Basic Information | |
---|---|
Family ID | F068198 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 125 |
Average Sequence Length | 42 residues |
Representative Sequence | TLEADRRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 125 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.60 % |
% of genes near scaffold ends (potentially truncated) | 93.60 % |
% of genes from short scaffolds (< 2000 bps) | 90.40 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.200 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.200 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.600 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.86% β-sheet: 0.00% Coil/Unstructured: 67.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 125 Family Scaffolds |
---|---|---|
PF13305 | TetR_C_33 | 31.20 |
PF01243 | Putative_PNPOx | 16.80 |
PF00196 | GerE | 13.60 |
PF03596 | Cad | 4.00 |
PF01545 | Cation_efflux | 4.00 |
PF01381 | HTH_3 | 2.40 |
PF02518 | HATPase_c | 2.40 |
PF12697 | Abhydrolase_6 | 2.40 |
PF00440 | TetR_N | 1.60 |
PF01546 | Peptidase_M20 | 1.60 |
PF00248 | Aldo_ket_red | 1.60 |
PF13561 | adh_short_C2 | 0.80 |
PF00583 | Acetyltransf_1 | 0.80 |
PF13489 | Methyltransf_23 | 0.80 |
PF00486 | Trans_reg_C | 0.80 |
PF05988 | DUF899 | 0.80 |
PF07687 | M20_dimer | 0.80 |
PF12840 | HTH_20 | 0.80 |
PF00753 | Lactamase_B | 0.80 |
PF08241 | Methyltransf_11 | 0.80 |
PF13676 | TIR_2 | 0.80 |
PF00202 | Aminotran_3 | 0.80 |
PF03881 | Fructosamin_kin | 0.80 |
PF13411 | MerR_1 | 0.80 |
PF10041 | DUF2277 | 0.80 |
COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
---|---|---|---|
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 4.00 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 4.00 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 4.00 |
COG4300 | Cadmium resistance protein CadD, predicted permease | Inorganic ion transport and metabolism [P] | 4.00 |
COG3001 | Fructosamine-3-kinase | Carbohydrate transport and metabolism [G] | 0.80 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.80 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.00 % |
Unclassified | root | N/A | 12.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003505|JGIcombinedJ51221_10099199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1157 | Open in IMG/M |
3300004091|Ga0062387_101558307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
3300005366|Ga0070659_101322168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
3300005548|Ga0070665_100505738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1220 | Open in IMG/M |
3300005554|Ga0066661_10394131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 848 | Open in IMG/M |
3300005563|Ga0068855_100782203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1015 | Open in IMG/M |
3300005610|Ga0070763_10044688 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
3300005712|Ga0070764_10465005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 756 | Open in IMG/M |
3300005921|Ga0070766_10796634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 644 | Open in IMG/M |
3300006052|Ga0075029_101127166 | Not Available | 546 | Open in IMG/M |
3300006163|Ga0070715_10017406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2721 | Open in IMG/M |
3300006172|Ga0075018_10742941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
3300006173|Ga0070716_100263297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1181 | Open in IMG/M |
3300006755|Ga0079222_11784512 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300006854|Ga0075425_100393857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1596 | Open in IMG/M |
3300006903|Ga0075426_10380816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1039 | Open in IMG/M |
3300006904|Ga0075424_101436721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 732 | Open in IMG/M |
3300007788|Ga0099795_10169510 | Not Available | 906 | Open in IMG/M |
3300009038|Ga0099829_10369924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1182 | Open in IMG/M |
3300009683|Ga0116224_10056764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1909 | Open in IMG/M |
3300009683|Ga0116224_10240029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 865 | Open in IMG/M |
3300009698|Ga0116216_10464788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
3300010359|Ga0126376_13217513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300010371|Ga0134125_10368903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1592 | Open in IMG/M |
3300010373|Ga0134128_11802647 | Not Available | 673 | Open in IMG/M |
3300010858|Ga0126345_1144948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1422 | Open in IMG/M |
3300010876|Ga0126361_10991802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 747 | Open in IMG/M |
3300012208|Ga0137376_11219211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
3300012507|Ga0157342_1084952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300012957|Ga0164303_10572867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
3300013306|Ga0163162_10266209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1845 | Open in IMG/M |
3300014326|Ga0157380_10546548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1135 | Open in IMG/M |
3300014495|Ga0182015_10811016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 588 | Open in IMG/M |
3300014968|Ga0157379_11906148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
3300017821|Ga0187812_1057036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
3300017821|Ga0187812_1132546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
3300017823|Ga0187818_10001735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8944 | Open in IMG/M |
3300017823|Ga0187818_10249113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp. | 776 | Open in IMG/M |
3300017823|Ga0187818_10428561 | Not Available | 589 | Open in IMG/M |
3300017926|Ga0187807_1055475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1229 | Open in IMG/M |
3300017928|Ga0187806_1022242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1843 | Open in IMG/M |
3300017932|Ga0187814_10252157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
3300017955|Ga0187817_10705357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
3300017955|Ga0187817_10840996 | Not Available | 586 | Open in IMG/M |
3300017994|Ga0187822_10267825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
3300017995|Ga0187816_10070967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1476 | Open in IMG/M |
3300018001|Ga0187815_10541799 | Not Available | 500 | Open in IMG/M |
3300018034|Ga0187863_10580019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
3300018037|Ga0187883_10183205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1075 | Open in IMG/M |
3300018046|Ga0187851_10286140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 958 | Open in IMG/M |
3300018062|Ga0187784_10283666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1346 | Open in IMG/M |
3300018088|Ga0187771_10754347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
3300020062|Ga0193724_1039920 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300020150|Ga0187768_1084047 | Not Available | 720 | Open in IMG/M |
3300021088|Ga0210404_10138318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
3300021180|Ga0210396_10029199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 5102 | Open in IMG/M |
3300021181|Ga0210388_10449742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
3300021181|Ga0210388_10523155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1040 | Open in IMG/M |
3300021403|Ga0210397_10290842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
3300021403|Ga0210397_10621694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
3300021406|Ga0210386_10619832 | Not Available | 934 | Open in IMG/M |
3300021406|Ga0210386_10960658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura physcomitrii | 730 | Open in IMG/M |
3300021407|Ga0210383_10926629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 741 | Open in IMG/M |
3300021474|Ga0210390_10076372 | Not Available | 2772 | Open in IMG/M |
3300021478|Ga0210402_11508564 | Not Available | 599 | Open in IMG/M |
3300021479|Ga0210410_10241638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1619 | Open in IMG/M |
3300021559|Ga0210409_10564853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1004 | Open in IMG/M |
3300022873|Ga0224550_1020023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 945 | Open in IMG/M |
3300024224|Ga0247673_1040446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
3300024279|Ga0247692_1071815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300024290|Ga0247667_1055168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 737 | Open in IMG/M |
3300025910|Ga0207684_10069277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2998 | Open in IMG/M |
3300025916|Ga0207663_10721630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
3300025937|Ga0207669_10209079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1423 | Open in IMG/M |
3300026041|Ga0207639_12143260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300026116|Ga0207674_10591023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1072 | Open in IMG/M |
3300026374|Ga0257146_1017628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1163 | Open in IMG/M |
3300026496|Ga0257157_1014836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora pisi | 1250 | Open in IMG/M |
3300027058|Ga0209111_1027138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
3300027853|Ga0209274_10306805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 816 | Open in IMG/M |
3300027855|Ga0209693_10479566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
3300027889|Ga0209380_10550760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 670 | Open in IMG/M |
3300028773|Ga0302234_10391341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Epidermidibacterium → Epidermidibacterium keratini | 595 | Open in IMG/M |
3300028793|Ga0307299_10328039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
3300028877|Ga0302235_10091483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1393 | Open in IMG/M |
3300028877|Ga0302235_10202933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
3300028877|Ga0302235_10273131 | Not Available | 734 | Open in IMG/M |
3300029636|Ga0222749_10837772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
3300029951|Ga0311371_10074010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 5582 | Open in IMG/M |
3300029999|Ga0311339_11396040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
3300030056|Ga0302181_10252201 | Not Available | 798 | Open in IMG/M |
3300030739|Ga0302311_10090491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2499 | Open in IMG/M |
3300031233|Ga0302307_10468632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Epidermidibacterium → Epidermidibacterium keratini | 639 | Open in IMG/M |
3300031236|Ga0302324_100356181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura physcomitrii | 2208 | Open in IMG/M |
3300031525|Ga0302326_11153361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura physcomitrii | 1071 | Open in IMG/M |
3300031573|Ga0310915_11274379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 507 | Open in IMG/M |
3300031680|Ga0318574_10650036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
3300031682|Ga0318560_10104805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1467 | Open in IMG/M |
3300031682|Ga0318560_10715006 | Not Available | 541 | Open in IMG/M |
3300031718|Ga0307474_10639035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 840 | Open in IMG/M |
3300031723|Ga0318493_10669828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
3300031744|Ga0306918_10355933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → Jatrophihabitans telluris | 1136 | Open in IMG/M |
3300031781|Ga0318547_10110453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1582 | Open in IMG/M |
3300031781|Ga0318547_10896590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
3300031782|Ga0318552_10629873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 547 | Open in IMG/M |
3300031823|Ga0307478_10120997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2052 | Open in IMG/M |
3300031823|Ga0307478_10684355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 859 | Open in IMG/M |
3300031845|Ga0318511_10328728 | Not Available | 694 | Open in IMG/M |
3300031879|Ga0306919_10765621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
3300031894|Ga0318522_10344267 | Not Available | 564 | Open in IMG/M |
3300032001|Ga0306922_10600468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1166 | Open in IMG/M |
3300032008|Ga0318562_10038886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2571 | Open in IMG/M |
3300032054|Ga0318570_10139124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1082 | Open in IMG/M |
3300032055|Ga0318575_10057951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1794 | Open in IMG/M |
3300032063|Ga0318504_10552910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 552 | Open in IMG/M |
3300032205|Ga0307472_100819065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
3300032782|Ga0335082_10759554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 831 | Open in IMG/M |
3300032783|Ga0335079_10551556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1222 | Open in IMG/M |
3300032783|Ga0335079_11124286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
3300032893|Ga0335069_12051830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
3300032895|Ga0335074_10104254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3725 | Open in IMG/M |
3300032896|Ga0335075_10743625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 932 | Open in IMG/M |
3300032955|Ga0335076_11653315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
3300033290|Ga0318519_10160153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → Jatrophihabitans telluris | 1263 | Open in IMG/M |
3300033807|Ga0314866_106537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.20% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 10.40% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.80% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.60% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.80% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.20% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.20% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.40% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.40% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.40% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.40% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.40% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.60% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.60% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.60% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.60% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.80% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.80% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.80% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.80% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.80% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.80% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ51221_100991993 | 3300003505 | Forest Soil | DPERRADFSRRVRAFLDRQPWDRTDVPLICRCPRSRRLAG* |
Ga0062387_1015583072 | 3300004091 | Bog Forest Soil | SGVITLDPERRADFSRRVRGFLDRQPWDRTDLPLICRCLRSRRLAG* |
Ga0070659_1013221682 | 3300005366 | Corn Rhizosphere | LEADRRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG* |
Ga0070665_1005057383 | 3300005548 | Switchgrass Rhizosphere | LEADQRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG* |
Ga0066661_103941312 | 3300005554 | Soil | GIITLDEGPRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLTD* |
Ga0068855_1007822033 | 3300005563 | Corn Rhizosphere | RAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG* |
Ga0070763_100446881 | 3300005610 | Soil | DPERRADFSRRVRAFLDRQPWDRTDLPLICRCLRSRRLPG* |
Ga0070764_104650052 | 3300005712 | Soil | DPERRADFSRRVRTFLDRQPWDRTDLPLICRCLRSTRLPG* |
Ga0070766_107966342 | 3300005921 | Soil | QFSRRVQAFLDRQPWDQVDLPMICRCLKSTRLPG* |
Ga0075029_1011271661 | 3300006052 | Watersheds | ADFTRRVRAFLDRQPWDRTDLPLICRCLRSTRRPG* |
Ga0070715_100174065 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LEPDQRAAFSRRVRSFLDRQPWDQTDVPLICRCVRSTRLTG* |
Ga0075018_107429411 | 3300006172 | Watersheds | LGTYSGIITLEEGPRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG* |
Ga0070716_1002632973 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TLGPEQRAAFSRRVAAFLDRQPWDRVDVPMICRCLRSTRLAG* |
Ga0079222_117845122 | 3300006755 | Agricultural Soil | VVADRETLDEGPRAEFSRRVSAFLDRQPWDQIDLPLICRCLRSTRLTG* |
Ga0075425_1003938574 | 3300006854 | Populus Rhizosphere | LEADQRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG* |
Ga0075426_103808163 | 3300006903 | Populus Rhizosphere | RRAEFSRRVRSFLDRQPWDEIDVPLICRCVRSTRLTG* |
Ga0075424_1014367212 | 3300006904 | Populus Rhizosphere | RAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG* |
Ga0099795_101695101 | 3300007788 | Vadose Zone Soil | ARADFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG* |
Ga0099829_103699242 | 3300009038 | Vadose Zone Soil | VITLEPQRRTEFSQKVRAFLDRQPWDEADVPMICRCLRSTRLRGRAL* |
Ga0116224_100567644 | 3300009683 | Peatlands Soil | EQRAAFSRRVRAFLDRQPWDQVDLPMICRCLRSTRLPG* |
Ga0116224_102400291 | 3300009683 | Peatlands Soil | RADFSRRVRAFLDRQPWDQVDLPMICRCLRSTRLPG* |
Ga0116216_104647881 | 3300009698 | Peatlands Soil | QRADFSRRVRAFLDRQPWDQVDLPMICRCLRSTRLPG* |
Ga0126376_132175132 | 3300010359 | Tropical Forest Soil | IITLEPGPRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPDGAIMGG* |
Ga0134125_103689031 | 3300010371 | Terrestrial Soil | SGIITLEADQRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPS* |
Ga0134128_118026471 | 3300010373 | Terrestrial Soil | SGIITLEADRRAEFSRRVRAFLDRQPWNQVDLPLICRCLRSTRLPG* |
Ga0126345_11449483 | 3300010858 | Boreal Forest Soil | TLEAGPRAEFSRRVWAFLDRQPWDQVDLPLICRCLRSTRLPG* |
Ga0126361_109918022 | 3300010876 | Boreal Forest Soil | PERRADFSRRVRAFLDRQPWDRTDLPLICRCLRSRRLPG* |
Ga0137376_112192112 | 3300012208 | Vadose Zone Soil | TLEADRRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPDGAIMGG* |
Ga0157342_10849521 | 3300012507 | Arabidopsis Rhizosphere | ADRRAEFSRRVRAFLDRQPWDEVDLPLICRCLRSTRLPG* |
Ga0164303_105728673 | 3300012957 | Soil | EEGPRAEFSRRVRAFLDRQPWDQVDLPLICRSLRSTRQTD* |
Ga0163162_102662094 | 3300013306 | Switchgrass Rhizosphere | ADRRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG* |
Ga0157380_105465481 | 3300014326 | Switchgrass Rhizosphere | GIITLEADRRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG* |
Ga0182015_108110163 | 3300014495 | Palsa | LDPDRRAEFSQRARDFLDRQPWDQIDLPMICRCLRSTRLPG* |
Ga0157379_119061482 | 3300014968 | Switchgrass Rhizosphere | AEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG* |
Ga0187812_10570362 | 3300017821 | Freshwater Sediment | VITLDPDQRAELTRQVRAFLDRQPWDQIDLPMTCRCVRSTRLPG |
Ga0187812_11325463 | 3300017821 | Freshwater Sediment | LGTYSGVITLEPGRRADFSRRVRAVLDRQPWESVDLPLICRCLRSRRLAG |
Ga0187818_100017353 | 3300017823 | Freshwater Sediment | VITLDPDQRTELTRQVRAFLDRQPWDQIDLPMTCRCVRSTRLPG |
Ga0187818_102491132 | 3300017823 | Freshwater Sediment | LAPERRADFSRRVRAFLDGQPWDRTDLPMVCRCLRSTRRPG |
Ga0187818_104285611 | 3300017823 | Freshwater Sediment | YSGVITLDPGRRADFSRMVRAFLDRQPWDRVDLPLICRCLRSRRLPG |
Ga0187807_10554751 | 3300017926 | Freshwater Sediment | ERRADFSRRVRAFLDGQPWDRTDLPMVCRCLRSTRRPG |
Ga0187806_10222424 | 3300017928 | Freshwater Sediment | DPGRRADFSRVVRAFLDQQPWDRVDLPLICRCLRSRRLGG |
Ga0187814_102521571 | 3300017932 | Freshwater Sediment | AERRADFTRRVRAFLDRQPWDRTDLPLICRCLRSTRRPG |
Ga0187817_107053572 | 3300017955 | Freshwater Sediment | GVITLDPERRADFSRRVRVFLDRQPWDQVDLPMICRCLRSTRLPG |
Ga0187817_108409961 | 3300017955 | Freshwater Sediment | LDAERRADFTRRVRAFLDRQPWDRTDLPLICRCLRSTRRPG |
Ga0187822_102678251 | 3300017994 | Freshwater Sediment | TLDPERRADFAQRVRAFLDRQPWDSVDLPLICRCLRSRRLPG |
Ga0187816_100709674 | 3300017995 | Freshwater Sediment | ITLDPERRADFAQRVRAFLDRQPWDSVDLPLICRCLRSRRLGG |
Ga0187815_105417991 | 3300018001 | Freshwater Sediment | ADFSRRVREYLDRQPWDQADLPMICRCLRSIRLIETSKKT |
Ga0187863_105800192 | 3300018034 | Peatland | ITMDQDQRAEFSRRVRAFLDRQPWDQVDLPMTCRCLKSTRLPG |
Ga0187883_101832051 | 3300018037 | Peatland | TLEPDRRAEFSQRVRDFLDRQPWDEADVPLICRCLRSTRLNG |
Ga0187851_102861401 | 3300018046 | Peatland | YSGVITMDQDQRAEFSRRARAFLDRPPWDQVDLPMICRCLKSTRLPG |
Ga0187784_102836663 | 3300018062 | Tropical Peatland | TLDPGRRADFSRMVRAFLDQQPWDRVDLPLICRCLRSTRLPG |
Ga0187771_107543472 | 3300018088 | Tropical Peatland | GTYSGVITLDPGRRADFSRMVRAFLDRQPWDRVDLPLICRCLRSTRLPG |
Ga0193724_10399203 | 3300020062 | Soil | SGIITLEADQRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG |
Ga0187768_10840471 | 3300020150 | Tropical Peatland | AAFSGRARAFLDRQPWDRVDLPMICRCLRSTRLPG |
Ga0210404_101383183 | 3300021088 | Soil | PRAEFSRRVRAFLDRQSWDQVDLPLICRCLRSARLPG |
Ga0210396_100291997 | 3300021180 | Soil | YSGVITLDPERRADFSRRVRTFLDRQPWDRTDLPLICRCLRSRRLAG |
Ga0210388_104497423 | 3300021181 | Soil | TLEQDQRAQFSRRVQAFLDRQPWDQVDLPMICRCLKSTRLPE |
Ga0210388_105231553 | 3300021181 | Soil | RADFSQRARDFLDRQPWEQTDLPMICRCLRSTRLPGSTS |
Ga0210397_102908421 | 3300021403 | Soil | ERRADFSRRVRAFLDRQPWDQVDLPMICRCLRSTRLPG |
Ga0210397_106216943 | 3300021403 | Soil | LDPERRADFSRRVRTFLDRQPWDQVDLPMICRCLRSTRLPG |
Ga0210386_106198321 | 3300021406 | Soil | RRADFSRRVRALLDGQPWEQVDLPLICRCLRSTRLPS |
Ga0210386_109606581 | 3300021406 | Soil | RRAEFSQRARDFLDRQPWDQIDLPMICRCLRSTRLPG |
Ga0210383_109266291 | 3300021407 | Soil | GTYSGVITLDAERRAEFSRRVRAFLDRQPWDRTDLPLICRCLRSRRLAG |
Ga0210390_100763721 | 3300021474 | Soil | RADPSQRARDFLDHLPWEQTDLPMICRCLRSTRLPGPTS |
Ga0210402_115085641 | 3300021478 | Soil | ADFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG |
Ga0210410_102416383 | 3300021479 | Soil | DARADFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG |
Ga0210409_105648532 | 3300021559 | Soil | RADFSRRVRAFLDRQPWDRTDLPLICRCLRSRRLPG |
Ga0224550_10200231 | 3300022873 | Soil | VITLDAEQRADFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLAG |
Ga0247673_10404462 | 3300024224 | Soil | TLEADRRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG |
Ga0247692_10718152 | 3300024279 | Soil | LEADQRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG |
Ga0247667_10551681 | 3300024290 | Soil | ADRRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG |
Ga0207684_100692775 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GIITLEADQRAGFSRRVRAFLDRQPWDRVDLPLICRCLRSTRIPD |
Ga0207663_107216303 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EADRRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG |
Ga0207669_102090791 | 3300025937 | Miscanthus Rhizosphere | YSGIITLEADQRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG |
Ga0207639_121432602 | 3300026041 | Corn Rhizosphere | ITLEADQRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG |
Ga0207674_105910231 | 3300026116 | Corn Rhizosphere | GVITLEPDQRAAFSRRVRSFLDRQPWDQTDVPLTCRCVRSTRLTG |
Ga0257146_10176281 | 3300026374 | Soil | AEFSRRVRAFLDRQPWDRIDLPLICRCLRSTRLPR |
Ga0257157_10148361 | 3300026496 | Soil | RRADFSRRVRAFLDRQPWDRTDLPLICRCLRSTRLAR |
Ga0209111_10271382 | 3300027058 | Forest Soil | CQSRAAPDLADRRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLPG |
Ga0209274_103068053 | 3300027853 | Soil | GVITLEDDQRADLTGQVSAFLDRQPWDRVDLPMICRCLRSTRLPG |
Ga0209693_104795661 | 3300027855 | Soil | ITLDAERRAEFSRRVRAFLDRQPWDRTDLPLICRCLRSRRLAG |
Ga0209380_105507602 | 3300027889 | Soil | QRAQFSRRVQAFLDRQPWDQVDLPMICRCLKSTRLPG |
Ga0302234_103913411 | 3300028773 | Palsa | ITMDPDQRAEFSRRVRAFLDLQPWDQVDLPMICRCLKSTRLPG |
Ga0307299_103280391 | 3300028793 | Soil | ITLETDQRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG |
Ga0302235_100914831 | 3300028877 | Palsa | TYSGVITMDPDQRAEFSRRVRAFLDRQPWDQVDLPMICRCLKSTRLPG |
Ga0302235_102029333 | 3300028877 | Palsa | TYSGVITLDAERRADFSRRVRAFLDRQPWDRTDLPLISRCLRSTRLAG |
Ga0302235_102731312 | 3300028877 | Palsa | MTKDDLLGMLGTDSGVITLEPGSRAGLIRRVQDWLDRQPWEQADPPLICRCLRSSRLPG |
Ga0222749_108377721 | 3300029636 | Soil | LGTYSGIITLEADKRAEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLTD |
Ga0311371_100740101 | 3300029951 | Palsa | GVITLDAEQRADFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLAG |
Ga0311339_113960401 | 3300029999 | Palsa | MTKDDLLGMLGTDSGVITLEPGSRAGLIRRVQDWLDRQPREQADPPLICRCLRSSRLPG |
Ga0302181_102522012 | 3300030056 | Palsa | VITLDPGRRAEFSGRAGDFLDRQPWEETDLPMICRCLRSTRLPDS |
Ga0302311_100904911 | 3300030739 | Palsa | LGTYSGVITLDAERRADFSRRVRAFLDRQPWDRTDLPLISRCLRSTRLAG |
Ga0302307_104686321 | 3300031233 | Palsa | GTYSGVITMDQDQRAGFSRRIRAFLDRQPWDQVDLPMICRCLKSRRLPG |
Ga0302324_1003561814 | 3300031236 | Palsa | LGTYSGVITLHPDRRAEFSQQARDFLDRQPWDQVDLPMICRCLRSTRLPD |
Ga0302326_111533613 | 3300031525 | Palsa | DHDRRAEFSQRARDFLDRQPWDQIDLPMICRCLRSTRLPG |
Ga0310915_112743792 | 3300031573 | Soil | LEAGRRAEFSRRVRAFLDHQPWDRVDLPLICRCLRSTRLPG |
Ga0318574_106500362 | 3300031680 | Soil | GRRADFTGRATAFLDRQPWDRVDLPMICRCLRSTRLPG |
Ga0318560_101048051 | 3300031682 | Soil | RAEFSRRVRAFLDHQPWDRVDLPLICRCLRSTRLPG |
Ga0318560_107150062 | 3300031682 | Soil | GRRAEFSRRVRAFLDHQLWDRVDLPLICRCLRSTRLPG |
Ga0307474_106390351 | 3300031718 | Hardwood Forest Soil | YSGVITLDPERRADFSRRVGAFLDRQPWDRTDLPLICRCLRSTRLAG |
Ga0318493_106698282 | 3300031723 | Soil | TYSGVITLDPGRRADFTGRARAFLDRQPWDRVDLPMICRCLRSTRLPG |
Ga0306918_103559331 | 3300031744 | Soil | EAGRRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG |
Ga0318547_101104533 | 3300031781 | Soil | SGVITLDPERRADFTRRVRAFLDRQPWDRTDLPLICRCLRSTRRPG |
Ga0318547_108965902 | 3300031781 | Soil | IITLEAGRRAEFSRRVRAFLDHQPWDRVDLPLICRCLRSTRLPG |
Ga0318552_106298732 | 3300031782 | Soil | LEAGRRAEFSRRVRAFLNHQPWDRVDLPLICRCLRSTRLPG |
Ga0307478_101209973 | 3300031823 | Hardwood Forest Soil | TLDPERRADFSRRVRAFLDRQPWDRTDLPLICRCLRSTRLPG |
Ga0307478_106843552 | 3300031823 | Hardwood Forest Soil | TLDPARRADFSQRARDFLDSQPWEQTDLPMICRCLRSTRLPGSTS |
Ga0318511_103287281 | 3300031845 | Soil | VITLDAGRRADFSPRVRAFLDRQTWDRTDLPLICRCLRSTRRPG |
Ga0306919_107656211 | 3300031879 | Soil | GRRADFTGRARAFLDRQPWDRVDLPMACRCLRSTRLPG |
Ga0318522_103442671 | 3300031894 | Soil | AEFSRRVRAFLDHQPWDRVDLPLICRCLRSTRLPG |
Ga0306922_106004681 | 3300032001 | Soil | TLDPERRADFTRRVRAFLDRQPWDRTDLPLICRCLRSTRRPG |
Ga0318562_100388861 | 3300032008 | Soil | TLEAGPRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG |
Ga0318570_101391241 | 3300032054 | Soil | VITLDAERRADFAGRARAFLGRQPWDRVDLPMICRCLRSTRLPG |
Ga0318575_100579513 | 3300032055 | Soil | ITLEAGPRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG |
Ga0318504_105529102 | 3300032063 | Soil | TLEAGRRAEFSRRVRAFLDHQPWDRVDLPLICRCLRSTRLPG |
Ga0307472_1008190652 | 3300032205 | Hardwood Forest Soil | YSGIITLETDQRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG |
Ga0335082_107595541 | 3300032782 | Soil | GPRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG |
Ga0335079_105515562 | 3300032783 | Soil | VITLEPEQRAEFSRRVTAFLDRQPWDQVDLPMICRCLRSTRLPG |
Ga0335079_111242861 | 3300032783 | Soil | ADFSRRVRAFLDGQPWDRTDLPLICRCLRSRRLPG |
Ga0335069_120518301 | 3300032893 | Soil | TEFSRRVRAFLDRQPWDQVDLPLICRCLRSTRLAA |
Ga0335074_101042541 | 3300032895 | Soil | PQRRADFSRRVRAFLDRQRWDRTDLPLICRCLRSTRLDG |
Ga0335075_107436252 | 3300032896 | Soil | TLDPERRADFSRRVRAFLDGQPWDRTDLPMICRCLRSTRRLG |
Ga0335076_116533152 | 3300032955 | Soil | PGQRAEFSRRVTAFLDRQPWDQVDLPMICRCLRSTRQPG |
Ga0318519_101601533 | 3300033290 | Soil | LLGTYSGIITLEAGRRAEFSRRVRAFLDRQPWDRVDLPLICRCLRSTRLPG |
Ga0314866_106537_9_143 | 3300033807 | Peatland | VITLDTGRRADFTRRVRAFLDRQPWERTDLPLICRCLRSTRLPG |
⦗Top⦘ |