NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F067700

Metagenome / Metatranscriptome Family F067700

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067700
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 63 residues
Representative Sequence MAESWGEWFKVPLVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN
Number of Associated Samples 76
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 21.60 %
% of genes near scaffold ends (potentially truncated) 16.80 %
% of genes from short scaffolds (< 2000 bps) 67.20 %
Associated GOLD sequencing projects 54
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.800 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(64.800 % of family members)
Environment Ontology (ENVO) Unclassified
(79.200 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(96.800 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 51.61%    β-sheet: 1.61%    Coil/Unstructured: 46.77%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF13385Laminin_G_3 4.80
PF05876GpA_ATPase 0.80
PF07486Hydrolase_2 0.80
PF00145DNA_methylase 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.80
COG3773Cell wall hydrolase CwlJ, involved in spore germinationCell cycle control, cell division, chromosome partitioning [D] 0.80
COG5525Phage terminase, large subunit GpAMobilome: prophages, transposons [X] 0.80

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.60 %
UnclassifiedrootN/A10.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10004905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1677460Open in IMG/M
3300005433|Ga0066830_10000874All Organisms → cellular organisms → Bacteria5051Open in IMG/M
3300005946|Ga0066378_10023088All Organisms → cellular organisms → Bacteria1960Open in IMG/M
3300006025|Ga0075474_10217601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167582Open in IMG/M
3300006025|Ga0075474_10263095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167517Open in IMG/M
3300006027|Ga0075462_10087955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167971Open in IMG/M
3300006637|Ga0075461_10009497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1673222Open in IMG/M
3300006637|Ga0075461_10030264All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1783Open in IMG/M
3300006637|Ga0075461_10058912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671238Open in IMG/M
3300006637|Ga0075461_10167084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167669Open in IMG/M
3300006637|Ga0075461_10171135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167659Open in IMG/M
3300006637|Ga0075461_10218385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167566Open in IMG/M
3300006802|Ga0070749_10045231All Organisms → Viruses → Predicted Viral2697Open in IMG/M
3300006802|Ga0070749_10058440All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2331Open in IMG/M
3300006802|Ga0070749_10117694All Organisms → Viruses → Predicted Viral1561Open in IMG/M
3300006802|Ga0070749_10387698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167772Open in IMG/M
3300006802|Ga0070749_10466016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167691Open in IMG/M
3300006802|Ga0070749_10710415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167537Open in IMG/M
3300006810|Ga0070754_10044513All Organisms → Viruses → Predicted Viral2381Open in IMG/M
3300006810|Ga0070754_10078780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671666Open in IMG/M
3300006869|Ga0075477_10073453All Organisms → cellular organisms → Bacteria → Proteobacteria1491Open in IMG/M
3300006870|Ga0075479_10079779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671370Open in IMG/M
3300006874|Ga0075475_10356492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167594Open in IMG/M
3300006916|Ga0070750_10095222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671385Open in IMG/M
3300006916|Ga0070750_10284450Not Available710Open in IMG/M
3300006916|Ga0070750_10292980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167697Open in IMG/M
3300006919|Ga0070746_10034550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672703Open in IMG/M
3300006919|Ga0070746_10097737Not Available1467Open in IMG/M
3300006919|Ga0070746_10138636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671191Open in IMG/M
3300007234|Ga0075460_10008440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1674128Open in IMG/M
3300007234|Ga0075460_10030745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672082Open in IMG/M
3300007234|Ga0075460_10049350All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1584Open in IMG/M
3300007234|Ga0075460_10065803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671340Open in IMG/M
3300007234|Ga0075460_10118387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167941Open in IMG/M
3300007236|Ga0075463_10214373Not Available620Open in IMG/M
3300007344|Ga0070745_1227916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167680Open in IMG/M
3300007345|Ga0070752_1095989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671276Open in IMG/M
3300007538|Ga0099851_1005524All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium5296Open in IMG/M
3300007538|Ga0099851_1013430All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3340Open in IMG/M
3300007539|Ga0099849_1079556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671328Open in IMG/M
3300007541|Ga0099848_1044604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671804Open in IMG/M
3300007541|Ga0099848_1051290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671661Open in IMG/M
3300007542|Ga0099846_1293409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167558Open in IMG/M
3300007640|Ga0070751_1257954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167660Open in IMG/M
3300007960|Ga0099850_1037817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672088Open in IMG/M
3300007960|Ga0099850_1063354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671560Open in IMG/M
3300007960|Ga0099850_1132524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671012Open in IMG/M
3300009124|Ga0118687_10019878All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2195Open in IMG/M
3300010296|Ga0129348_1120990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167915Open in IMG/M
3300010296|Ga0129348_1214268Not Available653Open in IMG/M
3300010299|Ga0129342_1014605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1673268Open in IMG/M
3300010299|Ga0129342_1026319All Organisms → Viruses → Predicted Viral2358Open in IMG/M
3300010300|Ga0129351_1348781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167555Open in IMG/M
3300010318|Ga0136656_1145200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167814Open in IMG/M
3300010354|Ga0129333_11311164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167598Open in IMG/M
3300011306|Ga0138371_1075852All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2898Open in IMG/M
3300011306|Ga0138371_1085595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672196Open in IMG/M
3300011311|Ga0138370_1028684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671639Open in IMG/M
3300012528|Ga0129352_10139561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167634Open in IMG/M
3300016781|Ga0182063_1264899Not Available917Open in IMG/M
3300017949|Ga0181584_10105069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671928Open in IMG/M
3300017949|Ga0181584_10668093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167623Open in IMG/M
3300017951|Ga0181577_10002114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED16715704Open in IMG/M
3300017951|Ga0181577_10090678All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2124Open in IMG/M
3300017951|Ga0181577_10172209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671461Open in IMG/M
3300017951|Ga0181577_10200628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671333Open in IMG/M
3300017951|Ga0181577_10276773Not Available1096Open in IMG/M
3300017962|Ga0181581_10955127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167501Open in IMG/M
3300017986|Ga0181569_10076778All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2386Open in IMG/M
3300018039|Ga0181579_10432177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167706Open in IMG/M
3300018424|Ga0181591_10954653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167585Open in IMG/M
3300018428|Ga0181568_10376017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671148Open in IMG/M
3300019271|Ga0182065_1572412Not Available1002Open in IMG/M
3300019283|Ga0182058_1734153Not Available2075Open in IMG/M
3300019756|Ga0194023_1004888All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin2162692Open in IMG/M
3300020056|Ga0181574_10209701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671242Open in IMG/M
3300020184|Ga0181573_10172459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671195Open in IMG/M
3300020189|Ga0181578_10346222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167667Open in IMG/M
3300020436|Ga0211708_10040216All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1793Open in IMG/M
3300021957|Ga0222717_10223014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671108Open in IMG/M
3300021960|Ga0222715_10038637Not Available3375Open in IMG/M
3300021961|Ga0222714_10497206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167626Open in IMG/M
3300022057|Ga0212025_1031178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167898Open in IMG/M
3300022168|Ga0212027_1041594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167591Open in IMG/M
3300022176|Ga0212031_1046170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167727Open in IMG/M
3300022176|Ga0212031_1067419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167607Open in IMG/M
3300022187|Ga0196899_1057671All Organisms → Viruses → Predicted Viral1250Open in IMG/M
3300022187|Ga0196899_1151878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167643Open in IMG/M
3300022198|Ga0196905_1003906All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium5386Open in IMG/M
3300022198|Ga0196905_1010669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1673040Open in IMG/M
3300022200|Ga0196901_1009487All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium4160Open in IMG/M
3300022934|Ga0255781_10049539All Organisms → cellular organisms → Bacteria2494Open in IMG/M
3300023178|Ga0255759_10337259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167935Open in IMG/M
3300025610|Ga0208149_1045835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671146Open in IMG/M
3300025630|Ga0208004_1002019All Organisms → cellular organisms → Bacteria7788Open in IMG/M
3300025630|Ga0208004_1004221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1675223Open in IMG/M
3300025630|Ga0208004_1017062All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2313Open in IMG/M
3300025630|Ga0208004_1031757All Organisms → Viruses → Predicted Viral1540Open in IMG/M
3300025630|Ga0208004_1039189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671335Open in IMG/M
3300025630|Ga0208004_1061740All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300025646|Ga0208161_1017865All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2729Open in IMG/M
3300025671|Ga0208898_1009500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1674949Open in IMG/M
3300025674|Ga0208162_1182012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167548Open in IMG/M
3300025687|Ga0208019_1161824Not Available621Open in IMG/M
3300025751|Ga0208150_1094534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167980Open in IMG/M
3300025759|Ga0208899_1155388Not Available777Open in IMG/M
3300025769|Ga0208767_1121456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671002Open in IMG/M
3300025769|Ga0208767_1133101Not Available934Open in IMG/M
3300025771|Ga0208427_1211510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167612Open in IMG/M
3300025818|Ga0208542_1001772All Organisms → cellular organisms → Bacteria8880Open in IMG/M
3300025818|Ga0208542_1003325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1676281Open in IMG/M
3300025818|Ga0208542_1020107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672252Open in IMG/M
3300025818|Ga0208542_1085660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167925Open in IMG/M
3300025889|Ga0208644_1001640All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium TMED7518542Open in IMG/M
3300025889|Ga0208644_1008439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1677261Open in IMG/M
3300025889|Ga0208644_1111565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671322Open in IMG/M
3300025889|Ga0208644_1148408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671078Open in IMG/M
3300025889|Ga0208644_1182615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167928Open in IMG/M
3300026093|Ga0208624_1002886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1677444Open in IMG/M
3300026093|Ga0208624_1010035All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3305Open in IMG/M
3300026136|Ga0208763_1004286Not Available2347Open in IMG/M
3300026201|Ga0208127_1001895All Organisms → cellular organisms → Bacteria10223Open in IMG/M
3300029448|Ga0183755_1023091All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1999Open in IMG/M
3300034374|Ga0348335_085036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671052Open in IMG/M
3300034375|Ga0348336_127576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167800Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous64.80%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh16.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.20%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient5.60%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.40%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.60%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.80%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.80%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005946Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_AEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300011306Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 DCM_B metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011311Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 DCM_A metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018039Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019271Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101411XT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300020056Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020184Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020189Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaGEnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026093Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300026201Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 (SPAdes)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_10004905123300000116MarineVKTMAESWGEWFKVPMVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGNAVIEFKRKRNEKRN*
Ga0066830_1000087433300005433MarineMSDTWGEWFKVPLVGAIGFTVTGSTIDEWLRIGIAAATLVYTIAKAGSAIIEFKRKRNEKRN*
Ga0066378_1002308833300005946MarineMTDTWGEWLKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRN*
Ga0075474_1021760123300006025AqueousWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0075474_1026309523300006025AqueousMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0075462_1008795523300006027AqueousMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0075461_1000949743300006637AqueousMAESWGEWFKVPMVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN*
Ga0075461_1003026443300006637AqueousMADTWGEWFKVPLVGVIGFSITGSTIDEWLRIGIAIATLVYTIAKAGSAVIEFKRKRNEKRN*
Ga0075461_1005891213300006637AqueousVKTMAESWGEWFKVPAIGVIGFTVTGSAIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0075461_1016708423300006637AqueousMAESWGEWFKVPLVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN*
Ga0075461_1017113523300006637AqueousMAESWGEWFKVPMVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGNAVIEFKRKRNEKRN*
Ga0075461_1021838523300006637AqueousVKTMADTWGEWFKVPLVGVIGFSITGSTIDEWLRIGIAIATLIYTIAKAGSAVIEFKRKRNEKRN*
Ga0070749_1004523143300006802AqueousLGVKTMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFRRKRNEKRN*
Ga0070749_1005844033300006802AqueousVKAMTDTWGEWLKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRD*
Ga0070749_1011769443300006802AqueousMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIALATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0070749_1038769823300006802AqueousMAESWGEWFKVPAIGAIGFTITGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFRRKRNEKRN*
Ga0070749_1046601623300006802AqueousMAESWGEWFKVPMVGVIGFSITGSTIDEWLRIGIAIATLIYTIAKAGSAIIEFKRKRNEKRN*
Ga0070749_1071041523300006802AqueousMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0070754_1004451343300006810AqueousMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFRRKRNEKRN*
Ga0070754_1007878033300006810AqueousMAESCGEWFKVPAIGAIGFTITGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0075477_1007345313300006869AqueousMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIE
Ga0075479_1007977923300006870AqueousMAEPWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0075475_1035649223300006874AqueousMAESWGEWFKVPAIGAIGFTITGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0070750_1009522223300006916AqueousVKTMAESWGEWFKVPMVGVIGFSITGSTIDEWLRIGIAIATLIYTIAKAGSAIIEFKRKRNEKRN*
Ga0070750_1028445023300006916AqueousMAESWGEWFKVPLVGVVGISVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0070750_1029298023300006916AqueousMTDTWGEWLKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRD*
Ga0070746_1003455043300006919AqueousVKTMAESWGEWFKVPMVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN*
Ga0070746_1009773743300006919AqueousVKTMAESWGEWFKVPLVGVVGISVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0070746_1013863623300006919AqueousVKTMAESWGEWFKVPAIGAIGFTITGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFRRKRNEKRN*
Ga0075460_1000844043300007234AqueousLGVKTMAESWGEWFKVPMVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN*
Ga0075460_1003074543300007234AqueousLGVKTMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIALATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0075460_1004935023300007234AqueousVKTMAESWGEWFKVPLVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN*
Ga0075460_1006580333300007234AqueousLGVKTMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIALATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0075460_1011838723300007234AqueousLGVKTMAESWGEWFKVPMVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGNAVIEFKRKRNEKRN*
Ga0075463_1021437323300007236AqueousRQGLGVKTMAESWGEWFKVPLVGVVGISVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0070745_122791623300007344AqueousLGVKTMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0070752_109598913300007345AqueousVKTMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIE
Ga0099851_100552433300007538AqueousVKTMAEPWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0099851_101343043300007538AqueousLGVKTMAESWGEWFKVPMVGVIGFTVTGSTIDERLRIAIAIATLVYTIAKAGNAVIEFKRKRNEKRN*
Ga0099849_107955633300007539AqueousLGVKTMADSWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0099848_104460433300007541AqueousVKTMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN*
Ga0099848_105129033300007541AqueousMAESWGEWFKVPAVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0099846_129340923300007542AqueousVKTMADTWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0070751_125795423300007640AqueousLGVKTMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0099850_103781733300007960AqueousLGVKTMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0099850_106335413300007960AqueousMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN*
Ga0099850_113252433300007960AqueousMAEPWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN*
Ga0118687_1001987833300009124SedimentLGVKTMAESWGEWFKVPLVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN*
Ga0129348_112099023300010296Freshwater To Marine Saline GradientLGVKTMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0129348_121426823300010296Freshwater To Marine Saline GradientVKAMTDTWGEWFKVPLVGVVGISVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKRKRNEKRN*
Ga0129342_101460563300010299Freshwater To Marine Saline GradientLGVKTMAEPWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVI
Ga0129342_102631923300010299Freshwater To Marine Saline GradientMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0129351_134878123300010300Freshwater To Marine Saline GradientVKTMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0136656_114520033300010318Freshwater To Marine Saline GradientVKTMAEPWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN*
Ga0129333_1131116413300010354Freshwater To Marine Saline GradientVKTMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEK
Ga0138371_107585243300011306MarineMTDTWGEWFKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAIIEFKRKRNEKRN*
Ga0138371_108559523300011306MarineLGVKAMTDTWGEWLKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRN*
Ga0138370_102868443300011311MarineVKAMTDTWGEWLKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRN*
Ga0129352_1013956123300012528AqueousMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKTQ*
Ga0182063_126489913300016781Salt MarshGVKAMTDTWGEWLKVPLVGVVGISVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0181584_1010506943300017949Salt MarshMAESWGEWFKVPMVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGNAVIEFKRKRNEKRN
Ga0181584_1066809323300017949Salt MarshVKAMTDTWGEWLKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRD
Ga0181577_10002114203300017951Salt MarshMAESWGEWFKVPLVGVIGFSITGSTIDEWLRIGIAIATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0181577_1009067823300017951Salt MarshVKAMTDTWGEWFKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRN
Ga0181577_1017220923300017951Salt MarshVKAMSDTWGEWFKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAIIEFKKKRNEKRN
Ga0181577_1020062813300017951Salt MarshMAESWGEWFKVPAIGAIGYTITGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0181577_1027677333300017951Salt MarshVKAMSDTWGEWLKVPLVGVVGISVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0181581_1095512713300017962Salt MarshVKTMAESWGEWFKVPMVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGNAVIEFKRKRNEKRN
Ga0181569_1007677843300017986Salt MarshVKAMSDTWGEWLKVPLVGVVGISVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRN
Ga0181579_1043217713300018039Salt MarshMTDTWGEWLKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRN
Ga0181591_1095465323300018424Salt MarshVRTMAESWGEWFKVPAIGVIGFTVTGSTVDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0181568_1037601723300018428Salt MarshVKTMAESWGEWFKVPLVGVIGFSITGSTIDEWLRIGIAIATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0182065_157241233300019271Salt MarshMSDTWGEWLKVPLVGVVGISVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0182058_173415333300019283Salt MarshLGVKAMSDTWGEWLKVPLVGVVGISVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0194023_100488833300019756FreshwaterMSDTWGEWLKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRN
Ga0181574_1020970133300020056Salt MarshVGVKAMTDTWGEWFKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRN
Ga0181573_1017245933300020184Salt MarshMTDTWGEWFKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRN
Ga0181578_1034622223300020189Salt MarshMTDTWGEWLKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRD
Ga0211708_1004021623300020436MarineMSDTWGEWFKVPLVGALGITITGSTIDEWLRIGIAAATLVYTIAKAGSAVIEFRKKQNEKRN
Ga0222717_1022301423300021957Estuarine WaterMAESWGEWFKVPLVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0222715_1003863743300021960Estuarine WaterVKTMAESWGEWFKVPLVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0222714_1049720623300021961Estuarine WaterPLVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0212025_103117823300022057AqueousMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0212027_104159413300022168AqueousSGVKTMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0212031_104617023300022176AqueousMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0212031_106741923300022176AqueousVKTMAESWGEWFKVPMVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAIIEFKRKRNEKRN
Ga0196899_105767123300022187AqueousMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFRRKRNEKRN
Ga0196899_115187823300022187AqueousMAESWGEWFKVPAIGAIGFTITGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0196905_100390633300022198AqueousVKTMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0196905_101066923300022198AqueousMAEPWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0196901_100948713300022200AqueousVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0255781_1004953933300022934Salt MarshMTDTWGEWLKVPLVGVVGISVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0255759_1033725933300023178Salt MarshLGVKAMTDTWGEWFKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRN
Ga0208149_104583513300025610AqueousWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0208004_1002019103300025630AqueousMADTWGEWFKVPLVGVIGFSITGSTIDEWLRIGIAIATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0208004_100422153300025630AqueousVKTMAESWGEWFKVPMVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0208004_101706223300025630AqueousMADTWGEWFKVPLVGVIGFSITGSTIDEWLRIGIAIATLIYTIAKAGSAVIEFKRKRNEKRN
Ga0208004_103175723300025630AqueousMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIALATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0208004_103918923300025630AqueousMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0208004_106174033300025630AqueousMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFR
Ga0208161_101786533300025646AqueousVKTMAESWGEWFKVPAVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0208898_100950043300025671AqueousVKTMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0208162_118201223300025674AqueousMADSWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0208019_116182423300025687AqueousVKAMTDTWGEWFKVPLVGVVGISVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0208150_109453433300025751AqueousMAEPWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0208899_115538813300025759AqueousAESWGEWFKVPLVGVVGISVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKR
Ga0208767_112145633300025769AqueousMAESWGEWFKVPAIGAIGFTITGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFRRKRNEKRN
Ga0208767_113310123300025769AqueousVKTMAESWGEWFKVPLVGVVGISVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0208427_121151013300025771AqueousMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIE
Ga0208542_100177253300025818AqueousVKTMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIALATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0208542_100332583300025818AqueousVKTMADTWGEWFKVPLVGVIGFSITGSTIDEWLRIGIAIATLIYTIAKAGSAVIEFKRKRNEKRN
Ga0208542_102010733300025818AqueousVKTMAESWGEWFKVPAIGAIGFTITGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFRRKRNEKRN
Ga0208542_108566013300025818AqueousMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKKKRNEK
Ga0208644_1001640133300025889AqueousVKTMADTWGEWFKVPLVGVIGFSITGSTIDEWLRIGIAIATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0208644_100843993300025889AqueousMAESWGEWFKVPMVGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKRKRNEKRN
Ga0208644_111156523300025889AqueousVKTMAESWGEWFKVPMVGVIGFSITGSTIDEWLRIGIAIATLIYTIAKAGSAIIEFKRKRNEKRN
Ga0208644_114840833300025889AqueousVKTMAESWGEWFKVPAIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKK
Ga0208644_118261533300025889AqueousMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKK
Ga0208624_100288653300026093MarineVKAMTDTWGEWLKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAVIEFRRKRNEKRN
Ga0208624_101003543300026093MarineVKPMTDTWGEWFKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAIIEFKRKRNEKRN
Ga0208763_100428643300026136MarineMSDTWGEWFKVPLVGAIGFTVTGSTIDEWLRIGIAAATLVYTIAKAGSAIIEFKRKRNEKRN
Ga0208127_100189583300026201MarineVKPMSDTWGEWFKVPLVGAIGFTVTGSTIDEWLRIGIAAATLVYTIAKAGSAIIEFKRKRNEKRN
Ga0183755_102309143300029448MarineVKAMTDTWGEWLKVPLVGAIGFTVTGSTIDEWLRICIAAATLVYTIAKAGSAIIEFRRKRNEKRN
Ga0348335_085036_214_4023300034374AqueousMAESWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAVATLVYTIAKAGSAVIEFKKKRNEKRN
Ga0348336_127576_1_1653300034375AqueousMAEPWGEWFKVPTIGVIGFTVTGSTIDEWLRIAIAIATLVYTIAKAGSAVIEFKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.