NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068216

Metagenome / Metatranscriptome Family F068216

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068216
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 62 residues
Representative Sequence MKASTNSTLAATLIATAAGVGAWLFGLAKAIWPAHPQIAALVITIVVSVVVKQIWPVGQKSS
Number of Associated Samples 77
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.51 %
% of genes near scaffold ends (potentially truncated) 14.40 %
% of genes from short scaffolds (< 2000 bps) 60.80 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.200 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(25.600 % of family members)
Environment Ontology (ENVO) Unclassified
(63.200 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(47.200 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.22%    β-sheet: 0.00%    Coil/Unstructured: 47.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF07589PEP-CTERM 4.00
PF00266Aminotran_5 2.40
PF01053Cys_Met_Meta_PP 2.40
PF00082Peptidase_S8 2.40
PF02511Thy1 1.60
PF00829Ribosomal_L21p 1.60
PF00535Glycos_transf_2 1.60
PF02900LigB 1.60
PF13620CarboxypepD_reg 1.60
PF03739LptF_LptG 1.60
PF12543DUF3738 1.60
PF07676PD40 1.60
PF00692dUTPase 1.60
PF02518HATPase_c 1.60
PF13487HD_5 1.60
PF01925TauE 0.80
PF05193Peptidase_M16_C 0.80
PF13564DoxX_2 0.80
PF00196GerE 0.80
PF00149Metallophos 0.80
PF13426PAS_9 0.80
PF05016ParE_toxin 0.80
PF03703bPH_2 0.80
PF00583Acetyltransf_1 0.80
PF10754DUF2569 0.80
PF01478Peptidase_A24 0.80
PF02754CCG 0.80
PF07681DoxX 0.80
PF02424ApbE 0.80
PF01243Putative_PNPOx 0.80
PF02652Lactate_perm 0.80
PF01593Amino_oxidase 0.80
PF13589HATPase_c_3 0.80
PF00027cNMP_binding 0.80
PF08207EFP_N 0.80
PF02541Ppx-GppA 0.80
PF01842ACT 0.80
PF04072LCM 0.80
PF00378ECH_1 0.80
PF00656Peptidase_C14 0.80
PF03884YacG 0.80
PF01075Glyco_transf_9 0.80
PF00664ABC_membrane 0.80
PF00654Voltage_CLC 0.80
PF02449Glyco_hydro_42 0.80
PF02824TGS 0.80
PF12773DZR 0.80
PF00158Sigma54_activat 0.80
PF13444Acetyltransf_5 0.80
PF02887PK_C 0.80
PF14871GHL6 0.80
PF02896PEP-utilizers_C 0.80
PF09363XFP_C 0.80
PF02574S-methyl_trans 0.80
PF13366PDDEXK_3 0.80
PF13977TetR_C_6 0.80
PF09243Rsm22 0.80
PF00171Aldedh 0.80
PF14310Fn3-like 0.80
PF01783Ribosomal_L32p 0.80
PF00561Abhydrolase_1 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 2.40
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 2.40
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 2.40
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 2.40
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 2.40
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 2.40
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 2.40
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 2.40
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 2.40
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 2.40
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 2.40
COG0248Exopolyphosphatase/pppGpp-phosphohydrolaseSignal transduction mechanisms [T] 1.60
COG0261Ribosomal protein L21Translation, ribosomal structure and biogenesis [J] 1.60
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 1.60
COG0756dUTP pyrophosphatase (dUTPase)Defense mechanisms [V] 1.60
COG0795Lipopolysaccharide export LptBFGC system, permease protein LptFCell wall/membrane/envelope biogenesis [M] 1.60
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 1.60
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.80
COG0038H+/Cl- antiporter ClcAInorganic ion transport and metabolism [P] 0.80
COG0231Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A)Translation, ribosomal structure and biogenesis [J] 0.80
COG0247Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcFEnergy production and conversion [C] 0.80
COG0333Ribosomal protein L32Translation, ribosomal structure and biogenesis [J] 0.80
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.80
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.80
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.80
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 0.80
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.80
COG1477FAD:protein FMN transferase ApbEPosttranslational modification, protein turnover, chaperones [O] 0.80
COG1620L-lactate permeaseEnergy production and conversion [C] 0.80
COG1874Beta-galactosidase GanACarbohydrate transport and metabolism [G] 0.80
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.80
COG2048Heterodisulfide reductase, subunit BEnergy production and conversion [C] 0.80
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.80
COG3024Endogenous inhibitor of DNA gyrase, YacG/DUF329 familyReplication, recombination and repair [L] 0.80
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.80
COG3402Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.80
COG3428Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.80
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.80
COG4249Uncharacterized conserved protein, contains caspase domainGeneral function prediction only [R] 0.80
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.80
COG5459Ribosomal protein RSM22 (predicted mitochondrial rRNA methylase)Translation, ribosomal structure and biogenesis [J] 0.80


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.20 %
UnclassifiedrootN/A12.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001471|JGI12712J15308_10083968All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3807Open in IMG/M
3300002245|JGIcombinedJ26739_100101999All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2687Open in IMG/M
3300004080|Ga0062385_10266371Not Available964Open in IMG/M
3300004092|Ga0062389_103742996All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3571Open in IMG/M
3300004152|Ga0062386_100071221All Organisms → cellular organisms → Bacteria2642Open in IMG/M
3300004152|Ga0062386_101392101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3584Open in IMG/M
3300005534|Ga0070735_10189357All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300006059|Ga0075017_100049394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA32823Open in IMG/M
3300009623|Ga0116133_1233874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3500Open in IMG/M
3300009644|Ga0116121_1094443Not Available936Open in IMG/M
3300009644|Ga0116121_1126266All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3805Open in IMG/M
3300009645|Ga0116106_1294234All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3517Open in IMG/M
3300009700|Ga0116217_10695756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3629Open in IMG/M
3300009762|Ga0116130_1204183All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3626Open in IMG/M
3300010339|Ga0074046_10278175Not Available1033Open in IMG/M
3300010341|Ga0074045_10094487All Organisms → cellular organisms → Bacteria2075Open in IMG/M
3300010341|Ga0074045_10586780All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3712Open in IMG/M
3300010341|Ga0074045_10652525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3670Open in IMG/M
3300010379|Ga0136449_100866918All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300014151|Ga0181539_1049921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1975Open in IMG/M
3300014151|Ga0181539_1108070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1160Open in IMG/M
3300014151|Ga0181539_1204034All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300014152|Ga0181533_1094298All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1353Open in IMG/M
3300014152|Ga0181533_1232814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3695Open in IMG/M
3300014153|Ga0181527_1054202All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2124Open in IMG/M
3300014160|Ga0181517_10000920All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae35571Open in IMG/M
3300014160|Ga0181517_10013670All Organisms → cellular organisms → Bacteria6027Open in IMG/M
3300014160|Ga0181517_10035023All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3225Open in IMG/M
3300014160|Ga0181517_10063125All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter2237Open in IMG/M
3300014160|Ga0181517_10063689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA32225Open in IMG/M
3300014160|Ga0181517_10166040All Organisms → cellular organisms → Bacteria → Acidobacteria1229Open in IMG/M
3300014161|Ga0181529_10002384All Organisms → cellular organisms → Bacteria → Acidobacteria22550Open in IMG/M
3300014161|Ga0181529_10234047All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans1057Open in IMG/M
3300014162|Ga0181538_10718084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3517Open in IMG/M
3300014164|Ga0181532_10596862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3600Open in IMG/M
3300014167|Ga0181528_10052995All Organisms → cellular organisms → Bacteria → Acidobacteria2246Open in IMG/M
3300014167|Ga0181528_10323530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae836Open in IMG/M
3300014167|Ga0181528_10336698All Organisms → cellular organisms → Bacteria → Acidobacteria818Open in IMG/M
3300014200|Ga0181526_10503995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans766Open in IMG/M
3300014200|Ga0181526_11006554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3524Open in IMG/M
3300014491|Ga0182014_10038670Not Available3497Open in IMG/M
3300014491|Ga0182014_10318816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3793Open in IMG/M
3300014491|Ga0182014_10643768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3506Open in IMG/M
3300014492|Ga0182013_10039552All Organisms → cellular organisms → Bacteria3770Open in IMG/M
3300014492|Ga0182013_10478950All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3652Open in IMG/M
3300014501|Ga0182024_10161239All Organisms → cellular organisms → Bacteria → Acidobacteria3131Open in IMG/M
3300014501|Ga0182024_10670982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31285Open in IMG/M
3300014838|Ga0182030_10009993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus19359Open in IMG/M
3300014838|Ga0182030_10786406All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_60_22873Open in IMG/M
3300014839|Ga0182027_10093550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales3636Open in IMG/M
3300014839|Ga0182027_10317447All Organisms → cellular organisms → Bacteria1757Open in IMG/M
3300014839|Ga0182027_10433360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1452Open in IMG/M
3300016701|Ga0181509_1121391All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae692Open in IMG/M
3300017925|Ga0187856_1014320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4340Open in IMG/M
3300017925|Ga0187856_1305107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3547Open in IMG/M
3300017930|Ga0187825_10182338All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300017935|Ga0187848_10150050All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1027Open in IMG/M
3300017935|Ga0187848_10201773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3855Open in IMG/M
3300017948|Ga0187847_10149000All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300017948|Ga0187847_10200574All Organisms → cellular organisms → Bacteria → Acidobacteria1087Open in IMG/M
3300017955|Ga0187817_10073993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2123Open in IMG/M
3300017988|Ga0181520_10002331All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae35568Open in IMG/M
3300017988|Ga0181520_10009480All Organisms → cellular organisms → Bacteria → Acidobacteria13433Open in IMG/M
3300017988|Ga0181520_10018520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus8159Open in IMG/M
3300017988|Ga0181520_10053579All Organisms → cellular organisms → Bacteria → Acidobacteria3807Open in IMG/M
3300017988|Ga0181520_10058443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3586Open in IMG/M
3300017988|Ga0181520_10347924All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300017988|Ga0181520_10520112Not Available839Open in IMG/M
3300017988|Ga0181520_10885905All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3596Open in IMG/M
3300017988|Ga0181520_11004487Not Available552Open in IMG/M
3300017996|Ga0187891_1164966Not Available778Open in IMG/M
3300018016|Ga0187880_1175507All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300018025|Ga0187885_10549637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3514Open in IMG/M
3300018033|Ga0187867_10017748All Organisms → cellular organisms → Bacteria4669Open in IMG/M
3300018033|Ga0187867_10368324All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia798Open in IMG/M
3300018035|Ga0187875_10377176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3760Open in IMG/M
3300018057|Ga0187858_10178431All Organisms → cellular organisms → Bacteria1399Open in IMG/M
3300019082|Ga0187852_1333147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3600Open in IMG/M
3300019256|Ga0181508_1378601All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3523Open in IMG/M
3300021476|Ga0187846_10156029All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300021476|Ga0187846_10188874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3865Open in IMG/M
3300022526|Ga0224533_1001632All Organisms → cellular organisms → Bacteria4065Open in IMG/M
3300022861|Ga0224528_1010615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis2847Open in IMG/M
3300025473|Ga0208190_1086766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3621Open in IMG/M
3300026450|Ga0247847_1016932Not Available989Open in IMG/M
3300027505|Ga0209218_1108590All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3581Open in IMG/M
3300027729|Ga0209248_10259638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3505Open in IMG/M
3300027825|Ga0209039_10012975All Organisms → cellular organisms → Bacteria → Acidobacteria4628Open in IMG/M
3300027829|Ga0209773_10319603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3647Open in IMG/M
3300027854|Ga0209517_10126720All Organisms → cellular organisms → Bacteria1671Open in IMG/M
3300027854|Ga0209517_10554700All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3616Open in IMG/M
3300027898|Ga0209067_10011521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA34643Open in IMG/M
3300027908|Ga0209006_10001045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis25434Open in IMG/M
3300027911|Ga0209698_10898698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3664Open in IMG/M
3300029817|Ga0247275_1099780Not Available768Open in IMG/M
3300031241|Ga0265325_10542887All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3503Open in IMG/M
3300031242|Ga0265329_10242483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter600Open in IMG/M
3300031524|Ga0302320_10486792All Organisms → cellular organisms → Bacteria → Proteobacteria1502Open in IMG/M
3300031759|Ga0316219_1002989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis14395Open in IMG/M
3300031813|Ga0316217_10157183All Organisms → cellular organisms → Bacteria → Acidobacteria972Open in IMG/M
3300032160|Ga0311301_11689859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia763Open in IMG/M
3300032676|Ga0316229_1117597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1116Open in IMG/M
3300032805|Ga0335078_10121804All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3730Open in IMG/M
3300032892|Ga0335081_10003224All Organisms → cellular organisms → Bacteria25638Open in IMG/M
3300032898|Ga0335072_10010803All Organisms → cellular organisms → Bacteria → Acidobacteria13118Open in IMG/M
3300033402|Ga0326728_10004583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus40562Open in IMG/M
3300033402|Ga0326728_10043597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00686861Open in IMG/M
3300033402|Ga0326728_10055364All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00685648Open in IMG/M
3300033402|Ga0326728_10105035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00683373Open in IMG/M
3300033402|Ga0326728_10441032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1088Open in IMG/M
3300033405|Ga0326727_10009820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE006823230Open in IMG/M
3300033405|Ga0326727_10184876All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2332Open in IMG/M
3300033405|Ga0326727_10786607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia737Open in IMG/M
3300033755|Ga0371489_0309219All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3759Open in IMG/M
3300033983|Ga0371488_0023912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter4362Open in IMG/M
3300034091|Ga0326724_0146801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171469Open in IMG/M
3300034199|Ga0370514_000186All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae13454Open in IMG/M
3300034199|Ga0370514_036957All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1218Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog25.60%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland14.40%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil9.60%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog6.40%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil5.60%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.80%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.00%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil3.20%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.20%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater2.40%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.40%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.40%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.40%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.40%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.40%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.60%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.60%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm1.60%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.80%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.80%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016701Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300022526Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 10-14EnvironmentalOpen in IMG/M
3300022861Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T25EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026450Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T25EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031759Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003PEnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032676Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12712J15308_1008396823300001471Forest SoilMKSSLNASVAATLIATAVGLGAWFFGIDKNIWPSHPQVADLVLSMVVCILVKEMWPVQRGQKKSKSSAFRS*
JGIcombinedJ26739_10010199923300002245Forest SoilMKSSTNATVAATLIATAVGLGLWFFGVAKVIWPTHPQVADLLITIVASIVVKQIWPVDHGQKKI*
Ga0062385_1026637123300004080Bog Forest SoilMRANMNSTLAATLIATAAGVGVWFFGLAKTIWPAHPQIAAFLVTVVAGIVVKQTWPAEYGRKRI*
Ga0062389_10374299623300004092Bog Forest SoilMRANMNSTLAATLIDTAAGVGVWFFGLAKAIWPAHPQIAAFLVTVVAGIVVKETWPAEYARKRI*
Ga0062386_10007122113300004152Bog Forest SoilMKAPTNSTLAATLIATAAGVGAWLFGFAKAIWPAHPQIAAFAITIVVSIVAKQIWPVDVGRKRS*
Ga0062386_10139210123300004152Bog Forest SoilMKASTNSTLAATLIATAAGIGAWFFGLAKAIWPAHPQIAAFVITLVVSVVVKQVWPANVTQKRI*
Ga0070735_1018935733300005534Surface SoilMKASTSTTLAASLIASAAGIGAWFFGLCDIIWPAHPQIAAFVLTIVVTVVMMKLWPVVGQKRV*
Ga0075017_10004939423300006059WatershedsMKASTKSTLAATLIATAAGIGAWLFGVAKAIWPTHPQIAAVVITIVVSVVVKTVWPVGTG
Ga0116133_123387413300009623PeatlandMMGLRISDLVKASISSTLAATAIATAAGTGAWLFGIARAIWPDHPLIAVFVITIVVSIVVKQIWHVPAGQKRA*
Ga0116121_109444313300009644PeatlandMKAPTNSTLAATLIATAAGVGVWLFGFAKVIWPAHPQIAALAITIVVSVVVKQVWPADVAQKRI*
Ga0116121_112626623300009644PeatlandMKASTNSTLAATLIATAAGLGAWFFGLAKAIWPAHSQIAALVITIVVSVVVKQIWPVGQKSS*
Ga0116106_129423413300009645PeatlandMKASTNSTLAATLIGTAAGVGAWFFGVAKAIWPAHPQIAAFVITIVVSVVVRQIWPADAGRKRV*
Ga0116217_1069575623300009700Peatlands SoilMRASTNSTLAATLIATAAGAGAWFFGVAQAIWPAHPQIAAFAITIVVSVVVKQLWPVNLGQKKI*
Ga0116130_120418323300009762PeatlandMKASTNSTLAATLIATAAGIGAWFFGLAKAIWPAHPQIAAFVITLVVSVVVKQIWP
Ga0074046_1027817513300010339Bog Forest SoilMNASMNSTLAATLIATGVGVGIWITGLAKAMWPAHPQILALLITIVVGIVVTQTWPAVAGRK*
Ga0074045_1009448723300010341Bog Forest SoilMKASTSSTLAATLVATVAGTGAWFFGMAKEIWPAHPQIAAFLLTLVTGIVVKQIWPSVDDGQKRI*
Ga0074045_1058678033300010341Bog Forest SoilMRAFTNSTLAATVIATIAGVVAWFFGLAKEIWPAHPQLVAFLLTFVTGIVVKQVWPYVDDDQEKPR*
Ga0074045_1065252523300010341Bog Forest SoilMKASTNSPLAATLIATAAGLGAWFFGVAKAIWPTHPQIAALVITIVVSVLVLRFGGRASNSRT*
Ga0136449_10086691823300010379Peatlands SoilMRASTNSTLAATLIATAAGVGAWFCGFAKAIWPAHPQIAAFVITIVVSVVVKQIWPVDVGQKRI*
Ga0181539_104992113300014151BogMKASTNSTLAATLIATAAGVGAWLFGLANAIWPAHPQIAALVITIVVSVVVKQIWPAGQKRS*
Ga0181539_110807023300014151BogMKASTNSTLAATLIATAAGVGTWFFGFAKAIWPTHPQIAAFVITIVVSVVVKQIWPVDAGRKRI*
Ga0181539_120403423300014151BogMKTSMNSTLAATLIATAAGVGAWFFGVAKAIWPTHPQIAAFAITVVVGVVVKQIWPVNAGQKRI*
Ga0181533_109429813300014152BogMKASTNSTLAATLIATAAGVGAWFFGIAKAIWPAHPQIAALVITIVVSVVVKQI
Ga0181533_123281423300014152BogMKASTNSTLAATLIATAAGVGAWLFGLANAIWPAHPQIAAFVITVVVGVVIKQIWPVNAGRKRI*
Ga0181527_105420243300014153BogMKASTNSTLAATLIATAAGVGAWFFGIAKAIWPAHPQIAALVITIVVSVVVKQIWPAGQKRS*
Ga0181517_1000092083300014160BogMSSTLAATLIATAAGVGAWFFGFAKAIWPAHPQLAAFVITVVVSVVVAKVWPAAVEQPPR
Ga0181517_1001367033300014160BogMKASTQSTLAATLIATAVGTGSWLFGFAALIWPAHPLIIAFLITIGVSVIVKQTWPVSHPRT*
Ga0181517_1003502353300014160BogMKASMNSTLAATLIATAVGIGAWLFGLAKAIWPNHPQVAALLITIVVGLVVRQLWPAKVGQKRI*
Ga0181517_1006312543300014160BogMSSTLAATLIATVVGTGAWLLGLAGAIWPAHPQLTAFAMTVVIGIVVKQLWPVDSRRA*
Ga0181517_1006368923300014160BogMKASTNSTLAATLIATAAGLGAWFFGLAKAIWPAHPQIAALVITIVVSVVVKQIWPVGQKSS*
Ga0181517_1016604033300014160BogVNEVESPDLVKASTNGTLAAALIATAAGVGAWLFGLANAIWPAHPQIAAIAITIVVSIAVKRIWPVDAAQNGM*
Ga0181529_1000238443300014161BogMKASISRTLAATLIATAAGVGVWFFGVSKAIWPTHPQIAAFVITIVVGVVVNQIWPVEAGQKRM*
Ga0181529_1023404723300014161BogMKSPTNSTLAATLIATAAGVGAWLFGVAEAIWPSHPQIAAFVITIVAGVVVKQFWPVHAGQKRS*
Ga0181529_1065887323300014161BogAGVGAWFFGFAKAIWPSHPQIAAFVITIVVSVAVKQFWPVDAGSKRS*
Ga0181538_1071808413300014162BogMKASTKSTVAASLIATAAGTGAWLFGFARAIWPAHPQIAVFAITIVVYIVVKQLWPVDASEKRV*
Ga0181532_1059686213300014164BogMKASTKSTLAATLIATAAGTGAWLFGFAKTIWLTHPQIAVFAITIVVYIVVKQVWPVGAGQKRI*
Ga0181528_1005299523300014167BogMTASTKSTLAATLIATAAGFGVWLFGFAKAIWPAHPQIAAFAITVVVSIVVKKTWPVDAAQRRV*
Ga0181528_1032353023300014167BogMKASMSSTLAATLIATAAGVGAWFFGFAKAIWPAHPQLAAFVITVVVSVVVAKVWPAAVEQPPR*
Ga0181528_1033669823300014167BogMSSTLAATLIATAIGTGAWLFGYAKAIWPAHPQVAVFAITIVVGIVVKQIWPVNLGQKPV
Ga0181535_1075371023300014199BogMREGGNHVKASMNSTLAATLIATVAGIGAWFFGLAARIWPEHPQVCALALTIVISVLVKQLWPDAGGKTRA*
Ga0181526_1050399523300014200BogMRISISRTLAATLIATAAGLAVWLFGFAERIWPTHPQICAILITIAVSIVVMRFWPTRQPRT*
Ga0181526_1100655423300014200BogNSTLAATLIATAAGLGAWFFGLAKAIWPAHPQIAALVITIVVSVVVKQIWPVGQKSS*
Ga0182014_1003867043300014491BogMKASTNSTLAATLIATAAGVGAWLFGLAKAIWPAHPQIAALVITIVVSVVVKQIWPVGQKSS*
Ga0182014_1009429413300014491BogGIGAWFFGLAKAIWPAHPQIAAFVITLVVSVVVKQIWPANVTQKRI*
Ga0182014_1031881613300014491BogMKRMIPAEVQDRMKAPMNSTLAATLIATAAGLGVWLLGIAKEIWPAHPQICALIITIVVSVVVKQAWPRN*
Ga0182014_1064376823300014491BogMKASTNSTLAATLIATAAGVGAWFFGFAKVIWPDHPQVAALVISIVVSIVVKQIWPINVGRKRI*
Ga0182013_1003955233300014492BogMKASTNSTLAATLIATAAGVGEWLFGLAKAIWPAHPQIAALVITIVVSVVVKQIWPVGQKSS*
Ga0182013_1047895013300014492BogMTASTKSTLAATLIATAAGLGVWLFGFAKAIWPAHPQIAAFAITIVVSIVVKKTWPVDAAQRRV*
Ga0182024_1016123923300014501PermafrostMKSSTNATVAATLIATAVGLGLWFFGIAKDIWPSHPQVADLLITIVASIVVKQIWPVDHGQKKI*
Ga0182024_1067098223300014501PermafrostMKASTNSTLAATLIATAAGIGAWLFGLAKAIWPTHPQIAAFAITIVVSVVVKQTWPVNVGQKRI*
Ga0182030_10009993173300014838BogMTASTKSTLAATLIATAAGLGVWLFGFAKAIWPAYPQIAAFAITIVVSIVVKKTWPVDAAQRRV*
Ga0182030_1078640613300014838BogMSSTLAATLIATAVGVGAWFFGYAKVIWPAHPQIAACVLTVVVSVVVKQIWPVDAGQKRI
Ga0182027_1009355043300014839FenMKASTNSTLAATLIATGVGVGAWLFGLAKAIWPAHPQIAALAITVVVSVVVKQIWPAGQKKS*
Ga0182027_1031744733300014839FenMKASTNSTLAATLFATAAGVGVWLFGLARAIWPAHPQLAAFAITIVVGIVVKQIWPSISAGRESD*
Ga0182027_1043336023300014839FenMKASTKSTLAATLIATAVGVGAWFGLAKASWPAHPQMAAFAITIAVSVVVNQTWPVAVGQKRI*
Ga0181509_112139123300016701PeatlandDCMKASMSSTLAATLIATAAGVGAWFFGFAKAIWPAHPQLAAFVITVVVSVVVAKVWPAAVEQPPR
Ga0187856_101432053300017925PeatlandMKASTNSTLAATLIATAAGVGAWFFGLAKAIWPTHPQIAALVITIVVSVVVKQIWPVDVGRK
Ga0187856_130510713300017925PeatlandMKASTNSTLAATLIATAAGVGTWFFGFAKAIWPTHPQIAAFVITIVVSVVVKQIWPVDAGRKRI
Ga0187825_1018233823300017930Freshwater SedimentLAATLIATVVGTGAWFFGLAKAIWPAHPQVAAFLSTIVASIVVKQTWPAGDGEKRT
Ga0187848_1015005023300017935PeatlandMKASTNSTLAATLIATAAGVGAWFFGIAKAIWPAHPQIAALVITIVVSVVVKQIWPAGQKRS
Ga0187848_1020177323300017935PeatlandMKASTKSTLAATVIASAAGVGAWLFGLAEAIWPAHPQIAAIVITIVASIVVKQLWRVDAGQKKA
Ga0187847_1014900023300017948PeatlandMKASMSRTLAATLIATAAGIGAWFFGVSKAIWPTHPQIAAFAITIVVGVVVNQIWPVEAGQKRI
Ga0187847_1020057423300017948PeatlandMMGIEEFQIFMTACTNSTLAATAIATAAGVGAWLFGLAKAVWPAHPQVAALAITIVVSIVVKQIWPVDAGQKRI
Ga0187817_1007399323300017955Freshwater SedimentMNSTLAATLIGTAAGTGTWLFGFDKAIWPAHPQIAAIVITIVVCVVVKKTWPAVPGRR
Ga0181520_10002331233300017988BogMKASMSSTLAATLIATAAGVGAWFFGFAKAIWPAHPQLAAFVITVVVSVVVAKVWPAAVEQPPR
Ga0181520_1000948033300017988BogMKASTQSTLAATLIATAVGTGSWLFGFAALIWPAHPLIIAFLITIGVSVIVKQTWPVSHPRT
Ga0181520_1001852063300017988BogMKASTNSTLAATLIGTAAGVGAWFFGVAKAIWPAHPQIAAFVITIVVSVVVRQIWPADAGRKRV
Ga0181520_1005357933300017988BogMKAPKNSTLAATLIATAAGVGAWFFGFAKAIWPSHPQIAAFVITIVVSVAVKQFWPVDAGSKRS
Ga0181520_1005844353300017988BogMKASMNSTLAATLIATAVGIGAWLFGLAKAIWPNHPQVAALLITIVVGLVVRQLWPAKVGQKRI
Ga0181520_1034792423300017988BogMNRTLAATLIATAVGVGAWFFGIAKVIWPAHPQIAAFVITIVVSVVVKAMWPFDAGQRRI
Ga0181520_1052011213300017988BogMNRNLAATLIATAAGLVAWLSGLAQLIWPAHPQICALLITIVVSVVVMQVWPAIAGQ
Ga0181520_1088590523300017988BogVKASMNSTLAATLIATVAGIGAWFFGLAARIWPEHPQVCALALTIVISVLVKQLWPEAGGKTRA
Ga0181520_1100448713300017988BogMKTYMNSTLAATLIATAAGVGAWFSGFSKIIWPAHPQMAAIVITVAVSIVVKQIWPVNVGQK
Ga0187891_116496613300017996PeatlandMTASMNRNLAATLIATAAGLVAWLSGLAQLIWPAHPQICALLITIVVSV
Ga0187804_1024673423300018006Freshwater SedimentMKASLKSTLIATLVGTAAGTGAWFFGVAHAIWPAHPQLAAFIIALIATVVAQRVWPTQ
Ga0187880_114383723300018016PeatlandAAGVGAWFFGLAKAIWPTHPQIAALVITIVVSVVVKQIWPVDVGRK
Ga0187880_117550723300018016PeatlandMKASTNSTLAATLIATAAGVGTWFFGFAKAIWPTHPQIAAFVITIVVSVVVKQIWPV
Ga0187885_1054963723300018025PeatlandMKASTKSTLAATLIATAAGVGVWLFGFAKVIWPAHPQIAALVITIVVSVVVKQIWPVDVGRK
Ga0187867_1001774823300018033PeatlandMKASTNSTLAATLIATAAGLGAWFFGLAKAIWPAHPQIAALVITIVVSVVVKQIWPVGQKSS
Ga0187867_1036832423300018033PeatlandAATAIATAAGVGAWLFGLAKAVWPAHPQVAALAITIVVSVVVKQVWPADVAQKRI
Ga0187875_1037717613300018035PeatlandMKASTNSTLAATLIATAAGFGAWFFGLAGVIWPAHPQMAAFAITIVLSVVVKQIWPVNIGPKRV
Ga0187851_1041297213300018046PeatlandTLIATAAGVGAWFFGFAKVIWPDHPQVAAFVISIVVSVVVKQIWPVDVGRKRI
Ga0187858_1017843143300018057PeatlandMKASTNSTLAATLIATAAGVGAWFFGLAKAIWPTHPQIAALVITIVVSVVVKQIWPV
Ga0187852_133314723300019082PeatlandPNLMKASTKSTLAATVIASAAGVGAWLFGLAEAIWPAHPQIAAIVITIVASIVVKQLWRVDAGQKKA
Ga0181508_137860123300019256PeatlandLKGTLAATLIGTVAGTGAWLLGFGESIWPAHPQIAVFAITLVVTIATRLVWPVDAGGNAPTGR
Ga0187846_1015602923300021476BiofilmMNATLAATLIATAAGLGAWFLGGAKLIWPAHPQISAFLISVVASIVIKQLWPLGSGQE
Ga0187846_1018887423300021476BiofilmMKASTNSALAATLIATAAGVGAWFFGVAKVIWPAHPQIAAFVITIVAGIVVKQTWPVDDGQKRI
Ga0224533_100163243300022526SoilMKASTSSTLAATLIATVVGAGAWLFGLASAIWPAHPLIAAFALTIVVSVIVKQIWPVATGQKRT
Ga0224528_101061533300022861SoilMNSTLAATLIATAAGLGVWLTGFSRVIWPAHPQIAAFLFTVAVSILVKMLWPVSAGQRHI
Ga0208190_108676623300025473PeatlandHLMKASTNSTLAATLIATAAGLGAWFFGLAKAIWPAHPQIAALVITIVVSVVVKQIWPVGQKSS
Ga0247847_101693213300026450SoilMKASMNSTLAATLIATAVGLGAWLSGFAGVIWPAHPQIAAFVLTIVVSVLVKQLWPVDAGQKRI
Ga0209218_110859013300027505Forest SoilMKSSTNATVAATLIATAVGLGLWFFGVAKVIWPTHPQVADLLITIVASIVVKQIWPVDHGQKKI
Ga0209248_1025963813300027729Bog Forest SoilAIQSVQRMNEPRTVLMRANMNSTLAATLIATAAGVGVWFFGLAKTIWPAHPQIAAFLVTVVAGIVVKQTWPAEYGRKRI
Ga0209039_1001297523300027825Bog Forest SoilMKAPTNSTLAATLIATAAGVGAWLFGFAKAIWPAHPQIAAFAITIVVSIVAKQIWPVDVGRKRS
Ga0209773_1031960323300027829Bog Forest SoilMRANMNSTLAATLIATAAGVGVWFFGLAKTIWPAHPQIAAFLVTVVAGIVVKQTWPAEYGRKRI
Ga0209517_1012672023300027854Peatlands SoilMRASTNSTLAATLIATAAGAGAWFFGVAQAIWPAHPQIAAFAITIVVSVVVKQLWPVNLGQKKI
Ga0209517_1055470013300027854Peatlands SoilMKTSMGSTLAATLIATAAGIGVWFFGVSKAIWPNHPQIAAFVITIVVGVVVKQIWPVDIGQKRI
Ga0209067_1001152123300027898WatershedsMKASTKSTLAATLIATAAGIGAWLFGVAKAIWPTHPQIAAFVITIVVSVVVKTVWPVGTG
Ga0209006_1000104553300027908Forest SoilMKSSLNASVAATLIATAVGLGAWFFGIDKNIWPSHPQVADLVLSMVVCILVKEMWPVQRGQKKSKSSAFRS
Ga0209698_1089869823300027911WatershedsMDRSQVKSSTSSTVAATLIATAAGVGVWRFGMAKAVWPAHPQIAALLITIGVSILVKQVWAQL
Ga0247275_109978013300029817SoilMKASTKSSVAATLIAFAAGFGAWSFGVAKAIWPAYPQIAALVITIVVSVVVLRIWPRQK
Ga0265325_1054288713300031241RhizosphereMKASTNSTLAATLIATAAGIGAWFFGLAKAIWPAHPQIAAFVITLVVSVVVKQIWPANVTQKRV
Ga0265329_1024248323300031242RhizosphereMKSSTKSTLAATLIATAAGTGAWLFGFAKAIWPAHPQIAVFAITIVVYIVAKQVWPVDAGQKRT
Ga0302320_1048679243300031524BogMIPAEVQDRMKAPMNSTLAATLIATAAGLGVWLLGIAKEIWPAHPQICALIITIVVSVVVKQAWPRN
Ga0316219_100298973300031759FreshwaterMNSTLAATLIATAVGIGTWFFGIAKAISPAHPQLVAFAFTIVASVLVKQLWPADAGQKRI
Ga0316217_1015718313300031813FreshwaterMNFSMNGTLAASLIATFVGIGAWFFGVAKAIWPAHPQIAAFIITIVVSVLVKQMWPVDARQKRI
Ga0311301_1168985923300032160Peatlands SoilMRASTNSTLAATLIATAAGVGAWFCGFAKAIWPAHPQIAAFVITIVVSVVVKQIWPVDVGQKRI
Ga0316229_111759723300032676FreshwaterMKTSMNATLAATLIATAAGLIAWFFGFARDIWPAHPQLAAFLITVVVGIVVNQTWPSNSGQRSI
Ga0335078_1012180433300032805SoilMASMKPSMSSTLAATLIGTAAGLGAWLFGIAKAIWPAHSQVCTFLITLAVCIVVKQTWPWHTK
Ga0335081_10003224273300032892SoilMKASIGRTLAATLIATATGIGVWFFGVSKAIWPTHPQLAAFVITIVVGVVVNQFWPVEVGSKRV
Ga0335072_10010803103300032898SoilMNRNLAATLIATVAGTGSWLSGLARATWPAHPLVAAFLITIVVSIVVLQAWPRVPKRP
Ga0326728_10004583193300033402Peat SoilMKASTKSTLAATLIATAAGLGAWLLGFGKAIWPAHPQLAAFAITIVVSVVVKQIWPADVGGKRI
Ga0326728_1004359743300033402Peat SoilMNPSMNSTLAATLIATAAGLGVWLSGLTKAVWPAHPQIAAILITIAVSILVKMLWPANAGQKHI
Ga0326728_1005536463300033402Peat SoilMTASMNRNLAATLIATAAGLVAWLSGLAQLIWPAHPQICALLITIAVSVVVMQVWPAVAGQKRI
Ga0326728_1010503513300033402Peat SoilNLAATLIATAAGLVAWLSGLAQLIWPAHPQICALLITIVVSVVVMQVWPAIAGQKRI
Ga0326728_1036223023300033402Peat SoilMREGGNHVKASMNSTLAATLIATVAGIGAWFFGLAARIWPEHPQVCALALTIVISVLVKQLWPDAGGKTRA
Ga0326728_1044103223300033402Peat SoilMKASTSSTLAATLIATVVGTGAWLFGLAKAIWPAHPLIAAFAITFVVSVVVKQIWPVDAGQKRT
Ga0326727_1000982093300033405Peat SoilMTASMNRNLAATLIATAAGLVAWLSGLAQLIWPAHPQICALLITIVVSVVVMQVWPAIAGQKRI
Ga0326727_1018487613300033405Peat SoilMKASTKSTLAATLIATAAGLGAWLLGFGKAIWPAHPQLAAFAITIVVSVVVKQI
Ga0326727_1078660713300033405Peat SoilMKASMNSTLAATLIATAAGTCAWLFGFARAIWPAHPQIAAFVLTIVVGIVVSKIWRVDASQKKV
Ga0371489_0309219_172_3663300033755Peat SoilMKAPKNSTLAATLIATAAGVGAWFFGFAKAIWPSHPQIAAFVITIVVSVAVKQLWPVEAGPKRS
Ga0371488_0023912_1558_17553300033983Peat SoilMKASTNSTLAATLIATAAGVGAWLFGLAGAIWPAHPQLAAFAITIVVSIVVKQIWPSISAGRESD
Ga0326724_0146801_972_11543300034091Peat SoilMNRNLAATLIATAAGLVAWLSGLAQLIWPAHPQICALLITIAVSVVVMQVWPAVAGQKRI
Ga0370514_000186_9412_96063300034199Untreated Peat SoilMKGSVNSTLAATLIATFVGVGAWLSGLAKAIWPGHPQIAAFATTIVVSVLVKQLWHANVGPKRV
Ga0370514_036957_885_10763300034199Untreated Peat SoilMKASVNSTLAATLIATFVGLGAWLSGFAKAIWPTHPQMAAFVMTIVVSVLVKQLWPVDVPRRI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.