NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F067225

Metagenome Family F067225

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067225
Family Type Metagenome
Number of Sequences 126
Average Sequence Length 46 residues
Representative Sequence DLNRAPPVEAAGIFPQSLWRHSHIRLTEEQFESARKLIEAAAK
Number of Associated Samples 108
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 94.44 %
% of genes from short scaffolds (< 2000 bps) 95.24 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.825 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(14.286 % of family members)
Environment Ontology (ENVO) Unclassified
(33.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.730 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.21%    β-sheet: 0.00%    Coil/Unstructured: 64.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF027373HCDH_N 63.49
PF07883Cupin_2 7.14
PF13649Methyltransf_25 5.56
PF00999Na_H_Exchanger 4.76
PF08241Methyltransf_11 3.97
PF12728HTH_17 2.38
PF00486Trans_reg_C 1.59
PF01699Na_Ca_ex 0.79
PF02080TrkA_C 0.79
PF06325PrmA 0.79
PF00171Aldedh 0.79
PF01370Epimerase 0.79
PF06803DUF1232 0.79
PF10027DUF2269 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 63.49
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 63.49
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 63.49
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 63.49
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 63.49
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 63.49
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 63.49
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 4.76
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 4.76
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 4.76
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 4.76
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 4.76
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.79
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 0.79
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 0.79
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.79
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 0.79
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.79
COG3339Uncharacterized membrane protein YkvA, DUF1232 familyFunction unknown [S] 0.79
COG3897Protein N-terminal and lysine N-methylase, NNT1/EFM7 familyPosttranslational modification, protein turnover, chaperones [O] 0.79
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.79

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.83 %
UnclassifiedrootN/A3.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig124396All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_14302656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300001205|C688J13580_1064916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300001431|F14TB_100213161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300001535|A3PFW1_10107982Not Available2069Open in IMG/M
3300004081|Ga0063454_100453628All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300004081|Ga0063454_102046454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300004479|Ga0062595_102551151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300004480|Ga0062592_102035500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300005171|Ga0066677_10816413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300005174|Ga0066680_10654662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300005175|Ga0066673_10896348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300005176|Ga0066679_10113893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1659Open in IMG/M
3300005178|Ga0066688_10287245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1059Open in IMG/M
3300005179|Ga0066684_10428160All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300005181|Ga0066678_10158574All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300005187|Ga0066675_10908134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300005294|Ga0065705_10552482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300005336|Ga0070680_101330170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300005353|Ga0070669_100880561All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300005434|Ga0070709_11044492All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300005468|Ga0070707_100242690All Organisms → cellular organisms → Bacteria1753Open in IMG/M
3300005526|Ga0073909_10323807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300005526|Ga0073909_10489724All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005536|Ga0070697_101274003All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300005544|Ga0070686_100868297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300005549|Ga0070704_101696704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300005553|Ga0066695_10108261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1708Open in IMG/M
3300005555|Ga0066692_10451006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300005558|Ga0066698_11079871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300005713|Ga0066905_101467010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300005718|Ga0068866_10287048All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300005764|Ga0066903_108224402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300006031|Ga0066651_10760285All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300006032|Ga0066696_10511988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium787Open in IMG/M
3300006034|Ga0066656_11082726All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300006046|Ga0066652_100003308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9091Open in IMG/M
3300006046|Ga0066652_101376343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300006794|Ga0066658_10616502All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300006806|Ga0079220_10054568All Organisms → cellular organisms → Bacteria1900Open in IMG/M
3300006854|Ga0075425_102239463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300006904|Ga0075424_101109549All Organisms → cellular organisms → Bacteria → Terrabacteria group843Open in IMG/M
3300006904|Ga0075424_101974866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300006904|Ga0075424_102158389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300007255|Ga0099791_10418152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300009012|Ga0066710_104488503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300009100|Ga0075418_11251443All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300009137|Ga0066709_101257939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1088Open in IMG/M
3300009162|Ga0075423_12783505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300009553|Ga0105249_11152610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria846Open in IMG/M
3300009553|Ga0105249_13446260All Organisms → cellular organisms → Bacteria → Terrabacteria group509Open in IMG/M
3300009789|Ga0126307_10672812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria835Open in IMG/M
3300009789|Ga0126307_10804187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300009789|Ga0126307_11203240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300009840|Ga0126313_10497885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria975Open in IMG/M
3300009840|Ga0126313_10875816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300010039|Ga0126309_10522126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria734Open in IMG/M
3300010040|Ga0126308_10032889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium2910Open in IMG/M
3300010041|Ga0126312_10024939All Organisms → cellular organisms → Bacteria3992Open in IMG/M
3300010041|Ga0126312_10546808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300010159|Ga0099796_10579904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300010303|Ga0134082_10421856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300010326|Ga0134065_10294236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300010333|Ga0134080_10050240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1638Open in IMG/M
3300010337|Ga0134062_10708284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300010362|Ga0126377_10130365All Organisms → cellular organisms → Bacteria → Terrabacteria group2336Open in IMG/M
3300010364|Ga0134066_10274444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300010364|Ga0134066_10438613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300010371|Ga0134125_11353793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300010375|Ga0105239_11911784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300012019|Ga0120139_1184564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300012209|Ga0137379_10507418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1114Open in IMG/M
3300012211|Ga0137377_10302798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1533Open in IMG/M
3300012211|Ga0137377_10304984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1527Open in IMG/M
3300012211|Ga0137377_11153700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium705Open in IMG/M
3300012211|Ga0137377_11330758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium648Open in IMG/M
3300012356|Ga0137371_10722480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria761Open in IMG/M
3300012503|Ga0157313_1066671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300012526|Ga0136637_1237034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300012898|Ga0157293_10156265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300012901|Ga0157288_10220726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300012948|Ga0126375_11773279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300012960|Ga0164301_11099911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300012976|Ga0134076_10447149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300013297|Ga0157378_10342461All Organisms → cellular organisms → Bacteria1458Open in IMG/M
3300014150|Ga0134081_10272709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300014157|Ga0134078_10231767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300014157|Ga0134078_10398647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300014166|Ga0134079_10713837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300014965|Ga0120193_10032880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300015077|Ga0173483_10790654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300015373|Ga0132257_104278119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300018468|Ga0066662_11215583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300022694|Ga0222623_10043114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1732Open in IMG/M
3300022756|Ga0222622_10849471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300025910|Ga0207684_10314478All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300025910|Ga0207684_11393383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300025910|Ga0207684_11552246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300025917|Ga0207660_11157826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300025922|Ga0207646_11354983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300025935|Ga0207709_11201797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300025938|Ga0207704_11463743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300026035|Ga0207703_12082711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300026550|Ga0209474_10428738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300028708|Ga0307295_10238794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300028718|Ga0307307_10090968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium924Open in IMG/M
3300028755|Ga0307316_10204470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium712Open in IMG/M
3300028768|Ga0307280_10336152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300028782|Ga0307306_10263411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300028875|Ga0307289_10162419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria919Open in IMG/M
3300028880|Ga0307300_10042797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1265Open in IMG/M
3300028885|Ga0307304_10560523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300028889|Ga0247827_11293919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300030336|Ga0247826_11746315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300031547|Ga0310887_10142282All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300031548|Ga0307408_101227477Not Available700Open in IMG/M
3300031562|Ga0310886_10473794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium751Open in IMG/M
3300031740|Ga0307468_101632214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium604Open in IMG/M
3300031854|Ga0310904_10387216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium912Open in IMG/M
3300031896|Ga0318551_10762465Not Available562Open in IMG/M
3300031903|Ga0307407_11091089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300031996|Ga0308176_11384512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria748Open in IMG/M
3300032126|Ga0307415_101961065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300032179|Ga0310889_10681275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300033551|Ga0247830_10412268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1053Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil14.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil8.73%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil7.14%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.35%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.35%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.38%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.38%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.59%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.59%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.59%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.59%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.79%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012526Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ857 (21.06)EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_055969402124908045SoilVTDLERAPAVEEAGIFPQSLWRHSHIRLSTEQFERARELIEAAA
ICChiseqgaiiFebDRAFT_1430265623300000363SoilPVEAAGIWPQSIWRHSHIRLSEEQFAEACRLIEDAARS*
C688J13580_106491613300001205SoilIRPTLVVGDLHDAPPVEAAGIFPQSLWRHSHIRLTDEQFDTARALIDAVGFPA*
F14TB_10021316123300001431SoilIGDLHDAPPVEAAGVFPQSLWRHSHIRLTPEQFERXXXXVEAAA*
A3PFW1_1010798213300001535PermafrostRPLAVVSDLERAPAVEEAGIFPQSLWRHSYIRLTEEQFDMARNLVERASGL*
Ga0063454_10045362823300004081SoilAPPVEAAGVFPQSVWRHSHIRLTPEQFATARALIESAAGR*
Ga0063454_10204645413300004081SoilDLHDAPPVEAAGIFPQSVWRHSYIRLTPGHFATARALIEAAAG*
Ga0062595_10255115133300004479SoilTVLTDLDEAPPVEEAGVFPSSLWRHSYIRLTPEQFERARELIELRRA*
Ga0062592_10203550013300004480SoilLERAPAVEEAGIFPQSLWRHSHIRLSTEQFERARELIEAAA*
Ga0066677_1081641323300005171SoilLVVVRDLHDAPAVEAAGIWPQSLWRHSHIRLTDEQFAAARRLVEAVGSPA*
Ga0066680_1065466213300005174SoilAPPVEAAGIFPQSLWRHSHIRLSNEQFERARALIELVGAAV*
Ga0066673_1089634813300005175SoilAPPAEEAGIFPQSLWRHSYIRLSDEQFDRARELIEAVGSSA*
Ga0066679_1011389313300005176SoilPPAEEAGIFPQSLWRHSYIRLSDEQFDRARELIEAVGSSA*
Ga0066688_1028724523300005178SoilAPPVEAAGVFPQSIWRHSHIRLSEEQFEVARALVAAAAK*
Ga0066684_1042816013300005179SoilAVVEDLHDAPPVEAAGVFPQSLWRHSHIRLSQEQFESARWLIEAALARSSA*
Ga0066678_1015857433300005181SoilFVSDLDRAPAVEEAGIFPQSLWRHSYIRLTAEQFEAARELIDRIAARGG*
Ga0066675_1090813413300005187SoilLPDLDRAPAVEEIGVFPSSLWRHSYIRLTPDQFEQAVALLEAARESGA*
Ga0065705_1055248223300005294Switchgrass RhizosphereVISDLHDAPPVEAAGIFPQSLWRHSHIRLTDEQFAAARELIEARSGGE*
Ga0070680_10133017013300005336Corn RhizosphereIRPLTVVRDLHEAPAVEAAGVFPQSIWRHSHIRLSEEQFTEACRLIEDAA*
Ga0070669_10088056123300005353Switchgrass RhizosphereSVTVVTDLNRAPPIEAAGIFPQSLWRHSHIRLTEEQFESARNLIEAAAK*
Ga0070709_1104449213300005434Corn, Switchgrass And Miscanthus RhizosphereLNDAPPVEAAGVFPQSLWRHSHIRLTEEQFESARKLIEAAAK*
Ga0070707_10024269013300005468Corn, Switchgrass And Miscanthus RhizosphereVVADLNDAPPVEAAGIFPQSLWRHSHIRLTEVQFESARELIEAAAK*
Ga0073909_1032380713300005526Surface SoilPPVEAAAVFPQSLWRHSHIRLTRDQFDAARALIEAAAA*
Ga0073909_1048972433300005526Surface SoilGDLHDAPPVEAAGIFPQSIWRHSHIRLTPEQFETARALIELAAGL*
Ga0070697_10127400323300005536Corn, Switchgrass And Miscanthus RhizosphereGYAIRPVTIVADLNDAPPVEAAGVFPQSLWRHSHIRLTEEQFESARKLIEAAAK*
Ga0070686_10086829733300005544Switchgrass RhizosphereRPLVVVPDLDRAPAVEEAGIFPSSIWRHSYIRLSEEQFDRARELIEARR*
Ga0070704_10169670423300005549Corn, Switchgrass And Miscanthus RhizosphereTVVTDLNRAPPVEAAGIFPQSLWRHSHIRLTEEQFESARKLIEAAAK*
Ga0066695_1010826143300005553SoilGIFPQSLWRHSHIRLSDDQFERARALIESVVSRA*
Ga0066692_1045100613300005555SoilVEAAGIFPQSLWRHSHIRLSQEQFERARALISASGSLRGEFD*
Ga0066698_1107987113300005558SoilVEAAGIFPQSLWRHSHIRLSDEQFERARALIESVVSRA*
Ga0066905_10146701013300005713Tropical Forest SoilHDAPPVEAAGVFPQSLWRHSHIRLTREQFESARALIEAAA*
Ga0068866_1028704813300005718Miscanthus RhizosphereIRSVTVVTDLNRAPPVEAAGIFPQSLWRHSHIRLTEEQFESARKLIEAAAK*
Ga0066903_10822440213300005764Tropical Forest SoilRDLHDAPPVEAAGIFPQSLWRHSHIRLTPAQFDEARRLIDVVAG*
Ga0066651_1076028523300006031SoilIRPLAVVADLHDAPPVEAAGIFPQSLWRHSHIRLTDEQFDRARALITAVSTRQ*
Ga0066696_1051198823300006032SoilADLHDAPAVEEAGIFPQSLWRHSYIRLTAEQFATARTLVEARH*
Ga0066656_1108272613300006034SoilAPAVEEAGIFPQSLWRHSHIRLSAEQFERAKELIEAAA*
Ga0066652_10000330813300006046SoilRFAIRPLAVVRDLEDAPPVEAAGVLPQSIWRHSHIRLTEEQFGAARALVEAAA*
Ga0066652_10137634333300006046SoilADLHDAPPVEAAGIFPQSLWRHSHIRLTDEQFERARALIAAVSTPR*
Ga0066658_1061650213300006794SoilVVADLNGAPPVEAAGIFPQSLWRHSHIRLTEKQFESARKLIEAAAK*
Ga0079220_1005456813300006806Agricultural SoilNDAPPVEAAGIFPQSLWRHSHIRLTDEQFDSACKLIEAATK*
Ga0075425_10223946323300006854Populus RhizosphereVVQDLERAPAVEEAGIFPQSLWRHSYIRLSGEQFESARALVERAGRRL*
Ga0075425_10262035023300006854Populus RhizosphereAWRFPIRPLVVVRDLDRAPPVEAAGIFPQSIWRHSYIRLRDEQFAAARALVERAARE*
Ga0075424_10110954913300006904Populus RhizosphereAPAVEEAGIFPQSLWRHSYIRLTTDQFDSALALVETAGHRL*
Ga0075424_10197486623300006904Populus RhizospherePLVAVRDLHDAPPVEAAGIFPQSLWRHSHIRLTPTQFDEARRLVAAAAG*
Ga0075424_10215838913300006904Populus RhizosphereVVSDLHDAPPVEAAGVFPQSLWRHSHIRLTVDQFDEARTLVQGAIDGRA*
Ga0099791_1041815223300007255Vadose Zone SoilPVEAAGIFPQSLWGHSHIRLTTEQFQSAQKLVEAAAN*
Ga0066710_10448850323300009012Grasslands SoilAGIFPQSLWRHSHIRLSDDQFERARALIESVVSRA
Ga0075418_1125144333300009100Populus RhizosphereIRALVVVTDLERAPAVEEAGIFPQSLWRHSHIRLSTEQFERARELIEAAA*
Ga0066709_10125793923300009137Grasslands SoilVTVVADLNRAPPVEAACIFPQSLWRHSHIRLTEEQFESARKLIEAAAK*
Ga0075423_1278350523300009162Populus RhizospherePLVAVRDLHDAPPVEAAGVFPNSIWRHSHIRLTPEQFAAARALIEAAA*
Ga0105249_1115261033300009553Switchgrass RhizosphereRFPIQPLAVVRDLHYAPPVEAAGVFPQSLWRHSYIRLTREQFETARALIEAAA*
Ga0105249_1344626023300009553Switchgrass RhizosphereVVRDLHDAPPVEAAGVFPQSLWRHSHIRLSAEQFATARSLVESAA*
Ga0126307_1067281213300009789Serpentine SoilVEAAGVFPQSLWRHSHIRLTTEQFAAASRLVEGASASSS*
Ga0126307_1080418723300009789Serpentine SoilVTDLHDAPPVEAAGIFPQSLWRHSHIRLSQEQFETARQLIETAADLSA*
Ga0126307_1120324023300009789Serpentine SoilAPPVEAAGIFPRSVWRHSHIRLEQERFAAACDVVEAAAAGPRAGRR*
Ga0126313_1049788513300009840Serpentine SoilPPVEAAGIFPQSLWRHSHIRLTADQFGAARRLVGEASG*
Ga0126313_1087581613300009840Serpentine SoilRPVTVVGDLHDAPPVEAAGIFPQSIWRHSHIRLSEEQFAEACRLIEEAA*
Ga0126309_1052212613300010039Serpentine SoilAVRDLHDAPPVEAAGVFPQSLWRHSHIRLSEDQFDAARGLIEEASA*
Ga0126308_1003288913300010040Serpentine SoilPVEAAGIFPQSLWRHSHIRLSEEQFADARRLIEAA*
Ga0126312_1002493913300010041Serpentine SoilDLHDAPPVEAAGVFPQSIWRHSHIRLTEEQFARARELIEAAA*
Ga0126312_1054680813300010041Serpentine SoilDVAPPVEAAGVFPQSVWRHSHIRLTPEQFEAARSLVVAAAG*
Ga0099796_1057990413300010159Vadose Zone SoilPAVEEAGVFPQSLWRHSHIRLTDQQFEIARELIEAASG*
Ga0134082_1042185623300010303Grasslands SoilPPVEAAGIFPQSLWRHSHIRLSDDQFERARALIESVVSRA*
Ga0134065_1029423623300010326Grasslands SoilSDAPPVEAAGIFPQSLWRHSHIRLSDDQFERARALIESVVSRA*
Ga0134080_1005024023300010333Grasslands SoilVTVVTDLNRAPPVEAAGIFPQSLWRHSHIRLTEEQFDSARKLIEAAAK*
Ga0134062_1070828413300010337Grasslands SoilIVVRDLDNAPPVEAAGILPQSLWRHSHIRLTKPQFDSARGLIEAAARVLARSRA*
Ga0126377_1013036543300010362Tropical Forest SoilVVEDLEHAPAVEEAGIFPQSLWRHSYIRLTSDQFETARALVEKAGKRL*
Ga0134066_1027444413300010364Grasslands SoilDLHDAPAVEEAGIFPQSLWRHSHIRLTQEQFDTARELIETAARLQGSRA*
Ga0134066_1043861323300010364Grasslands SoilLVVRDLHHAPPVEAAGIFPQSLWRHSHIRLSDDQFERARALIESVVSRA*
Ga0134125_1135379313300010371Terrestrial SoilRWAWRFPIRPVTLVGDLHDAPPVEAAGIFPQSIWRHSHIRLSEEPFADACRLIEEASS*
Ga0105239_1191178433300010375Corn RhizosphereVVVPDLDRAPAVEEAGIFPSSIWRHSYIRLSEEQFDRARELIEARR*
Ga0120139_118456423300012019PermafrostAWSYPVRPVTVVSDLNDAPPVEAAGIFPQSLWRHSHIRLTEEQFESARRLIEAAAQ*
Ga0137379_1050741823300012209Vadose Zone SoilAAGIFPQSLWRHSHIRLTEEQFESARTLVEAAAK*
Ga0137377_1030279813300012211Vadose Zone SoilHDAPAVEEAGIFPQSLWRHSYIRLTAEQFATARTLVEARH*
Ga0137377_1030498413300012211Vadose Zone SoilVVADLHDAPAVEEAGIWPQSLWRHSHIRLSAEQFDAARRLIESRIGSPP*
Ga0137377_1115370023300012211Vadose Zone SoilAPAVEEAGIWPQSLWRHSHIRLGEEQFAAARALVAAAASDMSV*
Ga0137377_1133075813300012211Vadose Zone SoilIRPLAVVADLNDAPPVEAAGIFPQSLWRHSHIRLSEEQFESARKLIEAAV*
Ga0137371_1072248023300012356Vadose Zone SoilPLVVVSDLHDAPPVEAAGIFPQSLWRHSHIRLSDEQFERARELIEAVGSTA*
Ga0157313_106667113300012503Arabidopsis RhizosphereAPPAEAAGIFPQSLWRHSHIRLTQEQFDEARTLIEGAGWYPRL*
Ga0136637_123703423300012526Polar Desert SandLRLLALVPDLDRAPAVEAAGIYPQSLWRHSHIRLSPEQFEAARELVETQ*
Ga0157293_1015626533300012898SoilVLVPDLERAPAVEEAGIFPSSIWRHSYIRLSDEQFDRARALIEARR*
Ga0157288_1022072613300012901SoilVGDLHDAPPVEAAGVFPQSIWRHSHIRLSEEQFAEACKLIEDAA*
Ga0126375_1177327923300012948Tropical Forest SoilGRVVVRDLHEAPPVEAAGIFPQSIWRHSHIRLTPEQFASARALIEAAAD*
Ga0164301_1109991113300012960SoilITPVTVVEDLHDAPPVEAAGIFPQSLWRHSHIRLTDEQFESARKLIEAAAK*
Ga0134076_1044714913300012976Grasslands SoilVTVVADLNRAPPVEAAGIFPQSLWRHSHIRLTEEQFESARKLIEAAAK*
Ga0157378_1034246133300013297Miscanthus RhizosphereVTVVTDLNRAPPVEAAGIFPQSLWRHSHIRLTEEQFESARKLIEAAAK*
Ga0134081_1027270923300014150Grasslands SoilWAWSYPIRAVAVVADLNDAPPVEAAGIFPQSLWRHSHIRLSEDQFESARKLIEAAAK*
Ga0134078_1023176713300014157Grasslands SoilTFPIRPVSVIADLHDAPPVEAAGIFPQSLWRHSHIRLTDEQFERARALIVAVSTRR*
Ga0134078_1039864723300014157Grasslands SoilRLVVRDLHEAPAAEEAGIFPSSLWRHSYVRLSPEQFEAARGLIAGIASS*
Ga0134079_1071383713300014166Grasslands SoilEAAGVFPQSLWRHSHIRLAPEQFARARALIESAAAQ*
Ga0120193_1003288023300014965TerrestrialHDAPRVEAAGVFPRSIWRHSHIRLTEEEFARARELIEAAA*
Ga0173483_1079065423300015077SoilVRDLHEAPAVEEIGVWPQSLWRHSHIRLTEEQFAAGRTAIEARR*
Ga0132257_10427811933300015373Arabidopsis RhizosphereDLHDAPPVEAAGIFPQSIWRHSHIRLTPEQFETARALIESAAGL*
Ga0066662_1121558323300018468Grasslands SoilWRFPIRPTLVVSDLHDAPPVESAGIFPQSLWRHSHIRLTDEQFDTARTLIDAVGSAA
Ga0222623_1004311443300022694Groundwater SedimentDLNRAPPVEAAGIFPQSLWRHSHIRLTEEQFESARKLIEAAAK
Ga0222622_1084947113300022756Groundwater SedimentFAIRPLVLVRDLHDAPPVEAAGIFPQSLWRHSHIRLTPGQFATARALIEAAAG
Ga0207684_1031447813300025910Corn, Switchgrass And Miscanthus RhizosphereLNDAPPVEAAGVFPQSLWRHSHIRLTEEQFESARKLIEAAAK
Ga0207684_1139338323300025910Corn, Switchgrass And Miscanthus RhizosphereIRSVTVVTDLNRAPPVEAAGIFPQSLWRHSHIRLTEEQFESARELIEAAAK
Ga0207684_1155224623300025910Corn, Switchgrass And Miscanthus RhizosphereVEEAGIFPQSLWRHSYIRLSEEQFAAARGLVEAAAE
Ga0207660_1115782623300025917Corn RhizosphereFAIRPLVAVADLHDAPPVEAAGIFPQSIWRHSHIRLSEEQFTEACRLIEDAA
Ga0207646_1135498313300025922Corn, Switchgrass And Miscanthus RhizosphereVEAAGIFPQSLWRHSHIRLTEEQFESARKLIEVAA
Ga0207709_1120179713300025935Miscanthus RhizosphereYQIRSVTVVTDLNRAPPVEAAGIFPQSLWRHSHIRLTEEQFESARKLIEAAAK
Ga0207704_1146374313300025938Miscanthus RhizosphereVVTDLNRAPPVEAAGIFPQSPWRHSHIRLTEEQFESARKLIEAAAK
Ga0207703_1208271123300026035Switchgrass RhizosphereVGDLHDAPPVEAAGIFPQSLWRHSHIRLTAEQFDSARTLIESVAG
Ga0209474_1042873813300026550SoilPLAVVSDLHDAPPVEAAGVFPQSLWRHSHIQLTEEQFAAARALVEASA
Ga0307295_1023879413300028708SoilWRFPIRPLTLVGDLHDAPPVEAAGVFPQTIWRHSHIRLSEEQFAEACRLIEEAA
Ga0307307_1009096823300028718SoilVIVSDLDDAPPVEAAGIFPQSLWRHSHIRLTEEQFESARRLIEAAAKVLARSRA
Ga0307316_1020447013300028755SoilSWRFPIRPMTLVGDLHDAPPVEAAGVFPQSIWRHSHIRLSEQQFAEACSLIEAAA
Ga0307280_1033615213300028768SoilPIRSVTVVTDLNRAPPVEAAGIFPQSLWRHSHIRLTEEQFESARKLIEAAAK
Ga0307306_1026341113300028782SoilIRPLVVVRDLDAAPPVEAAGIFPQSLWRHSYIRLGREQFETARSLIEGAAG
Ga0307289_1016241913300028875SoilPLVLVRDLHDAPPVEAAGIFPQSLWRHSHIRLTPGQFATARALIEAAAG
Ga0307300_1004279733300028880SoilVVDLHDAPAAEEAGIFPQSLWRHSHIRLTNEQFDAARRLIEEAART
Ga0307304_1056052313300028885SoilSPVEAAGIYPQSLWRHSHIRLSAEQFEAARELIEAAA
Ga0247827_1129391913300028889SoilAWSYPIRAVTVVTDLNRAPPVEAAGIFPQSLWRHSHIRLTEEQFESARKLIEAAAK
Ga0247826_1174631523300030336SoilPLVVVPDLDRAPAVEEAGIFPQSLWRHSYIRLTDAQFANARALVEAAGQRL
Ga0310887_1014228213300031547SoilIVADLNDAPPVEAAGVFPQSLWRHSHIRLTEEQFESGRKLIEAAAK
Ga0307408_10122747713300031548RhizosphereRDLHDAPPVEAAGIFPQSLWRHSHIRLTPEQFGVARGLVEDASA
Ga0310886_1047379413300031562SoilFPIRPLAVVRDLHDAPPVEAAGVFPQSLWRHSHIRLTEEQFKSARKLIEAAAK
Ga0307468_10163221423300031740Hardwood Forest SoilVEAAGVLPQSLWRHSHIRLTEEQFESARNLIEAAAK
Ga0310904_1038721623300031854SoilPVTTVADLNDAPPVEAAGVFPQSLWRHSHIRLTEEQFESARKLIEAAAK
Ga0318551_1076246523300031896SoilLVLVRDLDHAPPVEAAGIFPQSLWRHSYIRLTDEQFAAARALVERAAR
Ga0307407_1109108913300031903RhizosphereVVDLDDAPPVEEAGIFPQSLWRHSHIRLTPEQFTSARALIEAVA
Ga0308176_1138451213300031996SoilPLAAVRDLHDAPPVEAADIFPQSLWRHSHIRLTREQFQTARALIESASEPARTRH
Ga0307415_10196106513300032126RhizosphereIRPLAAVRDLHDAPPAEAAGIFPQSLWRHSHIRLTPEQFVVARGLVEDASA
Ga0310889_1068127523300032179SoilIRPVRIVADLNDAPPVEAAGVFPQSLWRHSHIRLTEEQFESGRKLIEAAAK
Ga0247830_1041226813300033551SoilAPPVEAAGIFPQSLWRHSHIRLSEEQFAEASRLIEEAVAV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.