Basic Information | |
---|---|
Family ID | F067024 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 126 |
Average Sequence Length | 41 residues |
Representative Sequence | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKV |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 126 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.21 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.06 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (53.175 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.460 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.365 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.762 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 126 Family Scaffolds |
---|---|---|
PF02881 | SRP54_N | 3.97 |
PF13620 | CarboxypepD_reg | 1.59 |
PF00873 | ACR_tran | 0.79 |
PF04357 | TamB | 0.79 |
PF13602 | ADH_zinc_N_2 | 0.79 |
PF00535 | Glycos_transf_2 | 0.79 |
PF00486 | Trans_reg_C | 0.79 |
PF13087 | AAA_12 | 0.79 |
PF05050 | Methyltransf_21 | 0.79 |
PF01609 | DDE_Tnp_1 | 0.79 |
PF13604 | AAA_30 | 0.79 |
PF01909 | NTP_transf_2 | 0.79 |
PF13517 | FG-GAP_3 | 0.79 |
PF05167 | DUF711 | 0.79 |
PF01261 | AP_endonuc_2 | 0.79 |
PF02517 | Rce1-like | 0.79 |
PF00210 | Ferritin | 0.79 |
PF13599 | Pentapeptide_4 | 0.79 |
PF08241 | Methyltransf_11 | 0.79 |
PF07593 | UnbV_ASPIC | 0.79 |
PF00376 | MerR | 0.79 |
PF00083 | Sugar_tr | 0.79 |
COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
---|---|---|---|
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
COG2848 | Uncharacterized conserved protein, UPF0210 family | Cell cycle control, cell division, chromosome partitioning [D] | 0.79 |
COG2911 | Phospholipid transport to the outer membrane protein TamB | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.79 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.79 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.79 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.79 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.79 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.79 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 53.17 % |
Unclassified | root | N/A | 46.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001172|JGI12681J13546_1008106 | Not Available | 579 | Open in IMG/M |
3300001661|JGI12053J15887_10188796 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300003372|JGI26336J50218_1009518 | Not Available | 666 | Open in IMG/M |
3300004082|Ga0062384_101148110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium callanderi | 562 | Open in IMG/M |
3300005467|Ga0070706_101448827 | Not Available | 628 | Open in IMG/M |
3300005537|Ga0070730_10714429 | Not Available | 634 | Open in IMG/M |
3300005554|Ga0066661_10858514 | Not Available | 531 | Open in IMG/M |
3300005566|Ga0066693_10418261 | Not Available | 546 | Open in IMG/M |
3300006041|Ga0075023_100132635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
3300006050|Ga0075028_100708097 | Not Available | 607 | Open in IMG/M |
3300006173|Ga0070716_101672099 | Not Available | 524 | Open in IMG/M |
3300006174|Ga0075014_100753475 | Not Available | 571 | Open in IMG/M |
3300006914|Ga0075436_100750904 | Not Available | 724 | Open in IMG/M |
3300009012|Ga0066710_103056121 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300009088|Ga0099830_11339653 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300009089|Ga0099828_10036660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3993 | Open in IMG/M |
3300009137|Ga0066709_101905006 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300009649|Ga0105855_1164415 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300009662|Ga0105856_1354499 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300010358|Ga0126370_11774218 | Not Available | 596 | Open in IMG/M |
3300010359|Ga0126376_12084963 | Not Available | 610 | Open in IMG/M |
3300010360|Ga0126372_10667836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1009 | Open in IMG/M |
3300010360|Ga0126372_10914195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300010360|Ga0126372_12296322 | Not Available | 589 | Open in IMG/M |
3300010361|Ga0126378_10727377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
3300010366|Ga0126379_10842323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
3300010376|Ga0126381_101245443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
3300010376|Ga0126381_101368253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
3300010376|Ga0126381_104960601 | Not Available | 511 | Open in IMG/M |
3300010398|Ga0126383_11715104 | Not Available | 717 | Open in IMG/M |
3300011269|Ga0137392_10260883 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300011269|Ga0137392_11253049 | Not Available | 600 | Open in IMG/M |
3300011270|Ga0137391_10941951 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300012203|Ga0137399_10290679 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
3300012205|Ga0137362_10923267 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300012362|Ga0137361_10594982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
3300012925|Ga0137419_10593199 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300012929|Ga0137404_11495928 | Not Available | 625 | Open in IMG/M |
3300014154|Ga0134075_10375099 | Not Available | 626 | Open in IMG/M |
3300015078|Ga0167660_1012494 | Not Available | 933 | Open in IMG/M |
3300015264|Ga0137403_10017092 | All Organisms → cellular organisms → Bacteria | 7834 | Open in IMG/M |
3300015264|Ga0137403_10164818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2172 | Open in IMG/M |
3300015373|Ga0132257_100630815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1327 | Open in IMG/M |
3300016270|Ga0182036_10315261 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300016270|Ga0182036_11289733 | Not Available | 609 | Open in IMG/M |
3300016357|Ga0182032_10831612 | Not Available | 782 | Open in IMG/M |
3300016445|Ga0182038_10362360 | Not Available | 1204 | Open in IMG/M |
3300016445|Ga0182038_10828343 | Not Available | 812 | Open in IMG/M |
3300017822|Ga0187802_10246299 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300017934|Ga0187803_10190919 | Not Available | 807 | Open in IMG/M |
3300017942|Ga0187808_10035592 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
3300017946|Ga0187879_10780544 | Not Available | 533 | Open in IMG/M |
3300017955|Ga0187817_10097522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1848 | Open in IMG/M |
3300017955|Ga0187817_11103912 | Not Available | 509 | Open in IMG/M |
3300017970|Ga0187783_10451886 | Not Available | 932 | Open in IMG/M |
3300017998|Ga0187870_1138328 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300018012|Ga0187810_10037565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1796 | Open in IMG/M |
3300018012|Ga0187810_10260892 | Not Available | 712 | Open in IMG/M |
3300018037|Ga0187883_10190340 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300018090|Ga0187770_10336237 | Not Available | 1179 | Open in IMG/M |
3300018431|Ga0066655_11343020 | Not Available | 515 | Open in IMG/M |
3300018468|Ga0066662_11083219 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300020581|Ga0210399_11079407 | Not Available | 643 | Open in IMG/M |
3300021178|Ga0210408_10291663 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
3300021180|Ga0210396_10574900 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300021420|Ga0210394_10211903 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1691 | Open in IMG/M |
3300021474|Ga0210390_11164756 | Not Available | 624 | Open in IMG/M |
3300021479|Ga0210410_10004086 | All Organisms → cellular organisms → Bacteria | 12832 | Open in IMG/M |
3300021479|Ga0210410_10010052 | All Organisms → cellular organisms → Bacteria | 8166 | Open in IMG/M |
3300022507|Ga0222729_1058315 | Not Available | 548 | Open in IMG/M |
3300024323|Ga0247666_1022645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1339 | Open in IMG/M |
3300024330|Ga0137417_1175998 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300025494|Ga0207928_1104193 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300026490|Ga0257153_1111676 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300026528|Ga0209378_1165558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300026529|Ga0209806_1306320 | Not Available | 533 | Open in IMG/M |
3300026557|Ga0179587_11152211 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300026959|Ga0207852_1002787 | All Organisms → cellular organisms → Bacteria | 2080 | Open in IMG/M |
3300027042|Ga0207766_1023025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5 | 702 | Open in IMG/M |
3300027567|Ga0209115_1160082 | Not Available | 502 | Open in IMG/M |
3300027604|Ga0208324_1169189 | Not Available | 589 | Open in IMG/M |
3300027703|Ga0207862_1128018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
3300027727|Ga0209328_10174148 | Not Available | 652 | Open in IMG/M |
3300027737|Ga0209038_10242541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
3300027795|Ga0209139_10089650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1081 | Open in IMG/M |
3300027846|Ga0209180_10101493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1640 | Open in IMG/M |
3300027853|Ga0209274_10621225 | Not Available | 559 | Open in IMG/M |
3300027867|Ga0209167_10432817 | Not Available | 718 | Open in IMG/M |
3300027874|Ga0209465_10289587 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300027874|Ga0209465_10497414 | Not Available | 609 | Open in IMG/M |
3300027908|Ga0209006_11308723 | Not Available | 560 | Open in IMG/M |
3300028776|Ga0302303_10189580 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300028871|Ga0302230_10437753 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300028906|Ga0308309_10608992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
3300028906|Ga0308309_11904655 | Not Available | 501 | Open in IMG/M |
3300029636|Ga0222749_10466095 | Not Available | 679 | Open in IMG/M |
3300030677|Ga0302317_10415098 | Not Available | 592 | Open in IMG/M |
3300030737|Ga0302310_10368296 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300031231|Ga0170824_119986383 | Not Available | 843 | Open in IMG/M |
3300031234|Ga0302325_12936387 | Not Available | 554 | Open in IMG/M |
3300031446|Ga0170820_14811026 | Not Available | 526 | Open in IMG/M |
3300031668|Ga0318542_10465229 | Not Available | 656 | Open in IMG/M |
3300031708|Ga0310686_109203899 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300031720|Ga0307469_11425346 | Not Available | 661 | Open in IMG/M |
3300031720|Ga0307469_12166540 | Not Available | 541 | Open in IMG/M |
3300031763|Ga0318537_10373310 | Not Available | 526 | Open in IMG/M |
3300031764|Ga0318535_10021481 | All Organisms → cellular organisms → Bacteria | 2491 | Open in IMG/M |
3300031770|Ga0318521_10697416 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300031771|Ga0318546_10661623 | Not Available | 735 | Open in IMG/M |
3300031890|Ga0306925_10754270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
3300031890|Ga0306925_11398758 | Not Available | 690 | Open in IMG/M |
3300031910|Ga0306923_10753605 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300031946|Ga0310910_10657232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
3300031946|Ga0310910_10944086 | Not Available | 675 | Open in IMG/M |
3300031962|Ga0307479_10173410 | All Organisms → cellular organisms → Bacteria | 2120 | Open in IMG/M |
3300032051|Ga0318532_10181221 | Not Available | 748 | Open in IMG/M |
3300032063|Ga0318504_10108313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
3300032076|Ga0306924_10894190 | Not Available | 983 | Open in IMG/M |
3300032091|Ga0318577_10344128 | Not Available | 713 | Open in IMG/M |
3300032180|Ga0307471_103303561 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300032205|Ga0307472_100926981 | Not Available | 809 | Open in IMG/M |
3300032261|Ga0306920_102603518 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300032783|Ga0335079_10006671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13206 | Open in IMG/M |
3300032954|Ga0335083_10261609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas → Desulfuromonas soudanensis | 1541 | Open in IMG/M |
3300033290|Ga0318519_10867943 | Not Available | 557 | Open in IMG/M |
3300033805|Ga0314864_0053843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.46% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.97% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.97% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.97% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.17% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.38% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.38% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.59% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.59% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.59% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.79% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.79% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001172 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300003372 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015078 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12681J13546_10081062 | 3300001172 | Forest Soil | MKTWQKVSIGVGAVVVLGSIAWYSVYQANKGVVQVQTGK |
JGI12053J15887_101887961 | 3300001661 | Forest Soil | MKTWHKVTIGIGGAIVLGGIVLFGINQANKGVVTVQTA |
JGI26336J50218_10095181 | 3300003372 | Bog Forest Soil | MKTWKKVLIAVVAVLVLVGIVTFSVNQANKGVVTVQTAKVAAQETLVSQVT |
Ga0062384_1011481101 | 3300004082 | Bog Forest Soil | VKGNRMKTWKKVLIALAVVVVGGVIVMVSINQANKGVVTVQTVK |
Ga0070706_1014488272 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQ |
Ga0070730_107144291 | 3300005537 | Surface Soil | MKTWKKVVIGVVVAGVLIGIVLFSVHQANKGVVTVQ |
Ga0066661_108585141 | 3300005554 | Soil | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVGKQDTL |
Ga0066693_104182611 | 3300005566 | Soil | MKTWQKVAIGAAVVAVGAGIVLYSVNQANKGVTTVQTAKVA |
Ga0075023_1001326352 | 3300006041 | Watersheds | MKVWKKLAIGVGVVVVAGGIVLYSVKQANKDVVTVQSGKVSLEPLVTI |
Ga0075028_1007080971 | 3300006050 | Watersheds | MKAWKKLAIGVGVVVVAGGIVLYSVKQANKDVVTVQSAKVGLEPLVTIVTSSG |
Ga0070716_1016720992 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKMWQKVAIGATVVVVGAGIVLYSVNQANKGVVTVQTARVAK |
Ga0075014_1007534752 | 3300006174 | Watersheds | MKTWQKVGLGLGVAALLGGVVWFSINQANKGVVVVQTAKVAK |
Ga0075436_1007509041 | 3300006914 | Populus Rhizosphere | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQDTL |
Ga0066710_1030561211 | 3300009012 | Grasslands Soil | MKMWHKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAQ |
Ga0099830_113396532 | 3300009088 | Vadose Zone Soil | MKTWQKVAIGVGAAVGLGGIVLFSVNQANKGVVTV |
Ga0099828_100366601 | 3300009089 | Vadose Zone Soil | MKMWQKVAIGATVVVVGAGIVLYSVNQANKGVVTVQTARVAKQDTLL |
Ga0066709_1019050061 | 3300009137 | Grasslands Soil | MKMWHKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQDTLVS |
Ga0105855_11644152 | 3300009649 | Permafrost Soil | MKTWQKVTIGVGGVVVLGGIVLFSINQANKGVTTVQTA |
Ga0105856_13544991 | 3300009662 | Permafrost Soil | MKTWQKVGIGVGTVAVLGGIVLFSVNQANKGVVTVQ |
Ga0126370_117742181 | 3300010358 | Tropical Forest Soil | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKV |
Ga0126376_120849631 | 3300010359 | Tropical Forest Soil | MKMWQKVTIGAAVVVVGAGIVLYSVNQANKGLTTVQTAKV |
Ga0126372_106678361 | 3300010360 | Tropical Forest Soil | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQDSLVSLVTA |
Ga0126372_109141951 | 3300010360 | Tropical Forest Soil | MKMWQKVAIGAAVVVVGAGIVIYSVNQANKGVTTVQTAKV |
Ga0126372_122963221 | 3300010360 | Tropical Forest Soil | MKTWQKVGSGFAAAAVVGGIVWFSVNQANKGVVTVQTAKV |
Ga0126378_107273771 | 3300010361 | Tropical Forest Soil | MKTWHKVTIGAGVVLVLGGIVLFSVNQANKGVVAVQTAKVT |
Ga0126379_108423232 | 3300010366 | Tropical Forest Soil | MKTWQKIGIGVGAAALLGAVVWFSINQANKGIVTVQTAKV |
Ga0126381_1012454433 | 3300010376 | Tropical Forest Soil | MKRWPKAAIAIGGAATLGGVVWFSVYQANKGLVTVQTAKVAKMETLVSQVT |
Ga0126381_1013682533 | 3300010376 | Tropical Forest Soil | MKRWQKAAIAIGGAATLGGVVWFSVYQANKGLVTVQTAKVAKMETLVSQVT |
Ga0126381_1049606011 | 3300010376 | Tropical Forest Soil | MKTWQKVAVGVAVAVVGAGIVLYSVNQANKGVTTVQTAKVAKQDTLVSLVTA |
Ga0126383_117151042 | 3300010398 | Tropical Forest Soil | MKTWQKVGSGLAAAAVVGGIVWFSVNQANKGVVTVQT |
Ga0137392_102608832 | 3300011269 | Vadose Zone Soil | MKTWQKVGIGLGGVAVLGGIVWFSINQANKGVVTVQTAK |
Ga0137392_112530491 | 3300011269 | Vadose Zone Soil | MKMWQKVAIGATVVVVGAGIVLYSVNQANKGVVTVQTARVAKQDTLISL |
Ga0137391_109419511 | 3300011270 | Vadose Zone Soil | MKTWQKVGIGVGAVVLLGGVMLFSVNQANKGVVTVQTAK |
Ga0137399_102906792 | 3300012203 | Vadose Zone Soil | MRTWHKVTIGAGGSALLGGIVWFTVHQANKGVVTVQ |
Ga0137362_109232671 | 3300012205 | Vadose Zone Soil | MKTWHKVAIGAGAVVVLGGIVLFSVNQAHKGVVTV |
Ga0137361_105949821 | 3300012362 | Vadose Zone Soil | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVITVQTAKVAKQD |
Ga0137419_105931992 | 3300012925 | Vadose Zone Soil | MKTWQKVGIGLGGVAVLGGIVWFSINQANKGVVTV |
Ga0137404_114959281 | 3300012929 | Vadose Zone Soil | MKTWQKVCIGGGVAVAIAGIVGYSITAANKGVVTVQTAK |
Ga0134075_103750991 | 3300014154 | Grasslands Soil | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVGKQDTLVSLVT |
Ga0167660_10124943 | 3300015078 | Glacier Forefield Soil | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVA |
Ga0137403_100170925 | 3300015264 | Vadose Zone Soil | MKTWQKVCIGGGVAVAIAGIVGYSITAANKGVVTVQTAKVAKQDTLVSIVT |
Ga0137403_101648182 | 3300015264 | Vadose Zone Soil | MKTWQKVCIGGGVAVVILGIVGYSITAANKGVVTVQTAKVAKQDTLVSIVT |
Ga0132257_1006308151 | 3300015373 | Arabidopsis Rhizosphere | MKMWHKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVVKQDT |
Ga0182036_103152613 | 3300016270 | Soil | MKTWHKVAIGLGGAAVLGGIIWFSINQANKGVVTVQTA |
Ga0182036_112897332 | 3300016270 | Soil | MKMWQKVAIGAAVVVVGAGIVLYSVSQATKGVTTVQTAKVAKQD |
Ga0182032_108316121 | 3300016357 | Soil | MKMWQKVAIGAAVVVVGAGIVLYSVSQATKGVTTVQTAKVAKQDTLVSLV |
Ga0182038_103623602 | 3300016445 | Soil | MKTWHKVGIGLGGALVLGGIVIFSINQANKGVVTV |
Ga0182038_108283432 | 3300016445 | Soil | MKMWQKVAIGAAVVVVGTGIILYSINQANKGVITVQTAKVAKQDSLISLVTA |
Ga0187802_102462991 | 3300017822 | Freshwater Sediment | MKTWHKIAIGLGGAVLVGGIVWFSINQANKGVVTV |
Ga0187803_101909191 | 3300017934 | Freshwater Sediment | MKVWKKVAIGVGVVLAGGGIVAYSVNQANKDVVTVQTAKVGHEHL |
Ga0187808_100355921 | 3300017942 | Freshwater Sediment | MAMKTWHKVAIGAGAVAVLGGIVLFSVNQASKGVV |
Ga0187879_107805441 | 3300017946 | Peatland | MKPWKRIAIGVAAVVVLGAITWVSVYQANKGVMTVQTGFAKRED |
Ga0187817_100975222 | 3300017955 | Freshwater Sediment | MKTWHKILIAVGGTALVGGIVWFSINQANKGVVTVQTAKVV |
Ga0187817_111039121 | 3300017955 | Freshwater Sediment | MVERNSMKTWQKVGIGVGAAVVLGGIVWFSINQANK |
Ga0187783_104518862 | 3300017970 | Tropical Peatland | MKVWQKVGIGVGVAVILVGIVWFSVNQANKGVVTVQTA |
Ga0187870_11383283 | 3300017998 | Peatland | MKTWHKVGIGLAGAAVLGGIVWFSINQANKGVVTV |
Ga0187810_100375651 | 3300018012 | Freshwater Sediment | MKTWHKVTIGVGGAALLGGIVWFGVNQARKGVVTVQTAKVAT |
Ga0187810_102608921 | 3300018012 | Freshwater Sediment | MKTWQKVAIGLGGAALVGGIVWVSINQANKGVVTVQTAK |
Ga0187883_101903401 | 3300018037 | Peatland | MKTWQKVGIGVGAAIALGLIVWFSINQANKGVVTVQTSKVAK |
Ga0187770_103362372 | 3300018090 | Tropical Peatland | MKTWQKVGIGAGVVAVLGGLVLFSVYQVNKGVETVQSGQ |
Ga0066655_113430201 | 3300018431 | Grasslands Soil | MKMWHKRAIGAGGVVVAGGIVLFSVKQANKGVVTVQA |
Ga0066662_110832191 | 3300018468 | Grasslands Soil | MKTWHKVLIGAGALVVLGGIVLFSVNQANKGVVTV |
Ga0210399_110794072 | 3300020581 | Soil | MKTWQKIGIGVAGVLALGGIVWYSVNQANKGVVTVQ |
Ga0210408_102916631 | 3300021178 | Soil | MKTWQKVGIGVGAVAVLGGIVLFSVNQANKGVVTV |
Ga0210396_105749001 | 3300021180 | Soil | MKTWQKVGIGLGGVAVLGGIVWFSINQANKGVVTVQT |
Ga0210394_102119032 | 3300021420 | Soil | MKTWQKAGIVVAGVLCLGGIVWYSVNQASKGVVTV |
Ga0210390_111647561 | 3300021474 | Soil | MKTWQKVGIGVGAVVVLGAIVGISVNQANKGVVTVQ |
Ga0210410_1000408611 | 3300021479 | Soil | MKTWQKVGTGLGGVVVLGGIVLFSINQANKGVVTVQTA |
Ga0210410_100100521 | 3300021479 | Soil | MKTWQKVGMGLGGVAVLGGIVWFSINQANKGVVTVQTAK |
Ga0222729_10583152 | 3300022507 | Soil | MKTWHKVAIGVGAVVVLGGIVLFSVNEANKGVETVQTAKVATQD |
Ga0247666_10226452 | 3300024323 | Soil | MKMWHKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQ |
Ga0137417_11759981 | 3300024330 | Vadose Zone Soil | MKTWHKVAIGAGAVVVLGGIVLFSVNQANKGVVTTVQTAK |
Ga0207928_11041931 | 3300025494 | Arctic Peat Soil | MKTWQKVTIGVGGVVVLGGIVLFSINQANKGVTTVQTAKVASQDALISQVTASGE |
Ga0257153_11116761 | 3300026490 | Soil | MKMWQKVATGATVVVVGTGIVLYSVNQANKGVITVQTAKVAKQDSLVSLVTASGEIKPTT |
Ga0209378_11655582 | 3300026528 | Soil | MKTWQKVCIGGGVAVAIAGIVGYSITAANKGVVTVQTAKVAKQD |
Ga0209806_13063201 | 3300026529 | Soil | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVG |
Ga0179587_111522111 | 3300026557 | Vadose Zone Soil | MKTWQKVGIAVAVVVVGAGIVLYSVNQANKGVITVQTAKVGKQDRLVSLVTASGEIKPTT |
Ga0207852_10027871 | 3300026959 | Tropical Forest Soil | MKTWQKVGIGLAAAAVVGGIVWFSVNQANKGVVTV |
Ga0207766_10230252 | 3300027042 | Tropical Forest Soil | MKTWQKVGIGLAAAAVVGGIVWFSVNQANKGVVTVQ |
Ga0209115_11600821 | 3300027567 | Forest Soil | MKTWQKVLIAVAVVAVLGGIVWYSVYQNNKGVVTVQTGH |
Ga0208324_11691891 | 3300027604 | Peatlands Soil | MKAWKKVTIGVGVVIVAGGIVLYSVKQANKDVVTVQSAK |
Ga0207862_11280182 | 3300027703 | Tropical Forest Soil | MKTWQKVLIGVGGAAILAGVVVVSINQANKGVITV |
Ga0209328_101741481 | 3300027727 | Forest Soil | MKTWKKVVIGLVILAALGGIVMYSVNLANKDVVTVQTAKV |
Ga0209038_102425411 | 3300027737 | Bog Forest Soil | MKTWQKVAIGVVAVVAIIGIVWFSVNLANKGVVTVQT |
Ga0209139_100896501 | 3300027795 | Bog Forest Soil | MKTWKKAVIGVVVAGVLIGIVVFSVNQANKGVVTVQ |
Ga0209180_101014931 | 3300027846 | Vadose Zone Soil | MKTWQKVAIGVGAAVGLGGIVLFSVNQANKGVITVQTAKVTPQETLVSQVTASG |
Ga0209274_106212251 | 3300027853 | Soil | MKTWKKVVIGLVVAGALIGIVVFSVNQANKGVVTVQTAKVVTSDDLVSL |
Ga0209167_104328173 | 3300027867 | Surface Soil | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQDSLVSL |
Ga0209465_102895872 | 3300027874 | Tropical Forest Soil | MKTWHKVAIGAGVVVVLGGIVLFSVNQANKGVVTV |
Ga0209465_104974141 | 3300027874 | Tropical Forest Soil | MKMWQKVAIGAAVVVVGAGIVMYSVTQANKGVTTVQTAKVAKQDTL |
Ga0209006_113087231 | 3300027908 | Forest Soil | MKTWQKVGIGVGAVVILGSISWYSIYQSNKGVVTVQSG |
Ga0302303_101895801 | 3300028776 | Palsa | MKTWQKVAIGLGAVVVLGGIVLFSINQANKDVMTVQTAKVSPQPSLVSQ |
Ga0302230_104377531 | 3300028871 | Palsa | MKTWQKVAIGLGAVVVLGGIVLFSINQANKDVMTVQTAK |
Ga0308309_106089921 | 3300028906 | Soil | MKTWKKVVIGLVAAGVLIGIVVFSVNQANKGVVTVQT |
Ga0308309_119046551 | 3300028906 | Soil | MKTWKKAVMGLVVAGVLIGIVVFSVNQANKGVVTVQ |
Ga0222749_104660951 | 3300029636 | Soil | MKTWKKVTIGLVVVAALGTIVWISVNAANKGVVTV |
Ga0302317_104150981 | 3300030677 | Palsa | MKTWQKVSIGVGAAVVLCSIAWYSVYQANKGVVQV |
Ga0302310_103682961 | 3300030737 | Palsa | MKTWQKVAIGLGAVVVLGGIVLFSINQANKDVMTVQTAKVSPQPSLVSQVTASG |
Ga0170824_1199863832 | 3300031231 | Forest Soil | MKTWQKVGIGLCGAAALGGLVWFSINKANQGVVTVQTAKVAK |
Ga0302325_129363871 | 3300031234 | Palsa | MKTWQKVSIGVGAVVVLGSIAWFSIYQANKGVVQVQT |
Ga0170820_148110261 | 3300031446 | Forest Soil | MKMWQKVAIGVAVVAVGAGIVLYSVNQANKGVTTVQTAKV |
Ga0318542_104652291 | 3300031668 | Soil | MKMWQKVAIGAAAVVVGAGIVLYSINQANKGVTTVQTAKVA |
Ga0310686_1092038991 | 3300031708 | Soil | MKTWQKVGIGAGVVLVLGGMAWFSAYQVNKGVVAVQ |
Ga0307469_114253461 | 3300031720 | Hardwood Forest Soil | MKMWQKVAIGAAVVVVGAGIVIYSVNQANKGVTTVQTAKVAKQDTL |
Ga0307469_121665401 | 3300031720 | Hardwood Forest Soil | MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQ |
Ga0318537_103733102 | 3300031763 | Soil | MKMWQKVAIGAAVVVVGAGIVLYSVSQATKGVTTVQTAKVAKQDTLIS |
Ga0318535_100214813 | 3300031764 | Soil | MKTWQKVGSGLAAAAVVGGIVWFSVNQANKGVVTVQTAKVA |
Ga0318521_106974163 | 3300031770 | Soil | MKTWHKVTIGAGVLVVLGGIVLFSVNQANKGVVAVQTAK |
Ga0318546_106616232 | 3300031771 | Soil | MKMWQKVAIGAAVAVVGAGIVLYSVNQASKGVTTV |
Ga0306925_107542702 | 3300031890 | Soil | MKTWHKVGMGLGVAAVLGGVVLYSINQANKGVVTVQTAK |
Ga0306925_113987581 | 3300031890 | Soil | MKMWQKVGSGLAAAAVVGGIVWFSVNQAHKGVVTVQTAKVAKQDS |
Ga0306923_107536052 | 3300031910 | Soil | MKMWQKVGSGLAAAAVVGGIVWFSVNQAHKGVVTVQTAKVAKQDSLISLVT |
Ga0310910_106572322 | 3300031946 | Soil | MKMWQKVAIGAAVVVVGAGIVLYSVSQATKGVTTVQTAKVAKQDTLVSLVT |
Ga0310910_109440861 | 3300031946 | Soil | MKTWHKVLIGIGAAAVVSGVVWYSINQANKGVVTVQTAKV |
Ga0307479_101734101 | 3300031962 | Hardwood Forest Soil | MKTWQKVLIGGAVVVVIGGVVMYSINAANKGVVTVQTAK |
Ga0318532_101812211 | 3300032051 | Soil | MKMWQKVAIGAAVVVVGAGIVLYSVSQATKGVTTVQ |
Ga0318504_101083132 | 3300032063 | Soil | MKMWQKVAIGAAVVVVAAGIVLYSVNQANKGVTTVQTAKVAKQDTLVS |
Ga0306924_108941901 | 3300032076 | Soil | MKMWQKVAIGAAVVVVGTGIILYSINQANKGVITVQTAKVAKQDSLI |
Ga0318577_103441281 | 3300032091 | Soil | MKTWQKVGSGLAAAAVVGGIVWFSVNQANKGVVTV |
Ga0307471_1033035611 | 3300032180 | Hardwood Forest Soil | MKTWQKVGIGVGGAVVLGGIVLFSVNQANKGVVTV |
Ga0307472_1009269811 | 3300032205 | Hardwood Forest Soil | MKTWQKVGIGVSAVVVLGGIVGYSVNKANKGVVTVQTAKVAPAETL |
Ga0306920_1026035181 | 3300032261 | Soil | MKTWHKVTIGAGVLVVLGGIVLFSVNQANKGVVAV |
Ga0335079_100066711 | 3300032783 | Soil | MKVWKKVTIGVGVVVLGGGIVLYSVNQANKDVVTVQTAKVGREH |
Ga0335083_102616092 | 3300032954 | Soil | MKTWQKVGIGIGVAALLAGLVVFSITQANKGVVTVQTAKVAKMDTLISQ |
Ga0318519_108679431 | 3300033290 | Soil | MKTWQKVGIGLAAAAVVGGIVWFSVNQANKGVVTVQTAKVA |
Ga0314864_0053843_810_920 | 3300033805 | Peatland | MKTWQKVAIGLGGAAAIAIIAGISINQANKGVVTVQT |
⦗Top⦘ |