open in IMG/M
3300018021|Ga0187882_1343159All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7569Open in IMG/M
3300018021|Ga0187882_1379964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7537Open in IMG/M
3300018021|Ga0187882_1407820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7515Open in IMG/M
3300018022|Ga0187864_10466305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7535Open in IMG/M
3300018022|Ga0187864_10479670All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7525Open in IMG/M
3300018023|Ga0187889_10395355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7599Open in IMG/M
3300018026|Ga0187857_10334808All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7688Open in IMG/M
3300018033|Ga0187867_10089763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71799Open in IMG/M
3300018042|Ga0187871_10636478All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7592Open in IMG/M
3300018044|Ga0187890_10429062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7742Open in IMG/M
3300019082|Ga0187852_1284125All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7662Open in IMG/M
3300019082|Ga0187852_1369680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7562Open in IMG/M
3300019787|Ga0182031_1026750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71018Open in IMG/M
3300019787|Ga0182031_1548416All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72029Open in IMG/M
3300021168|Ga0210406_11246293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7538Open in IMG/M
3300021168|Ga0210406_11365518All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7507Open in IMG/M
3300021170|Ga0210400_11186327All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7615Open in IMG/M
3300021404|Ga0210389_10720058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7781Open in IMG/M
3300021478|Ga0210402_10126605All Organisms → cellular organisms → Bacteria → Acidobacteria2313Open in IMG/M
3300022717|Ga0242661_1027341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7962Open in IMG/M
3300022726|Ga0242654_10021262All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71595Open in IMG/M
3300024233|Ga0224521_1130573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7534Open in IMG/M
3300025442|Ga0208034_1057674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7774Open in IMG/M
3300025453|Ga0208455_1021688All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71534Open in IMG/M
3300025459|Ga0208689_1103061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7503Open in IMG/M
3300025460|Ga0208562_1089666All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7610Open in IMG/M
3300025469|Ga0208687_1029850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71460Open in IMG/M
3300025474|Ga0208479_1040532All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7943Open in IMG/M
3300025480|Ga0208688_1039023All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71084Open in IMG/M
3300025480|Ga0208688_1066799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7739Open in IMG/M
3300026482|Ga0257172_1030159All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7977Open in IMG/M
3300026496|Ga0257157_1032330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7864Open in IMG/M
3300026551|Ga0209648_10699797All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7553Open in IMG/M
3300027171|Ga0207947_1013828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7573Open in IMG/M
3300027559|Ga0209222_1029349All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71066Open in IMG/M
3300027634|Ga0209905_1091424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7518Open in IMG/M
3300027641|Ga0208827_1213891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7507Open in IMG/M
3300027645|Ga0209117_1000438All Organisms → cellular organisms → Bacteria → Acidobacteria17824Open in IMG/M
3300027648|Ga0209420_1137929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7674Open in IMG/M
3300027663|Ga0208990_1030551All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71711Open in IMG/M
3300027669|Ga0208981_1158658All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7574Open in IMG/M
3300027737|Ga0209038_10136145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7744Open in IMG/M
3300027905|Ga0209415_10143742All Organisms → cellular organisms → Bacteria → Acidobacteria2423Open in IMG/M
3300027905|Ga0209415_10596528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7820Open in IMG/M
3300027905|Ga0209415_10884154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7610Open in IMG/M
3300027905|Ga0209415_10884218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7610Open in IMG/M
3300028536|Ga0137415_10509160All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71012Open in IMG/M
3300028747|Ga0302219_10053257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71509Open in IMG/M
3300028798|Ga0302222_10083903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71275Open in IMG/M
3300028806|Ga0302221_10436488All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7571Open in IMG/M
3300029817|Ga0247275_1003968All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8077Open in IMG/M
3300029882|Ga0311368_10604975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7772Open in IMG/M
3300029889|Ga0246001_1016132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72364Open in IMG/M
3300029954|Ga0311331_11297600All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7607Open in IMG/M
3300030815|Ga0265746_1008574All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71108Open in IMG/M
3300031028|Ga0302180_10311712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7808Open in IMG/M
3300031122|Ga0170822_10686861All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7560Open in IMG/M
3300031525|Ga0302326_11949658All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7761Open in IMG/M
3300031718|Ga0307474_10463733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7991Open in IMG/M
3300031718|Ga0307474_11383498All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7555Open in IMG/M
3300031754|Ga0307475_10556453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7920Open in IMG/M
3300032072|Ga0326631_104750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7789Open in IMG/M
3300032119|Ga0316051_1031494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7522Open in IMG/M
3300032180|Ga0307471_100076920All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72913Open in IMG/M
3300033823|Ga0334837_008258All Organisms → cellular organisms → Bacteria → Acidobacteria5019Open in IMG/M
3300033826|Ga0334847_002728All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71689Open in IMG/M
3300033890|Ga0334810_185378All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7504Open in IMG/M
3300034125|Ga0370484_0184687All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7567Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland15.32%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland12.10%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil11.29%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil8.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.26%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.65%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.84%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.03%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.23%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.23%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.23%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.42%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.42%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.81%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.81%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.81%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001170Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004476Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004612Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300011083Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011088Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024233Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025474Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027171Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027634Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1MEnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027669Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300032072Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032119Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M
3300033826Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5EnvironmentalOpen in IMG/M
3300033890Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-MEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12636J13339_101753623300001154Forest SoilFIPLFALYSVQGVTGKEYAYAYCVTLLISIVLRFGVIDEISRNLFRESRFLKVAARRSLQCVTGLLLGVGALLTVYAPGGNSATWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLAVLTSLDLAMFALRAAFTSEAAADFVDLLITGTYLVCVSIWMGYSLAPEPEPIASPAVLPHDEVETWNRELQQLLKR*
JGI12704J13340_100810523300001170Forest SoilLRSVPGVSAKVYLYAYSATLLLSIALRFGVIEEVSKQLFRESQFLRVSAKRSLLCIQGLLLVMGVVLAVYAPSSNSFRLVAGIVVVSRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGITLGLGILTSVDLAVYAVRAGFAPGVGAEFLNFLTTGTYLVCVLIWIGYLLAPEHQPVSLTAVSRDEVETWNTELQHLLRD*
JGIcombinedJ26739_10075666923300002245Forest SoilFFPLFALYSVQGVSGKEYAYAYCVTLLISIVLRFGVIDEISRNLFRESQFLRVAARRSLQCVTGLLLGAGALLAVYAPGGNSAKWYAGIVVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSTFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELASPTVVAHDEVETWNREFQQFLKQ*
Ga0062385_1112524613300004080Bog Forest SoilRRVLFGVQGLLLVIGILLAVYAPGDNSIRWIAGVSVINRGAAMIQSGLLLSLLLFSRFLGVSWHRHAFGIALGLGILTSVDVAIYALRAQLASDSLVPYLDLLRTGTYVVCILTWIGYLLLPELEPGPLTVVSSEEVETWSTELQHMLRPRQ*
Ga0062389_10300927713300004092Bog Forest SoilKIAARRLLQCLAGLLLAMGILLAFYAPGNNSVRWHAGVFAVNRGAAMVQCGLLLASLLLSRFLGLTWRRPAFGIALGLGILTTVNLATSALRAELTTNAARDFLNLLTTGTYLVCVSLWLRYLLAPETEPASPMIVSHNEVEIWNQELQHFLKQ*
Ga0062386_10094489313300004152Bog Forest SoilESPSRKVAARRALLCVQGLLVVVGVLLAIYAPGDNSVRWIAGVSVVNRGGAMVQSGMLLSLLLFSRFLGVSWSRPAFGITLGLGVLTSVDLAIYALRAEFTTGVLVPYLDLLRTGTYFLCILIWIGYSLAPEHEPASLTAIPHDEVETWNTELRRLLRD*
Ga0068966_129337313300004476Peatlands SoilFNIALRFGVIDEVCKDLFRDAQFLKVAARRSLLCVTGLLLGVGVLLAVYAPGGNSVRWFAGVLAVNRGAAVVQSGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVYLANYALRAEFTSRSGAGFLNLLTTGTYLVCVSIWSGYLLAPEPEPASLAVVPHDEVETWNTELQHLLRD*
Ga0068961_131280413300004612Peatlands SoilLKVSARRSLQGLTGLLLVMGVLLAVYAPGDNSARWFAGVLAINRGAAMVQSGLLLSLLLFSRFLGLSWRRLAFGITLGLGIVTSVDLAMFALRAEFTSAAGKEFLNLLITGTYLICVLIWIRYLLAPEPEPASLAVVPHDEVETWNTELQHLLRD*
Ga0066679_1011973843300005176SoilQYAYAYCATLLLSIALRFGVIDEVSKDLFRESQLLKVSARRSLQCVTGLLLVVGVLLAVYAPGDNSGRWIAGVSVVNRGAAMVQCGLLLALLLSSRFLGLSWRRSTFGIALGLGILTSVDLATFALRTAFASWVAVEFFNLLITSAYLVCVSIWIGYVLAPELQPASLMIVPNDNDNDEVGTWNRELRQLLKH*
Ga0070762_1000972263300005602SoilDLFRDSMFLKAAARRALQCVTGLLLVMGVLLAAYAPGDNSVRLIAGIFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVQTSVDLAMFALRAQFTSAASINFLNLLITGTYLICVLTWLGYLLVPEHEPASPGIISHDEVETWNKELQHFLKQ*
Ga0066795_1005531133300005938SoilFRESQFLKVSARRSLRCVTGLLLVMCVLLAVYAPGKNSTKWIAGVSVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAMFALRTAFASWVAVEFFNLLITGAYLVCVSIWIGYLLAPELEPASLTVVPHDEVETWNRELQHLLRH*
Ga0075017_10158042313300006059WatershedsYYATLVLSVALRFGVIGEISKYLFRESELLQMAARRSLQSVTGLLLITAVLLAVYAPGNHHLQWIAGVSVVNRGAALIQSGLLISLLAFSRFFGLSWRRPVFGITLGLGILISVDLAIYALRVTFASFAWVPYLDLLRAGTYVVCVSIWIGYLLAPEIEPASAAVVSHDEVE
Ga0075015_10011871813300006102WatershedsSVTGEQYAYAYYATLLLSIALRFGLIEEVSRDLFRESQFLRVAARRALQCVTGLLLVMGILLAVYGPGDTSIRLVAGSVVNRGAAMVQCGLLLTLLLFSRFLGLSWRRPAFGIALGLGVLSSADLATYAVRAEFSSAAWVPYLNSVITGAYLVCVLIWIGYLLAPELKPVALTVVSRDEVETWNTELQHLFKR*
Ga0075030_10135356313300006162WatershedsYSVLGVTSKPYAYVFSATLMISIALRFGVIDEVSKDLFRESQFLKVSAKRSLQCVTGLLAVIGVLLAVYAPGGNSARFTAGIFVVNRGAAMVQSGLLLSLLLLSRFLGLSWRRPAFGIALGLAALTSLDLAMFALRAAFTSDVAREFLNLLITGTYLVCVLIWIGYLLAPELKPVALTVVSRDEV
Ga0099828_1135325923300009089Vadose Zone SoilYAYCATLLLSIALRFGVIDEVSKDLFRESEFLKVAARRSLRCVTGLLLLVGVVLAVYAPGDNSVRWIAGVSVVNRGAAMVQCGLLLSLLLFSRFLGVSWRGAAFGITLGLGVLASVDLAAYALRAEFTSKVGEEFLNLLIPGTYLVCVLIWIRFLLAPELQPASPTVVPHDEVETWNTELQRLLRD*
Ga0099828_1163626713300009089Vadose Zone SoilIALRFGVIDEVSKDLFRESQFLKVAARRSLQCITGLLLVMGVLLAVYAPGDNSAKWYAGIFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRSAFGIALGLGILTSVDLAFSALRAEFASEVGAEFLDLLITGTYLVCVSIWIGYLLAPELEPASVAAVPHEEVETWNRELQQLLKQ*
Ga0099827_1088644213300009090Vadose Zone SoilQCVTGLLLVVGVLLAVYAPGDNSGRWIAGVSVVNRGAAMVQCGLLLALLLFSRFLGLSWRRSTFGIALGLGILTSVDLAVFALRTAFASWVAVEFFNLLITGAYLVCVSIWIGYVLALELKPASLAVVPNDNDNAEVETWNRELQQLLKH*
Ga0116128_115386513300009518PeatlandYCATLLLSIALRFGVIDEVSKDLFRESQFLKMAARRSLLCVTGLLLLIGVLLTVYAPGGYSDGWWYTGAAVINRGAAMIQSGLLLALLLSSRFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFASEAMKDILNLLMTGTYLVCVLIWIGYSLAPELELASLTIVSHDEVENWNTELQHLLRD*
Ga0116108_109758423300009519PeatlandTLLLSIALRFGVIDEVSKDLFRESQFLKMAARRSLLCVTGLLLLIGVLLTVYAPGGYSDGWWYTGAAVINRGAAMIQSGLLLALLLSSRFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFASEAMKDILNLLMTGTYLVCVLIWIGYSLAPELELASLTIVSHDEVENWNTELQHLLRD*
Ga0116214_136929313300009520Peatlands SoilFAYVLYKIAVFILLFTLYSVQGLAGKQYAYAFSATLLLSIALRFGAIDEVSKDLFRDSQFLKLSARRSLQCVTGLLFVVGILFAVYAPSDNSFDSRLLAGTLVVNRGAAMVQSGLLLSLLLFSRFLGLSWRRLAFGITLGLGILTSVDLATYALRAEFTSRVGAELLNLLITGTYLVCVSIWIGY
Ga0116218_132933413300009522Peatlands SoilYYATLMFSLVLRFGVINEVSKDLFRESQFLKVAARRSLQCITGLLLAMGVALAVYAPGDISVKWVAGASVVTRGAALVQCGLLLTLLLFSRFLGLTWRRPAFGITLGLGVLTSVNLAIYALRAEFTNRVGAAFLNFLATGTYLVCVSIWIGYLLAPEPQPASLAVVPHDEVETWNTELQHLLRD*
Ga0116225_150251213300009524Peatlands SoilDLFRESRFLKVSARRSLQCVTGLLLAMGVLLAVYAPGDNSARWYAGIIVVNRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLGIVTSVDLAMFALRAEFASAVAAEYLNLLVTGAYLVSVSIWIGYLLAPELEPASLTVVPHDEVETWNTELQHLLRD*
Ga0116220_1032690313300009525Peatlands SoilLFALYFVPGATGERYVYAYSATLLLSVALRFGAIAEVSKDLFRESQFLNVAARRSLKCAQGLLLVIGVLLAVYAPGDNSARLTAGVSVVNRGAAMVQCGLLLVLLLSSRFLGLSWRRPAFGITLGLGVLTSVDLAIYAVRAEFSSDVWVPYFNLLTTGAYLICVSIWVGYSLAPEVQPASPTVVPHDEVETWNRELQHLVRH*
Ga0116138_102966913300009552PeatlandIAEISRNLFRESQFLKVAARRSLQCVTGLLFVVGVLLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLSLLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVLIWIGYLLVPEVEPASVTVVPHDEVETWNREFQQFLRH*
Ga0116103_115883313300009615PeatlandACAFSATLLLSIALRFGVIHEVSKDLFRESQFLKVSARRALQGVAGLLLAVCVLLAVYAPGTNSAKWIAGVYAVNRGAAMIQCGLTLSLLLFSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRE
Ga0116120_103010713300009641PeatlandLFRESQFLKVSARRALQGVAGLLLAVCVLLAVYAPGTNSAKWIAGVYAVNRGAAMIQCGLTLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLATYAIRAEFPSDVVRGVLNLLKTGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRELRQFLRH*
Ga0116110_127288513300009643PeatlandIALRFGVIDEVCKDLFRESQFLKVAARRSLLCVTGLLLGLGVLLAVYAPGDITVRWLAGVFAVNRGAAMVQSGLLLSLLLFSRFLGVTWRRHAFGIALGLAVLTSAYLAIYGLRAEFTSRAGTDFLNLLLNGTNLVCVSIWIGYVLAPEPEPASLAVVSHDEVETWNTELQHLLKD*
Ga0116135_106529823300009665PeatlandLRSVPGVSAKVYLYAYSATLLLSIALRFGVIEEVSKQLFRESQFLRVSAKRSLLCIQGLQLVMGVVLAVYAPSSNSFRLVAGIVVVSRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGITLGLGILTSVDLAVYAVRAGFAPGVGAEFLNFLTTGTYLVCVLIWIGYLLAPEHQPVSLTAVSRDEVETWNTELQHLLRD*
Ga0116224_1028930523300009683Peatlands SoilYATLFLSIALRFGVSEEVSKDLFRESMLLKVAARRSLRCVTGFLLVVGVLIAVYAPGDISVRLVAGSIVSRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGVVLGLGVLTSVDLAIYALRTEFSSAVWVPYLNLAMTGAYLVCVSIWIGYLLAPEPQPAFVSRDEVETWNSELQQWIRH*
Ga0116130_122782013300009762PeatlandLYSALGVNLEQSSYAYAYSATLMFSIALRFGVIDEVSKDLFRGSQFLKVSARRALLCVTGLLLAMGVLLAVYAPGNNSAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGITLGLGILTSVDLAFSALRAEFTSRVGAEFLNLLITGAYLVCVSIWIGYLRAPEIEPASLTVVPRDEVETWNRELR
Ga0074044_1048812323300010343Bog Forest SoilFILLFTLYLFALYSVAGVTANHYAYAYSATLPFNIALRFGVIDEVCKDLFRDSQFLKVAARRSLLCLTGLLLGVGVLLAVYAPGGNSVRWFAGVLAVNRGAAVVQSGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVYLANYALRAEFTGKVAAGFLSLLTTGTFLVCVSIWIGYLLAPEPEPASLAVVPHGEVETWNTELQHLLRD*
Ga0074044_1050557623300010343Bog Forest SoilLLFTLYTVYGVTGRQYAYAFSATLLLIIALGFGVIDEVSRDLFRKSPFLKVAAKRLLRCVAGLLLVMGVLLAVHAPGSNSVRWHAGISVINRGAAMVQCGLLLALLLLARFLGLTWRRITFGITLGLGTLASVDVAASALRAEFTSAAAMELLNLLTTGIYLVCVSIWTGYLFAPELEPAASPTIGSPDEMETWNTELQNLLKH*
Ga0074044_1107450213300010343Bog Forest SoilSIALRFGVIDEICKDLFRESQFLQVAAGRSLRCVTGLLLVMGVLLAVYAPGGNSVKWFAGVLVVNRGAAMVQCGSLLSLLLFSRFLGLSWRRAAFGIALGLGILTSVDLAAYAVRAEFTSGAGAAFLNLLTKGTYLVCVSIWIGYSLTPELESASSTIVPHDEVETWNREFQHLL
Ga0138560_110169513300011083Peatlands SoilLSIALRFGVIDEVSKDLFRESQFLKVAARRSLQCITGLLLAMGVALAVYAPGDISVKWVAGASVVTRGAALVQCGLLLTLLLFSRFLGLTWRRPAFGITLGLGVLTSVNLAIYALRAEFTNRVGAAFLNFLATGTYLVCVSIWIGYLLAPEPQPASLAVVPHDEVETWNTELQHLLRD*
Ga0138576_127596913300011088Peatlands SoilSLQCVTGLLFVVGILFAVYAPSDNSFDSRLLAGTLVVNRGAAMVQSGLLLSLLLFSRFLGLSWRRLAFGITLGLGIVTSVDLAMFALRAEFTSAAGKEFLNLLITGTYLICVLIWIRYLLAPEPEPASLAVVPHDEVETWNTELQHLLRD*
Ga0150983_1520657813300011120Forest SoilVAARRSLQCVTGLLLGAGALLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELEVASPTVVAHDEVETWNRELQQFLKQ*
Ga0181521_1043517723300014158BogFSIALRFGVIDEVSKDLFRGSQFLKVSARRALLCVTGLLLAMGVLLAVYAPGNNSAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGITLGLGILTSVDLAFSALRAEFTSRVGAEFLNLLITGAYLVCVSIWIGYLRAPEIEPASLTVVPRDEVETWNRELRHFLRQ*
Ga0181530_1010607213300014159BogSQFLKVSARRALLCVTGLLLAMGVLLAVYAPGNNSAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGITLGLGILTSVDLAFSALRAEFTSRVGAEFLNLLITGAYLVCVSIWIGYLRAPEIEPASLTVVPRDEVETWNRELRHFLRQ*
Ga0181538_1038009923300014162BogGVIDEVSKDLFSESQFLKVAARRTLQWVTGLLLIMGVLLGVYAPGGNTARWYAGVFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAFSALRAEFNSRVGAQLLDLLVTGTYLVCVLIWVGYSLAPELEPASLAVVPHDEVETWNTELQHFLRD*
Ga0181532_1003494913300014164BogESQFLKVAARRTLQWVTGLLLIMGVLLGVYAPGGNTARWYAGVFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAFSALRAEFNSRVGAQLLDLLVTGTYLVCVLIWVGYSLAPELEPASLAVVPHDEVETWNTELQHFLRD*
Ga0181531_1094685513300014169BogGFPFLKVSARRTLQWTVGFLLPVSVLLAVYAPGSNSTQWYDAIFVVNRGAAMVQCGLLLALLLFSQFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFTSEAAKQMLGLLITGTYLVCVSIWMGYLLVPEPKPASLAVLPHGEVETWNKEFQRLLRD*
Ga0181537_1054468413300014201BogISGDLFRGFPFLKVSARRTLQWTVGFLLPVSVLLAVYAPGSNSTQWYDAIFVVNRGAAMVQCGLLLALLLFSQFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFTSEAAKQMLGLLITGTYLVCVSIWMGYLLVPEPKPASLAVLPHGEVETWNKEFQRLLRD*
Ga0181516_1053163613300014655BogYFVQGTGGKQYRYAFCATLLLSIALRFGVIDEVAKGLFRKSQFLKVAARRWLQCVQGLLLMVAVLLAVCAPGGNSLGVAAGIFVVNRGAALVQCGLLIALLLSSGFLGLSWHRPAFGIALGVALLTTFDLAMFSLRAEFTSATGKEILNLLTTGTYLICVLLWIGYLRVPEPEPDSSSLAVLPHDEVETWNTEFQHLLRD*
Ga0187818_1049695113300017823Freshwater SedimentFILLFALYFVPGAGRQYAYAFSVTLLLSLALRFGVIHEVSRNSFRESPFLKASARRLLQCVGGLLLAMGILLAVYAPGSNAVRWHAGVSVVNRGAVMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGILTSVDLAASALRAEFASNAAKELLNLLITGASLVCVSIWFGYLLAPELKPVS
Ga0187849_124682213300017929PeatlandLYSALGVNLEQSSYAYAYSATLMFSIALRFGVIDEVSKDLFRGSQFLKVSARRALLCVTGLLLAMGVLLAVYAPGNNSAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGITLGLGILTSVDLAFSALRAEFTSRVGAEFLNLLITGAYLVCVSIWIGYLRAPEIEPASLTVVPRDEVETWNRELRHFLRQ
Ga0187849_132482813300017929PeatlandVSARRSLQCVTCLLALMGVLLAVYAPGDNSLRWIAGVSVVNRGAAMVQCGLLVDLLLFSRFLGVSWRRPAFGITLGLGVLTSVDLAFSALRAQLISRVGAEFLNLLITGAYLVCVSIWIGYLLAPEISPASVTDITRDEVEIWNRELQQFLKQ
Ga0187803_1031419113300017934Freshwater SedimentVVGLASKLYAYAFCATLLPSIALRFGVIDEVSRDLLREAQFLKVAARRSLQCVTGLLLVVGVLLAVYAPGDSRFGFVAGMLVVNRGAAMVQSGSLLALLLFSRFLGLSWRGPAFGIALGLGVLTSVDLAMFALRAEFASAVAAVYLNLLTTGTYLVCVLIWIGYLLAPEVDPASLTVVPRDEVETWNTELQRLLGH
Ga0187854_1018448313300017938PeatlandEVCKDLFRESQFLKVAARRSLLCVTGLLLGLGVLLAVYAPGDITVRWLAGVFAVNRGAAMVQSGLLLSLLLFSRFLGVTWRRHAFGIALGLAVLTSAYLAIYGLRAEFTSRAGTDFLNLLLNGTNLVCVSIWIGYVLAPEPEPASLAVVSHDEVETWNTELQHLLKD
Ga0187808_1050037613300017942Freshwater SedimentFILLFTLYLFALHSVAGVTANTYAYAWSATLTFNIALRFGVIDEVCKDLFRDSQFLKLAARRSLLCVTGLLLGVGVLLAVYAPGGNSVRWFAGVLAINRGAAMVQSGLLLSLLLFSRFLSLSWRRSAFGIALGLGVLTSLYLANYALRAEFTSKAGADFLNLLTTGTYLACVSIWTGYLLTPEPEPV
Ga0187819_1068107023300017943Freshwater SedimentRVSARRLLQCVAGLLLGVGVLLAIYAPGNNSVRWHAGVSVVNRGAVMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGVGILTSVDLATSAIRVEFTSAVTRDFLNLLITAASLVCASIWIGYLWAPGREPAASLMVIPHDEVDKWNTELQHLLKD
Ga0187819_1076159713300017943Freshwater SedimentDLLREAQFLKVAARRSLQCVTGLLLVVGVLLAVYAPGDSRFGFVAGMLVVNRGAAMVQSGLLLALLLFSRFLGLSWRGPAFGIALGLGVLTSVDLAMFALRAEFASAVAAVYLNLLTTGTYLVCVLIWIGYLLAPEVDPASFTVVPRDEVETWNQELQQFLKQ
Ga0187781_1134655513300017972Tropical PeatlandFPAFFAYVLYKVAEFVFLFTFDALHVKGDYKYGYGATLMFSIALRFAVIDEISRNLLREYQFLKVAARRSLQCATALLIAVSVLVAVYAPGRNNARWSAGIFVVNRGAAMVQCGMLLFLLLFSRLLGLSWRRHAFGIALGLGILTSFDIADFALRTEFTSSASVHFLNLLITGRY
Ga0187884_1041291623300018009PeatlandRLLQGATGLLFVIGIVFAVYAPGENSIWWAAGASTICRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLAVLTSVDLAYSALRAEFTSKVGAEFLRLLTTGTYLVCVSIWIGYLLAPEPKPASLAVVPHDVVPHDEVETWNTELQHLLRD
Ga0187873_105990713300018013PeatlandQFLKVTARRSLLGVTGLLLVIGVLLAVYAPGDNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLAVLTSLDLAMFALRAEFTSRAGAEFLNLLITGNYLVCVSIWIGYLLAPEAKPASLAAVPHDEVETWNTELQRLLKG
Ga0187866_128573813300018015PeatlandALLSAPSVTEEQYAYAYYATLMLSVALRFGVIDEVSKDLFRESQFLKVSARRALQGITGLLLAMGVLLAVYAPGDNRAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPVSLTVVPHDEVETWNTEL
Ga0187874_1025309223300018019PeatlandGVIDEVSKDLFRESQFLKMAARRSLLCVTGLLLLIGVLLTVYAPGGYSDGWWYTGAAVINRGAAMIQSGLLLALLLSSRFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFASEAMKDILNLLMTGTYLVCVLIWIGYSLAPELELASLTIVSHDEVENWNTELQHLLRD
Ga0187882_134315913300018021PeatlandKVSARRSLQGVTAFLLVMGVVLTVYAPGGSSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLAVLTSLDLAMFALRAEFTSRAGAEFLNLLITGNYLVCVSIWIGYLLAPEAKPASLAAVPHDEVETWNTELQRLLKG
Ga0187882_137996413300018021PeatlandIAKFIPLFALYSVQGVTGKEYAYAYCVTLLVSIVLRFGVIAEISRNLFRESQFLKVAARRSLQCVTGLLFVVGVLLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLSLLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVLIWIGYLL
Ga0187882_140782013300018021PeatlandTLHAAPIVTREQYRYAYCATLLLSIALRFGVIDEVSKDLFRESQFLKMAARRSLLCVTGLLLLIGVLLTVYAPGGYSDGWWYTGAAVINRGAAMIQSGLLLALLLSSRFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFASEAMKDILNLLMTGTYFVCVLIWIGYLL
Ga0187864_1046630513300018022PeatlandNLFRESQFLKVAARRSLQCVTGLLLVVAVLLAVFAPGGNTKWYAGIFVVNRGAAMVQSGLLLSLLLFSRFSGLSWRRPTFGIALGLAVLTSLDLAMFALRATFTSKTGVEFLNLLIPCTYLICVSIWIRYSRAPEPEPAASLAVVPHDEVETWNTELQRLLKG
Ga0187864_1047967013300018022PeatlandILLFALYSLRSVSVEKYAEAFSATLLFSIALRFGVIDEVSKDLFRESPFLKLAARRSLQCVTGLLLVIGVLFAVYAHSDNSVRLVAVSVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAAYAVRAEFTSAVGTEFLNLLTTGTYLVCVLIWIGYLLA
Ga0187889_1039535523300018023PeatlandIDEVSRDLLRESQFLKVAVRRSLQCVTGLLLVMGVLLAVYAPGDNRFAFVTGIFVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGIALGLAVLTSLDLAMFALRAEFTSRAGAEFLNLLITGNYLVCVSIWIGYLLAPEPKPASLAAVPHDEVETWNTELQHLLRD
Ga0187857_1033480813300018026PeatlandLRFGVIAEISRNLFRESQFLKVAARRSLQCVTGLLFVVGVLLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLSLLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVLIWIGYLLVPEVEPASVTVVPHDEVETWNREFQQFLRH
Ga0187867_1008976343300018033PeatlandSIALRFGVIDEVSKDLFRESQFLKMAARRSLLCVTGLLLLIGVLLTVYAPGGYSDGWWYTGAAVINRGAAMIQSGLLLALLLSSRFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFASEAMKDILNLLMTGTYFVCVLIWIGYLLLPEPKPASIAVLPHDEVETWNTEFQRLLRAKD
Ga0187871_1063647813300018042PeatlandYCATLMISIVLRFGVIDEVSRGLFRGSQVLRLSARRALQCVTGLLLILGVLLAVYAPGDYSAKWYVGVAVVNRGAAMVQSGLLLALLLYSRFLGLSWRRPALGIALGLAVLTSADLATFALRAAFTSELAKDIVNLLMTGTYFVCVLIWIGYLLLPEPKPASIAVLPHDEVETWNTEFQRLLRAKD
Ga0187890_1042906213300018044PeatlandSIALRFGVIDEVSKDLFRESQFLKVSARRALQGITGLLLAMGVLLAVYAPGDNRAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPEIEPASLTVVPRDEVETWNRELRQFLRH
Ga0187852_128412523300019082PeatlandSIALRFGVIDEVSKDLFRESQFLKVSARRSLQGVTAFLLVMGVVLTVYAPGGSSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLAVLTSLDLAMFALRAEFTSRAGAEFLNLLITGNYLVCVSIWIGYLLAPEAKPASLAAVPHDEVETWNTELQRLLKG
Ga0187852_136968013300019082PeatlandVVTLLGIVLRFGVIDEVSKDLFRDGKFLKVPARRLLQGATGLLFVIGIVFAVYAPGENSIWWAAGASTICRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLGILVTVDLATFAIRAEFTLDVAVLYSNLLIMGTCFVCNSIWIKYLRAPELSPASLTVVPHEDVEIWNKELQEFLRQ
Ga0182031_102675023300019787BogFLKMAARRALQCVTVSLLVVGALLVVYAPGSNNGRWYEGVFVVNRGAAMVQCGLLLALLLSSCFLGLSWRRPAFGIALGLAALTSADLATFALRAAFTSEAAKEILNLLMTGPYLVCVSIWIGYLLAREPKPASVAVLPHDEVETWNTEFQRLLRH
Ga0182031_154841643300019787BogVIDEISKNLFRESHFLKMAARRALQCVTVSLLVVGALLVVYAPGSNNGRWYEGVFVVNRGAAMVQCGLLLALLLSSCFLGLSWRRPAFGIALGLAALTSADLATFALRAAFTSEAAKEILNLLMTGPYLVCVSIWIGYLLAREPKPASVAVLPHDEVETWNTEFQRLLRH
Ga0210406_1124629313300021168SoilTLLISIVLRFGVIDEISRNLFRESQFLKVAARRSLQCVTGLLLGAGALLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELEVASPTVVAHDEVETWNRELQQFL
Ga0210406_1136551813300021168SoilESEFLKVAARRSLQCVTGLLFLVGVLLAVYAPGDNSVRWIAGVSVVNRGAAMVQCGLLLSLLLFSGFLGVSWRGTAFGITLGLGVLTSVDLATYALRAEFTSKVGEEFLNLLIPGTYLVCVLIWIRYLLAPELQPVSPTVVPHEEVETWNTELQRLLRD
Ga0210400_1118632713300021170SoilSIVLRFGVIDEISRNLFRESQFLKVAARRSLQCVTGLFLGAGALLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELVSPTVVAHDEVETWNRELQQLIKQ
Ga0210389_1072005823300021404SoilLLVSIALRFGVIDEVSKDLFRESMFLKAAARRALQCVTGLLLVMGVLLAAYAPGDNSVRLIAGIFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVQTSVDLAMFALRAQFTSAASINFLNLLITGTYLICVLTWLGYLLVPEHEPASAGIISHDEVETWNKELQHFLKQ
Ga0210402_1012660513300021478SoilDEISRNLFRESQFLKVAARRSLQCVTGLFLGAGALLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELVSPTVVAHDEVETWNRELQQLIKQ
Ga0242661_102734123300022717SoilAARRSLQCVTGLLLGAGALLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELEVASPTVVAHDEVETWNRELQQFLKQ
Ga0242654_1002126233300022726SoilCVTLLISIVLRFGVIDEISRNLFRESQFLKVAARRSLQCVTGLFLGAGALLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELASPTVVAHDEVETWNRELQQLIKQ
Ga0224521_113057313300024233SoilLFTLYVVPNATGKHYTYAYGATLLFSIVLRFGVIDEVSKDLFRESPFLKVSARRLLQFVTGLLIAIGVLLAAYAPGDSSAKWYAGVFVVNRGAAIVQSGLLLSLLLFSSFLGLSWRRPAFGIALGLGVLTSADLAMFALRAAFTSEASLRFLDLLMTATYLVCVSIWIGYLLAPELE
Ga0208034_105767423300025442PeatlandQHSYAYAYSATLLFSIALRFGVIDEVSKDLFRESQFLKVSARRALQGITGLLLAMGVLLAVYAPGDNRAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRELRQFLRH
Ga0208455_102168813300025453PeatlandYPAALTFNIALRFGVIDEVCKDLFRESQFLKVAARRSLLCVTGLLLGLGVLLAVYAPGDITVRWLAGVFAVNRGAAMVQSGLLLSLLLFSRFLGVTWRRHAFGIALGLAVLTSAYLAIYGLRAEFTSRAGTDFLNLLLNGTNLVCVSIWIGYVLAPEPEPASLAVVSHDEVETWNTELQHLLKD
Ga0208689_110306113300025459PeatlandQSSYAYAYSATLMFSIALRFGVIDEVSKDLFRGSQFLKVSARRALLCVTGLLLAMGVLLAVYAPGNNSAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGITLGLGILTSVDLAFSALRAEFTSTAAANFLNLLLMGADLVSVSIWIGYLWAPEPAL
Ga0208562_108966613300025460PeatlandYCATLLLSIALRFGVIDEVSKDLFRESQFLKMAARRSLLCVTGLLLLIGVLLTVYAPGGYSDGWWYTGAAVINRGAAMIQSGLLLALLLSSRFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFASEAMKDILNLLMTGTYLVCVLIWIGYSLAPELELASLTIVSHDEVENWNTELQHLLRD
Ga0208687_102985033300025469PeatlandRALQGITGLLLAMGVLLAVYAPGDNRAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRELRQFLRH
Ga0208479_104053223300025474Arctic Peat SoilLRFGVIEEASRDFFRESQFLKVAARRSLQCVTGLLLVMGVLLAVYAPGDNSVRWYAGVFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLGALTSADLAMFALRAAFTSGAAVEVLDLLITGAYLVCVSIWIGYLLAPELEPVTLTVVHDNEVETWNRELQQLLRP
Ga0208688_103902323300025480PeatlandAYSATLLFSIALRFGVIDEVSKDLFRESQFLKVSARRALQGITGLLLAMGVLLAVYAPGDNRAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRELRQFLRH
Ga0208688_106679923300025480PeatlandTLLLSIALRFGVIDEVSKDLFRESQFLKMAARRSLLCVTGLLLLIGVLLTVYAPGGYSDGWWYTGAAVINRGAAMIQSGLLLALLLSSRFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFASEAMKDILNLLMTGTYLVCVLIWIGYSLAPELELASLTIVSHDEVENWNTELQHLLRD
Ga0257172_103015913300026482SoilISRNLFRESQFLKVAARRSLQCVTGLLLGAGALLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLFFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSTWIGYLLAPELELASPTVVAHDEVETWNRELQQFLKQ
Ga0257157_103233013300026496SoilIDEVSKDLFRESQLLKVSARRSLQCVTGLLVVVGVLLAVYAPGDNSGRWMAGVSVVNRGAAMVQCGLLLALLLFSRFLGLSWRRSTFGIALGLGILTSVDLAMFALRTAFASWVAVEFFNLLITGAYLVCVSIWIGYVLALELKPASLAVVPNDNDNAEVETWNRELQQLLKH
Ga0209648_1069979723300026551Grasslands SoilCVTGLLLGAGALLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAALTSEAAANFLDLLITGTYLACVSTWIGYLLAPELELASPTVVAHDEVETWNRELQQFLKQ
Ga0207947_101382813300027171Forest SoilLVSIALRFGVIDEVSKDLFRESMFLKAAARRALQCVTGLLLVMGVLLAAYAPGDNSVRLIAGIFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVQTSVDLAMFALRAQFTSAASINFLNLLITGTYLICVLTWLGYLLVPEHEPASAGIISHDEVETWNKELQHFLKQ
Ga0209222_102934923300027559Forest SoilLRSVPGVTGNQYVYAYSTTLLFSIVLRFGVIHEVSKNLFRDSQFLQVSARRSLQCVTGLMLLMGILLAVYAPGDISSKWYASIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLGVLTSIDLAYSGLRAQFSSKAGEELLNLLITGTYLVCVLIWIGYLLAPELKPASLTVVSREEVETWNTELQHLLKD
Ga0209905_109142413300027634Thawing PermafrostRESHFLKMAARRALQCVTVSLLVVGALLVVYAPGSNNGRWYEGVFVVNRGAAMVQCGLLLALLLSSCFLGLSWRRPAFGIALGLAALTSADLATFALRAAFTSEAAKEILNLLMTGPYLVCVSIWIGYLLAREPKPASVAVLPHDEVETWNTEFQRLLRH
Ga0208827_121389113300027641Peatlands SoilAGVTANQYAYAYSATLPFNIALRFGVIDEVCKDLFRDSQFLKVAARRSLLCVTGLLLGVGVLLAVYAPGGNSVRWFAGVLAVNRGAAVVQSGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVYLANYALRAEFTSRSGADFLNLLTTGTYLVCVSIWTGYLLAPE
Ga0209117_1000438173300027645Forest SoilFRESQFLRVAARRSLQCVTGLLLGAGALLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPEVELASPTDVPHDEVETWNRELQQLLKE
Ga0209420_113792913300027648Forest SoilTLLLSIALRFGVIEEVSKQLFRESQFLRVSAKRSLLCIQGLLLVMGVVLAVYAPSSNSFRLVAGIVVVSRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGITLGLGILTSVDLAVYAVRAGFAPGVGAEFLNFLTTGTYLVCVLIWIGYLLAPEHQPVSLTAVSRDEVETWNTELQHLLR
Ga0208990_103055113300027663Forest SoilDEVSKDLFRESQLLKVSARRSLQCVTGLLLVVGVLLAVYAPGDNSGRWIAGVSVVNRGAAMVQCGLLLALLLFSRFLGLSWRRSTFGIALGLGILTSVDLAMFALRTAFASWVAVEFFNLLITGAYLVCVSIWIGYVLALELNPASLTVVPNDNDNAEVEMWNRELQQLVKH
Ga0208981_115865813300027669Forest SoilLISIVLRFGVIDEISGNLFRESQFLKVASRRSLQCVAGLLLGAGALLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAASFLDLLITGTYLVCVSIWIGYLLAPEVELASPTDVPHDEVETWNRELQQLLKE
Ga0209038_1013614523300027737Bog Forest SoilDLFRESQFLQVAAGRSLRCVTGLLPVMGVLLAVYAPGGNSVKWFAGVLVVNRGAAMVQCGSLLSLLLFSRFLGLSWRRAAFGIALGLGILTSVDLAAYAVRAEFTSGAGAAFLNLLTKGTYLVCVSIWIGYSLTPELESASSTIVPHDEVETWNREFQHLLKP
Ga0209415_1014374213300027905Peatlands SoilLGATSKPYAYVFSATLMISIALRFGVIDEVSKDLFRESQFLKVAARRSLQSVAGLLLAVGVLLAVYAPGDNSARLIAGVSVVNRGAAMVQCGLLVSLLLFSRFLGLSWRRPAFGIALGLGIVTSVDLAMFALRAEFASAVAAEYLNLLVTGAYLVCVSIWIGYLLAPELEPASLAVVPHDEVETWNTELQHLLRD
Ga0209415_1059652813300027905Peatlands SoilYAYYATLLLSIALRFGVIEEVSRDLFRESMFLRVAARRSLRCITALLLVMGVLLAVYAPGDNGVRLVAGSVVNRGAAMVQCGLLLSLLLFSRFVGLSWRRPAFGITLGLGVLTSVDLAIYAIRTEFSSAAWVPYLNLAMTGTYFVCVLIWIGYLLAPELKPASLTDVSRDEVETWNTELQHLVR
Ga0209415_1088415413300027905Peatlands SoilKVAARRSLLCVTGLLLGVGVLLAVYVPGGNSVRWLAGVLAINRGAAIVQSGLLLSLLLFSRFLGLSWHRSAFGIALGLGVLTSVYLANYALRAEFTSRAGADFLNLLTTGTYLICVSIWTGYLLAPEPEPVSLPAVPHDEVETWNTELQQLLRD
Ga0209415_1088421823300027905Peatlands SoilKVAARRSLLCVTGLLLGVGVLLAVYAPGGNSVRWFAGVLAVNRGAAVVQSGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVYLANYALRAEFTSRSGAGFLNLLTTGTYLVCVSIWSGYLLAPEPEPASLAVVPHDEVETWNTELQHLLRD
Ga0137415_1050916023300028536Vadose Zone SoilQLLKVPARRSLRCVTGLLLVVGVLLAVYAPGDNSGRWIAGVSVVNRGAAMVQCGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANLLDLLITGTYLVCVSIWIGYLLAPELELAPATVVAHDEVETWNRELQQFLKQ
Ga0302219_1005325713300028747PalsaTGGKQYRYAFCATLLLSIALRFGVIDEVAKGLFRKSQFLKVAARRWLLCIQGLLLMMAVLLAVSAPGGNSLGLAAGIFVVNRGAALVQCGLLIALLLSSRFLGLSWHPPAFGIALGVAVLTTFDLAMFSLRAEFTSATGKEILNLLTTGTYLICVLLWIGYLRVPEAEPDSSSLAVLPHDEVETWNTEFQHLLRD
Ga0302222_1008390313300028798PalsaIDEVAKGLFRKSQFLKVAARRWLLCIQGLLLMMAVLLAVSAPGGNSLGLAAGIFVVNRGAALVQCGLLIALLLSSRFLGLSWHPPAFGIALGVAVLTTFDLAMFSLRAEFTSATGKEILNLLTTGTYLICVLLWIGYLRVPEAEPDSSSLAVLPHDEVETWNTEFQHLLRD
Ga0302221_1043648813300028806PalsaKQYRYAFCATLLLSIALRFGVIDEVAKGLFRKSQFLKVAARRWLLCIQGLLLMMAVLLAVSAPGGNSLGLAAGIFVVNRGAALVQCGLLIALLLSSRFLGLSWHPPAFGIALGVAVLTTFDLAMFSLRAEFTSATGKEILNLLTTGTYLICVLLWIGYLRVPEAEPDSSSLAVLPHDEVETWNTEFQHLL
Ga0247275_100396813300029817SoilIALRFGVIDEVSKDLFRESQFLKVAARRSLQCVTGLLLVIGVLFAVYAHSDNSVRLVAVSVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAAYAVRAEFTSAVGTEFLNLLTTGTYLVCVLIWIGYLLAPEAEPASVAVLPRDEVETWNTEFQHLLRD
Ga0311368_1060497523300029882PalsaRFLKVAARRLLQCVTGLLLVISIVLAVYSPGNNTVRWQTGISVINRGAAMVQCGLLLSLLLFSYFLGLTWRRPAIGITLGLGILTSIDLATSALRAEFTSAATRELLNLMVTGSALACVSIWIGYLLVPEPNPAPVTVVSSDEVETWNKELQRLARH
Ga0246001_101613213300029889PeatLSIALRFGVIDEVSKDLFRESQFLKVSARRSLQGVTAFLLVMGVVLTVYAPGGSSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLAVLTSLDLAMFALRAEFTSRAGAEFLNLLITGNYLVCVSIWIGYLLAPEAKPASLAAVPHDEVETWNTELQRLLKG
Ga0311331_1129760013300029954BogDEVSKDLFRESRFLKVAARRSLQCVTGLLIAVGVLLAMFAPGDNSIKWIAGVSVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRLAFGITLGLGASASVDLAIYALRAEFISQRWTEFLNLLSTGTDLVCVLIWIGYVLAPEHTPASPTVFPDDEVNTWNRELQQLLRQ
Ga0265746_100857413300030815SoilYAYSTTLLFSIVLRFGVIHEVSKNLFRDSQFLQVSARRSLQCVTGLMLLMGILLAVYAPGDISSKWYASIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLGVLTSIDLAYSGLRAQFSSKAGEELLNLLITGTYLVCVLIWIGYLLAPELKPASLTVVSREEVETWNTELQHLLKD
Ga0302180_1031171223300031028PalsaSVLGVTGKPYGYAYCATLLLSIALRFGVINEVANDLFRESRFLKVSARRSLQCVTGLLLVMGVLLAVYAPGDNSAKWYAGVFVVNRGAAMVQSGLLLSLLLFSRFLGMSWRRPAFGITLGLGVLTSLDLAYSALRAEFSSGVGAEFLNLLITGVYLVCVSIWMRYLVAPEPEPVSPTAVPHDEVEIWNRELQQFLKH
Ga0170822_1068686113300031122Forest SoilSLRCVTGLLLLVGVVLAVYAPGDNSVRWIAGVSVVNRGAAMVQCGLLLSLLLVSRFLGVSWRGAAFGITLGLGVLASVDLAAYALRAEFTSKVGEKFLNLVIPGTYLVCVLIWIRFLLAPELQPASPPVVPHDEVETWNTELQRLLRD
Ga0302326_1194965823300031525PalsaFALNSASSVTAEQYAYAYYFTLLFSIALRFGVIEEVSRGLFRESMFLKVAARRSLRCVAGLLLVMGVLLAVYAPGNNSIKLVAGSVVNRGAAMVQCGLLLSLLLFSRFVGLSWRRPAFGIALGLGVLSSVDLATFALRTEFSSAAWVPYLNWAITGTYFVCVSIWIAYLLAPELEPASLTVLSRDEVENWNSELQHVVRQ
Ga0307474_1046373313300031718Hardwood Forest SoilHSVSGEVYAYIFSATLLVSIALRLGVIDEVSKNLFREYDFLKVSARRLLQCVAALLLGIGTLLAVYAPGNNSAKWHAGVFVVNRGAAMVQCGLLLSLLLLSRFMGLSWRRPVFGITLGLGILSSVDLATSALRAEFTSPAMKEFLNLLITGSSFVCVLIWIGYLLVPERKPAFPALVPHDEVEIWNRELQHLLKH
Ga0307474_1138349813300031718Hardwood Forest SoilVSKDLFRESQLLKVSARRSLQCVTGLLLVVGVLLAVYAPGDNSGRWIAGVSVVNRGAAMVQCGLLLALLLFSRFLGLSWRRSTFGIALGLGILTSVDLAMFALRTAFASWVAVEFFNLLITGTYLVCVSIWIGYVLALELKPASLTVVPNDNDNAEVETWNRELRQLLKH
Ga0307475_1055645313300031754Hardwood Forest SoilYCGTLLLSIALRFGVIDEVSKDLFRESEFLKVAARRSLRCVTGLLLLAGVVLAVYAPGDNSVRWIAGVSVVNRGAAMVQCGLLLSLLLFSRFLGVSWRGTAFGITLGLGVLASVDLAAYALRAEFTSKVGEEFLNLLIPGTYLVCVLIWIRFLLAPELQPASPPVVPDDEVESWNTELQRLLRD
Ga0326631_10475023300032072SoilSLQVVTGLLLVIGVVLAVYAPGSTSVRWFAGVLAVNRGVAMVQCGLLLSLLLFSCFLGLSWRRPAFGITLGLGVLTSVDLATYALRAEFTSRIGEEFLNLLTTGTYLICVLLWIGYLLAPEFEPASPTVVSRDEVETWNQELQHFLKH
Ga0316051_103149413300032119SoilRSLQVVTGLLLVIGVVLAVYAPGSTSVRWFAGVLAVNRGVAMVQCGLLLSLLLFSCFLGLSWRRPAFGITLGLGVLTSVDLATYALRAEFTSRIGEEFLNLLTTGTYLICVLLWIGYLLAPEFEPASPTVVSRDEVETWNQELQHFLKH
Ga0307471_10007692013300032180Hardwood Forest SoilKVAAKRSLQCITGLLLVMGVLLAVYAPGDNSAKWYAGIFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRSAFGIALGLGILTSVDLAFSALRAEFASEVGAELLDLLITGTYLVCVSIWIGYLLAPELEPASVAAVPHEEVETWNRELQQLLKQ
Ga0334837_008258_4492_50043300033823SoilVIDEVAKDLFRESQFLKVAARRTLQCVTGLLLIMGVLLGVYAPGGNSARWYAGVFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAFSALRAEFNSMVGAQLLDLLVTGTYLVCVLIWVGYSLAPELEPASLTVVSRDEVETWNTELQHLLRD
Ga0334847_002728_1104_16853300033826SoilVTEEQYRYAYSATLLLSIALRFGVIEEASRDFFRESQFLKVAARRSLQCVTGLLLVMGVLLAVYAPGDNSVRWYAGVFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLGALTSADLAMFALRAAFTSGAAVEVLDLLITGAYLVCVSIWIGYLLAPELEPVTLTVVHDNEVETWNRELQQLLRP
Ga0334810_185378_1_5043300033890SoilDEVSKDLFRESPFLKVSARRLLQFVTGLLIAIGVLLAAYAPGDSSAKWYAGVFVVNRGAAIVQSGLLLSLLLFSSFLGLSWRRPAFGIALGLGVLTSADLAMFALRAAFTSEASLRFLDLLMTATYLVCVSIWIGYLLAPELEPASLTVVPPDEVETWNREFQQFLKQ
Ga0370484_0184687_103_5373300034125Untreated Peat SoilVTGLLLGVGILLAVYAPGDNTVKWHTGISVVNRGAAIVQCGLLLFFLLFSRFLGLSWRRAAFGIALGLGILTSVDLAMFALRPEFSSKAAKEFLNLLRTGAYLICVSAWIGYLLAPELETASPAAVSLDEVETWNKELRHWLRD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.