Basic Information | |
---|---|
Family ID | F066707 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 126 |
Average Sequence Length | 45 residues |
Representative Sequence | MYWAIFVVGACLIVIALLAIYVPTIYIRKTNNVIHLLEQIAANTRK |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 126 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 81.75 % |
% of genes near scaffold ends (potentially truncated) | 21.43 % |
% of genes from short scaffolds (< 2000 bps) | 75.40 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (56.349 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (13.492 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.063 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.063 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 126 Family Scaffolds |
---|---|---|
PF07704 | PSK_trans_fac | 2.38 |
PF03279 | Lip_A_acyltrans | 2.38 |
PF01638 | HxlR | 2.38 |
PF05345 | He_PIG | 2.38 |
PF04892 | VanZ | 2.38 |
PF00072 | Response_reg | 1.59 |
PF05015 | HigB-like_toxin | 1.59 |
PF07589 | PEP-CTERM | 1.59 |
PF00797 | Acetyltransf_2 | 1.59 |
PF13358 | DDE_3 | 1.59 |
PF07690 | MFS_1 | 1.59 |
PF01844 | HNH | 1.59 |
PF00294 | PfkB | 0.79 |
PF00120 | Gln-synt_C | 0.79 |
PF00364 | Biotin_lipoyl | 0.79 |
PF00034 | Cytochrom_C | 0.79 |
PF13462 | Thioredoxin_4 | 0.79 |
PF00491 | Arginase | 0.79 |
PF13579 | Glyco_trans_4_4 | 0.79 |
PF13387 | DUF4105 | 0.79 |
PF07238 | PilZ | 0.79 |
PF02742 | Fe_dep_repr_C | 0.79 |
PF03739 | LptF_LptG | 0.79 |
PF12779 | WXXGXW | 0.79 |
PF01471 | PG_binding_1 | 0.79 |
PF00589 | Phage_integrase | 0.79 |
PF13744 | HTH_37 | 0.79 |
PF04173 | DoxD | 0.79 |
PF13742 | tRNA_anti_2 | 0.79 |
PF01325 | Fe_dep_repress | 0.79 |
PF00313 | CSD | 0.79 |
PF01551 | Peptidase_M23 | 0.79 |
PF02590 | SPOUT_MTase | 0.79 |
PF02321 | OEP | 0.79 |
PF03030 | H_PPase | 0.79 |
PF12762 | DDE_Tnp_IS1595 | 0.79 |
PF03602 | Cons_hypoth95 | 0.79 |
PF00753 | Lactamase_B | 0.79 |
PF02746 | MR_MLE_N | 0.79 |
PF13676 | TIR_2 | 0.79 |
PF00291 | PALP | 0.79 |
PF00950 | ABC-3 | 0.79 |
PF12833 | HTH_18 | 0.79 |
PF11999 | Ice_binding | 0.79 |
PF12225 | DUF5981 | 0.79 |
COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
---|---|---|---|
COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 2.38 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.38 |
COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 2.38 |
COG4423 | Uncharacterized conserved protein | Function unknown [S] | 2.38 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.59 |
COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.59 |
COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 1.59 |
COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.59 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.79 |
COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.79 |
COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.79 |
COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.79 |
COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.79 |
COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 0.79 |
COG1576 | 23S rRNA pseudoU1915 N3-methylase RlmH | Translation, ribosomal structure and biogenesis [J] | 0.79 |
COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.79 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.79 |
COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.79 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.79 |
COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.79 |
COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 56.35 % |
Unclassified | root | N/A | 43.65 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918008|ConsensusfromContig261453 | Not Available | 645 | Open in IMG/M |
3300002908|JGI25382J43887_10018418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3687 | Open in IMG/M |
3300002961|JGI11641J44799_10137566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 684 | Open in IMG/M |
3300003218|JGI26339J46600_10033718 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300003219|JGI26341J46601_10026172 | Not Available | 1905 | Open in IMG/M |
3300003219|JGI26341J46601_10074901 | Not Available | 1018 | Open in IMG/M |
3300003219|JGI26341J46601_10201049 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300003369|JGI24140J50213_10099401 | Not Available | 967 | Open in IMG/M |
3300004477|Ga0068971_1263206 | Not Available | 679 | Open in IMG/M |
3300004635|Ga0062388_100199874 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
3300004635|Ga0062388_101493393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 682 | Open in IMG/M |
3300004635|Ga0062388_101592481 | Not Available | 663 | Open in IMG/M |
3300005468|Ga0070707_101811229 | Not Available | 578 | Open in IMG/M |
3300006052|Ga0075029_100159426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1391 | Open in IMG/M |
3300006052|Ga0075029_100348883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 953 | Open in IMG/M |
3300006055|Ga0097691_1004587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8113 | Open in IMG/M |
3300006642|Ga0075521_10055755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1736 | Open in IMG/M |
3300008784|Ga0103637_1001061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
3300008787|Ga0103640_1002283 | Not Available | 582 | Open in IMG/M |
3300009029|Ga0066793_10166998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → Thiohalocapsa halophila | 1283 | Open in IMG/M |
3300009029|Ga0066793_10640853 | Not Available | 604 | Open in IMG/M |
3300009038|Ga0099829_10333634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
3300009616|Ga0116111_1001190 | All Organisms → cellular organisms → Bacteria | 18933 | Open in IMG/M |
3300009616|Ga0116111_1013919 | All Organisms → cellular organisms → Bacteria | 3097 | Open in IMG/M |
3300009628|Ga0116125_1149371 | Not Available | 647 | Open in IMG/M |
3300009641|Ga0116120_1022144 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
3300009644|Ga0116121_1069210 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300009644|Ga0116121_1086437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 981 | Open in IMG/M |
3300009644|Ga0116121_1137513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 770 | Open in IMG/M |
3300009644|Ga0116121_1160779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 710 | Open in IMG/M |
3300009644|Ga0116121_1236929 | Not Available | 583 | Open in IMG/M |
3300009645|Ga0116106_1286625 | Not Available | 524 | Open in IMG/M |
3300010339|Ga0074046_10008057 | All Organisms → cellular organisms → Bacteria | 8081 | Open in IMG/M |
3300010339|Ga0074046_10011285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6610 | Open in IMG/M |
3300010341|Ga0074045_10712190 | Not Available | 637 | Open in IMG/M |
3300010379|Ga0136449_100000003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 374583 | Open in IMG/M |
3300010379|Ga0136449_103832371 | Not Available | 565 | Open in IMG/M |
3300010379|Ga0136449_103873853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 561 | Open in IMG/M |
3300011269|Ga0137392_10848309 | Not Available | 753 | Open in IMG/M |
3300011270|Ga0137391_11205695 | Not Available | 604 | Open in IMG/M |
3300011271|Ga0137393_11325302 | Not Available | 609 | Open in IMG/M |
3300012096|Ga0137389_10438573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
3300014155|Ga0181524_10026096 | All Organisms → cellular organisms → Bacteria | 4139 | Open in IMG/M |
3300014159|Ga0181530_10546350 | Not Available | 572 | Open in IMG/M |
3300014162|Ga0181538_10541886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 610 | Open in IMG/M |
3300014164|Ga0181532_10074895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2160 | Open in IMG/M |
3300014164|Ga0181532_10227678 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300014322|Ga0075355_1007663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2089 | Open in IMG/M |
3300014492|Ga0182013_10400500 | Not Available | 737 | Open in IMG/M |
3300014501|Ga0182024_10216417 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
3300014501|Ga0182024_10778626 | Not Available | 1169 | Open in IMG/M |
3300014501|Ga0182024_10820417 | Not Available | 1131 | Open in IMG/M |
3300016404|Ga0182037_10633771 | Not Available | 910 | Open in IMG/M |
3300017823|Ga0187818_10208035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 854 | Open in IMG/M |
3300017931|Ga0187877_1181605 | Not Available | 832 | Open in IMG/M |
3300017935|Ga0187848_10065385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1715 | Open in IMG/M |
3300017940|Ga0187853_10443456 | Not Available | 571 | Open in IMG/M |
3300017941|Ga0187850_10198091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 921 | Open in IMG/M |
3300017941|Ga0187850_10438276 | Not Available | 568 | Open in IMG/M |
3300017946|Ga0187879_10059265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 2239 | Open in IMG/M |
3300017946|Ga0187879_10123445 | Not Available | 1475 | Open in IMG/M |
3300017946|Ga0187879_10142859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1357 | Open in IMG/M |
3300017946|Ga0187879_10242464 | Not Available | 1005 | Open in IMG/M |
3300017946|Ga0187879_10277131 | Not Available | 933 | Open in IMG/M |
3300017948|Ga0187847_10122860 | Not Available | 1424 | Open in IMG/M |
3300017948|Ga0187847_10271296 | Not Available | 926 | Open in IMG/M |
3300017970|Ga0187783_10068923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2605 | Open in IMG/M |
3300017972|Ga0187781_11252336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 546 | Open in IMG/M |
3300018003|Ga0187876_1000588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 36577 | Open in IMG/M |
3300018003|Ga0187876_1014900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3881 | Open in IMG/M |
3300018025|Ga0187885_10250596 | Not Available | 809 | Open in IMG/M |
3300018025|Ga0187885_10456869 | Not Available | 570 | Open in IMG/M |
3300018042|Ga0187871_10796345 | Not Available | 527 | Open in IMG/M |
3300018468|Ga0066662_10025619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3404 | Open in IMG/M |
3300020004|Ga0193755_1119481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
3300021475|Ga0210392_10323865 | Not Available | 1110 | Open in IMG/M |
3300025427|Ga0208077_1000046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10916 | Open in IMG/M |
3300025442|Ga0208034_1010597 | All Organisms → cellular organisms → Bacteria | 3104 | Open in IMG/M |
3300025484|Ga0208587_1000539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 20648 | Open in IMG/M |
3300025496|Ga0208191_1026548 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300025579|Ga0207927_1033666 | Not Available | 1439 | Open in IMG/M |
3300025650|Ga0209385_1156599 | Not Available | 670 | Open in IMG/M |
3300026273|Ga0209881_1047620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → Thiohalocapsa halophila | 1054 | Open in IMG/M |
3300027432|Ga0209421_1080769 | Not Available | 659 | Open in IMG/M |
3300027698|Ga0209446_1156241 | Not Available | 589 | Open in IMG/M |
3300027698|Ga0209446_1160072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 581 | Open in IMG/M |
3300027812|Ga0209656_10000845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 19820 | Open in IMG/M |
3300027812|Ga0209656_10065815 | Not Available | 1990 | Open in IMG/M |
3300027812|Ga0209656_10092017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1608 | Open in IMG/M |
3300027812|Ga0209656_10099887 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
3300027812|Ga0209656_10222637 | Not Available | 904 | Open in IMG/M |
3300027824|Ga0209040_10276497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
3300027846|Ga0209180_10044867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2425 | Open in IMG/M |
3300027869|Ga0209579_10027919 | All Organisms → cellular organisms → Bacteria | 3101 | Open in IMG/M |
3300027887|Ga0208980_10001823 | All Organisms → cellular organisms → Bacteria | 12938 | Open in IMG/M |
3300027902|Ga0209048_10003469 | All Organisms → cellular organisms → Bacteria | 15293 | Open in IMG/M |
3300027905|Ga0209415_10167141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium | 2162 | Open in IMG/M |
3300031057|Ga0170834_105765389 | Not Available | 683 | Open in IMG/M |
3300031234|Ga0302325_10086623 | All Organisms → cellular organisms → Bacteria | 5955 | Open in IMG/M |
3300031235|Ga0265330_10130492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 1070 | Open in IMG/M |
3300031236|Ga0302324_100655506 | Not Available | 1492 | Open in IMG/M |
3300031241|Ga0265325_10179862 | Not Available | 985 | Open in IMG/M |
3300031242|Ga0265329_10183863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 684 | Open in IMG/M |
3300031242|Ga0265329_10191779 | Not Available | 671 | Open in IMG/M |
3300031247|Ga0265340_10047146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 2100 | Open in IMG/M |
3300031344|Ga0265316_11145654 | Not Available | 539 | Open in IMG/M |
3300031708|Ga0310686_101615404 | Not Available | 645 | Open in IMG/M |
3300031708|Ga0310686_102481902 | Not Available | 722 | Open in IMG/M |
3300031720|Ga0307469_10262672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1398 | Open in IMG/M |
3300031912|Ga0306921_11679022 | Not Available | 687 | Open in IMG/M |
3300031942|Ga0310916_10909077 | Not Available | 738 | Open in IMG/M |
3300032160|Ga0311301_10010499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 29602 | Open in IMG/M |
3300032160|Ga0311301_11428700 | Not Available | 860 | Open in IMG/M |
3300032173|Ga0315268_10519855 | Not Available | 1175 | Open in IMG/M |
3300032205|Ga0307472_100381423 | Not Available | 1171 | Open in IMG/M |
3300032205|Ga0307472_101481060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300032770|Ga0335085_10544939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1316 | Open in IMG/M |
3300032829|Ga0335070_10258763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1702 | Open in IMG/M |
3300032829|Ga0335070_10621014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
3300032892|Ga0335081_10026067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9434 | Open in IMG/M |
3300032892|Ga0335081_10122487 | All Organisms → cellular organisms → Bacteria | 3796 | Open in IMG/M |
3300032893|Ga0335069_12056959 | Not Available | 601 | Open in IMG/M |
3300032893|Ga0335069_12702182 | Not Available | 510 | Open in IMG/M |
3300033513|Ga0316628_104060945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 522 | Open in IMG/M |
3300034125|Ga0370484_0138741 | Not Available | 649 | Open in IMG/M |
3300034163|Ga0370515_0082152 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.49% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 11.90% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 9.52% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.35% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.56% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.56% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 4.76% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.38% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.38% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.38% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.38% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.59% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.59% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.59% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.59% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.59% |
Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 1.59% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.79% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.79% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.79% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.79% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.79% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.79% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300008784 | Microbial communities from wetland soil in Czech Republic - M1_cDNA | Environmental | Open in IMG/M |
3300008787 | Microbial communities from wetland soil in Czech Republic - R3_cDNA | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Bog_all_C_02743860 | 2140918008 | Soil | MNWPILVLGACLVVVALLAIYVPTVYIRKTNVMIHLLEQIAANTRR |
JGI25382J43887_100184181 | 3300002908 | Grasslands Soil | MQWPFALVGACVVLVALLTAYLPTIYIRKTNKVIALLEQIAANTKK* |
JGI11641J44799_101375661 | 3300002961 | Wetland | MSSMALVGACVIVIALVAIYVPTVYIRKTNKVLKVLEQIEANTRK* |
JGI26339J46600_100337183 | 3300003218 | Bog Forest Soil | MYWPTLVFGFCLIVIALLAVYVPTLYIRKTNAVIKLLEQIAANTRK* |
JGI26341J46601_100261721 | 3300003219 | Bog Forest Soil | MWAIALPIGSLLLIALLAIYVPTIYIRKTNKMIALLEQIAVNTRK* |
JGI26341J46601_100749012 | 3300003219 | Bog Forest Soil | MYLPSFVFGICLAVIAGLAIYVPTIYIRKTNATIKLLEQIAVNTGK* |
JGI26341J46601_102010491 | 3300003219 | Bog Forest Soil | MYLSSVVVGTCLVVIALLAIYVPTVYIRKTNVMIKLLEQIAANTRK* |
JGI24140J50213_100994011 | 3300003369 | Arctic Peat Soil | MIAFFVPVASLVLIAVLVLYVPTLYIRKTNKMIQLLEQIAANTRK* |
Ga0068971_12632062 | 3300004477 | Peatlands Soil | MYWATVVLGACVIVVAVLAIYVPTVYIRKTNVLIHLLEQIAANTRK* |
Ga0062388_1001998743 | 3300004635 | Bog Forest Soil | MYWSSFIPGACLLVIALMALYVPTVYIRKTNAMIKLLEEIAANTRK* |
Ga0062388_1014933932 | 3300004635 | Bog Forest Soil | MFGTTLVIGACVIVIALLAIYVPTIYIRKTNKLIDLLEQIAANTRK* |
Ga0062388_1015924811 | 3300004635 | Bog Forest Soil | MYWMSYLVGVCLVVIAVLAVYVPTVYIRKTNVMIHLLEQIAANTRK* |
Ga0070707_1018112291 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MWSFAMTGGALVLIALLAAYVPTIYIRKTNKMLRVLEQIASNTQH* |
Ga0075029_1001594263 | 3300006052 | Watersheds | MWAIAISVACLMMIALLAIYVPTIYIRKTNKMIQLLEQVAANTRK* |
Ga0075029_1003488832 | 3300006052 | Watersheds | MWAMSVPIACLVLIALLAIYVPTIYIRKTNKMIQLLEQIEANTRK* |
Ga0097691_10045878 | 3300006055 | Arctic Peat Soil | VCLILIALLAIYVPTIYIRKTNKMIHILEQIAANTRK* |
Ga0075521_100557552 | 3300006642 | Arctic Peat Soil | MYSLTFVFGACAVIIALMAIYVPTVYIRKTNVMIHLLEQIVANTRK* |
Ga0103637_10010611 | 3300008784 | Wetland Soil | MSVPIACLVLIALLAIYVPTIYIRKTNKVIDLLQQIAANSRK* |
Ga0103640_10022831 | 3300008787 | Wetland Soil | MYWPTFVLGVCVVVVAVLAIYVPTVYIRKTNVMIHLLEQIAANGHK* |
Ga0066793_101669982 | 3300009029 | Prmafrost Soil | MTSSILVLSASLVVIALLAIYVPTVYIRKTNVMIKLLEQIAANTRK* |
Ga0066793_106408532 | 3300009029 | Prmafrost Soil | MPILVLAACLVVIALLAIYVPTVYIRKTNVMIHLLEQIAANGRK* |
Ga0099829_103336342 | 3300009038 | Vadose Zone Soil | MQWPLALVGACVVLVALLTAYVPTIYIRKTNKVIALLEQIAANTKK* |
Ga0116111_10011904 | 3300009616 | Peatland | MYGSILVLGACLVVLALLAIYFPTVYIRKTNVMIHLLEQIAANGRK* |
Ga0116111_10139196 | 3300009616 | Peatland | MYGSILVLGACLVVIAALAIYVPTVYIRKTNAMIRLLEQIAANTRK* |
Ga0116125_11493711 | 3300009628 | Peatland | MMMYSAVLIPAACLIVIALLALYVPTIYIRKTNKVIHLLEEIAANARK* |
Ga0116120_10221443 | 3300009641 | Peatland | MIGGVMYGSILVLGACLVVLALLAIYFPTVYIRKTNVMIHLLEQIAANGRK* |
Ga0116121_10692102 | 3300009644 | Peatland | MFGYTFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQ |
Ga0116121_10864373 | 3300009644 | Peatland | FGYTFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIAANTRK* |
Ga0116121_11375131 | 3300009644 | Peatland | MFGYSFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEEIVANTRK* |
Ga0116121_11607792 | 3300009644 | Peatland | VVIAVLAIYVPTVYIRKTNVMIHLLEQIAANTRK* |
Ga0116121_12369291 | 3300009644 | Peatland | MVIALLAIYVPTIYIRKTNKMIALLEQIAANTRK* |
Ga0116106_12866251 | 3300009645 | Peatland | MFGYSFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEEIAANTRK* |
Ga0074046_100080573 | 3300010339 | Bog Forest Soil | MYWPTLVFGFCLIVLALLAIYFPTIYIRKTNKMIHLLEQIAANTSK* |
Ga0074046_100112854 | 3300010339 | Bog Forest Soil | MWAIALPIGSLLLIALLAIYVPTIYIRKTNKMIALLEQTAVNTRK* |
Ga0074045_107121902 | 3300010341 | Bog Forest Soil | MLIALLALYVPTIYIRKTNKVIKILEQIADNTRK* |
Ga0136449_10000000363 | 3300010379 | Peatlands Soil | MGWPFAVATGCLVLLALLAIYVPTIYVRKTNKMIQLLEQIAANTRK* |
Ga0136449_1038323711 | 3300010379 | Peatlands Soil | MYWASFVVGICVIVIAFLAIYFPTIYIRKTNKLLDLLEQIAANTRK* |
Ga0136449_1038738531 | 3300010379 | Peatlands Soil | SIVIVALLAIYVPTIYIRKTNKLMAILDKIEANTRK* |
Ga0137392_108483091 | 3300011269 | Vadose Zone Soil | MWSFALLGGCIILIALLAAYVPTIYIRKTNKILTALEQI |
Ga0137391_112056951 | 3300011270 | Vadose Zone Soil | MQWSLALVGACVVLVALLAAYVPTIYIRKTNKVIALLEQIAANTKK* |
Ga0137393_113253023 | 3300011271 | Vadose Zone Soil | MWSFALLGGCIILIALLAAYVPTIYIRKTNKILTALEQIAA |
Ga0137389_104385732 | 3300012096 | Vadose Zone Soil | MQWSFVLLGACVVLVALLAAYVPTIYIRKTNKVIALLEQIAANTKK* |
Ga0181524_100260965 | 3300014155 | Bog | MFGYSFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIAANTRK* |
Ga0181530_105463501 | 3300014159 | Bog | TSEASMFGYSFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIAANTRK* |
Ga0181538_105418861 | 3300014162 | Bog | MYGSIVVLGACVIVIALLAIYVPTIYIRKTNKMMHILEQIETNTRK* |
Ga0181532_100748954 | 3300014164 | Bog | FVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIAANTRK* |
Ga0181532_102276782 | 3300014164 | Bog | MFGYTFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIAANTR |
Ga0075355_10076632 | 3300014322 | Natural And Restored Wetlands | MLYWPSFVLGFCVIALALLAFYVPTIYIRKTNKLIHLLEEIAGNTRK* |
Ga0182013_104005001 | 3300014492 | Bog | MYFWPMFVAGTCLVIITVLAIYIPTIYIRKTNKLIDLLGQIATNTSK* |
Ga0182024_102164174 | 3300014501 | Permafrost | MTFTIQLVLACLIVIALLAIYVPTVYIRKTNAMIHLLEQIAANTRK* |
Ga0182024_107786261 | 3300014501 | Permafrost | MFLSIYLIGTSLIVMALLAIYVPTVYIRKTNVMIHLLEEIAASARK* |
Ga0182024_108204171 | 3300014501 | Permafrost | MYWPTFVLGMCVIVVALLAIYVPTVYIRKTNAMIRLLEQITANTRR* |
Ga0182037_106337712 | 3300016404 | Soil | MFYFPSLVSALCLLVIALMAIYVPAVYIRKTNAMIKLLQEMAANTRK |
Ga0187818_102080352 | 3300017823 | Freshwater Sediment | MMYWPSFVFGSCLIVIAVLAIYVPTIYIRKTNKVITLLEQIAANTRK |
Ga0187877_11816051 | 3300017931 | Peatland | MIGGVMYGSILVLGACLVVLALLAIYFPTVYIRKTNVMIHLLEQIAANGRK |
Ga0187848_100653852 | 3300017935 | Peatland | MFGYSFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIAANTRK |
Ga0187853_104434561 | 3300017940 | Peatland | MFGYSFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEEIAANTRK |
Ga0187850_101980911 | 3300017941 | Peatland | GYSFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIAANTRK |
Ga0187850_104382761 | 3300017941 | Peatland | MFGYSFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIA |
Ga0187879_100592655 | 3300017946 | Peatland | MFGYSFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIAANTR |
Ga0187879_101234451 | 3300017946 | Peatland | MMMYSAVLIPAACLIVIALLALYVPTIYIRKTNKVIHLLEEIAANARK |
Ga0187879_101428593 | 3300017946 | Peatland | FVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIAANTRK |
Ga0187879_102424643 | 3300017946 | Peatland | MFGYSFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEEIAANTR |
Ga0187879_102771312 | 3300017946 | Peatland | FVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEEIAANTRK |
Ga0187847_101228601 | 3300017948 | Peatland | MYGSVLVLCTCLMVIALLAIYVPTIYIRKTNKMIALLEQIAANTRK |
Ga0187847_102712961 | 3300017948 | Peatland | MFGYTFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIAANTRK |
Ga0187783_100689232 | 3300017970 | Tropical Peatland | MYWAIFVVGACLIVIALLAIYVPTIYIRKTNNVIHLLEQIAANTRK |
Ga0187781_112523362 | 3300017972 | Tropical Peatland | MYWAIFVVGSCLIVIALLTIYVPTVYIRKTNKVIQLLEQIAAN |
Ga0187876_10005883 | 3300018003 | Peatland | MYGSILVLGACLVVLALLAIYFPTVYIRKTNVMIHLLEQIAANGRK |
Ga0187876_10149003 | 3300018003 | Peatland | MYGYGAVVGACVVVIAALAVYVPTVYIRKTNTMIKLLEQIAANTRN |
Ga0187885_102505962 | 3300018025 | Peatland | MFGYSFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIAAN |
Ga0187885_104568692 | 3300018025 | Peatland | MFGYTFVIGVCLVVIAVLAIYVPTVYIRKTNVMIHLLEQIA |
Ga0187871_107963452 | 3300018042 | Peatland | CLVVIAVLAIYVPTVYIRKTNVMIHLLEEIAANTRK |
Ga0066662_100256195 | 3300018468 | Grasslands Soil | MQWPFALVGACVVLVALLTAYLPTIYIRKTNKVIALLEQIAANTKK |
Ga0193755_11194811 | 3300020004 | Soil | MAWTFALPVACLTLIALIAVYFPTLYIRKTNKMLSLLEQIAANTRK |
Ga0210392_103238651 | 3300021475 | Soil | MMMYWCIVVPAACLIVIALLSLYVPTIYIRKTNKLIHLLEEIAANTRK |
Ga0208077_10000466 | 3300025427 | Arctic Peat Soil | MIAFFVPVASLVLIAVLVLYVPTLYIRKTNKMIQLLEQIAANTRK |
Ga0208034_10105977 | 3300025442 | Peatland | MYGSILVLGACLVVIAALAIYVPTVYIRKTNAMIRLLEQIAANTRK |
Ga0208587_10005391 | 3300025484 | Arctic Peat Soil | MWAFAVPIVCLILIALLAIYVPTIYIRKTNKMIHILEQIAANTRK |
Ga0208191_10265481 | 3300025496 | Peatland | MNWPIFVLGACVIVVALLAIYVPTVYIRKTNVMVHLLEQISANTRR |
Ga0207927_10336662 | 3300025579 | Arctic Peat Soil | MTPSILVLSASLIVVALLAIYVPTVYIRKTNVMIHLLEQIAANTRK |
Ga0209385_11565991 | 3300025650 | Arctic Peat Soil | MYSLTFVFGACAVIIALMAIYVPTVYIRKTNVMIHLLEQIVANTRK |
Ga0209881_10476201 | 3300026273 | Soil | MLSGWVYVVHTLIGGVMTSSILVLSASLVVIALLAIYVPTVYIRKTNVMIHLLEQIAANTRR |
Ga0209421_10807692 | 3300027432 | Forest Soil | MYSFSFVFGACAVIVAVMAIYVPTVYIRKTNVMIHLLEQIAANTRK |
Ga0209446_11562412 | 3300027698 | Bog Forest Soil | MYWSSFIPGACLLVIALMALYVPTVYIRKTNAMIKLLEEIAANTRK |
Ga0209446_11600721 | 3300027698 | Bog Forest Soil | MFGTTLVIGACVIVIALLAIYVPTIYIRKTNKLIDLLEQIAANTRK |
Ga0209656_1000084520 | 3300027812 | Bog Forest Soil | MYLPSFVFGICLAVIAGLAIYVPTIYIRKTNATIKLLEQIAVNTGK |
Ga0209656_100658153 | 3300027812 | Bog Forest Soil | MWAIALPIGSLLLIALLAIYVPTIYIRKTNKMIALLEQIAVNTRK |
Ga0209656_100920171 | 3300027812 | Bog Forest Soil | MYWPTLVFGFCLIVLALLAIYFPTIYIRKTNKMIHLLEQIAANTSK |
Ga0209656_100998871 | 3300027812 | Bog Forest Soil | MYWPTLVFGFCLIVIALLAVYVPTLYIRKTNAVIKLLEQIAANTRK |
Ga0209656_102226371 | 3300027812 | Bog Forest Soil | MYLSSVVVGTCLVVIALLAIYVPTVYIRKTNVMIKLLEQIAANTRK |
Ga0209040_102764972 | 3300027824 | Bog Forest Soil | MYWSSFIPGACLLVIALMALYVPTVYIRKTNAMIKLLQEIAANTRK |
Ga0209180_100448672 | 3300027846 | Vadose Zone Soil | MQWPLALVGACVVLVALLTAYVPTIYIRKTNKVIALLEQIAANTKK |
Ga0209579_100279194 | 3300027869 | Surface Soil | MEWSFALTVGCTVLIALLAIYVPTIYIRKTNKIINLLEQIQANTRK |
Ga0208980_1000182314 | 3300027887 | Wetland | MSSMALVGACVIVIALVAIYVPTVYIRKTNKVLKVLEQIEANTRK |
Ga0209048_1000346915 | 3300027902 | Freshwater Lake Sediment | MYWATFVPGACLIIIALLALYVPTIYIRKTNKVIQLLEQIAANKGK |
Ga0209415_101671411 | 3300027905 | Peatlands Soil | MGWPFAVATGCLVLLALLAIYVPTIYVRKTNKMIQLLEQIAANTRK |
Ga0170834_1057653891 | 3300031057 | Forest Soil | MMMYWYVLVPAACLIVIALLALYVPTIYIRKTNKLIHLLEEIAANTRK |
Ga0302325_100866235 | 3300031234 | Palsa | MYWMSYLVGVCLVVIALLAIYVPTVYIRKTNVMIHLLEQIAANTRK |
Ga0265330_101304921 | 3300031235 | Rhizosphere | MILIALLAIYVPTIYIRKTNKMIHLLEEIAANARK |
Ga0302324_1006555063 | 3300031236 | Palsa | GVCLVVIALLAIYVPTVYIRKTNVMIHLLEQIAANTRK |
Ga0265325_101798622 | 3300031241 | Rhizosphere | MWAIALPVVCLILIALLVVYVPTIYISKTNKMIHLLEQIAANTRK |
Ga0265329_101838632 | 3300031242 | Rhizosphere | VFRPRVEAFMWTMAIPAACMILIALLAIYVPTIYIRKTNKMIHLLEEIAANARK |
Ga0265329_101917791 | 3300031242 | Rhizosphere | MLYWPSFVLGTCLILLALLALYVPTIYIRKTNVMIRLLEEIAANTRK |
Ga0265340_100471462 | 3300031247 | Rhizosphere | MWTMAIPAACMILIALLAIYVPTIYIRKTNKMIHLLEEIAANARK |
Ga0265316_111456541 | 3300031344 | Rhizosphere | YWPSFVLGTCLILLALLALYVPTIYIRKTNVMIRLLEEIAANSRK |
Ga0310686_1016154042 | 3300031708 | Soil | MMMYTAVLIPAGCLIVIALLGLYVPTIYIRKTNKIIHLLEEIAANTGKS |
Ga0310686_1024819021 | 3300031708 | Soil | MVMYWCIVVPAVCLIVIALLALYVPTIYIRKTNKLIHLLEEIVANTRK |
Ga0307469_102626722 | 3300031720 | Hardwood Forest Soil | MQWSFALLGTCVVLVALLAAYVPTIYIRKTNKVIALLEQIAANTKK |
Ga0306921_116790221 | 3300031912 | Soil | MFYFPSLVSALCLLVIALMAIYVPTVYIRKTNAMIKLLQEMAANTRK |
Ga0310916_109090772 | 3300031942 | Soil | MWSMALVGACVILIALMAVYVPTVYIRKTNKVLKLLEQIEANTRK |
Ga0311301_1001049919 | 3300032160 | Peatlands Soil | MYWATVVLGACVIVVAVLAIYVPTVYIRKTNVLIHLLEQIAANTRK |
Ga0311301_114287001 | 3300032160 | Peatlands Soil | MYWASFVVGICVIVIAFLAIYFPTIYIRKTNKLLDLLEQIAANTRK |
Ga0315268_105198551 | 3300032173 | Sediment | IIGVALLAIYVATIYIRKTNKLAALLEIIVLNTRK |
Ga0307472_1003814231 | 3300032205 | Hardwood Forest Soil | MHWPFAMVGACVVLIALLTAYVPTVYIRKTNKMIALLEQIAANTKK |
Ga0307472_1014810602 | 3300032205 | Hardwood Forest Soil | SMQWSFALLGTCVVLVALLAAYVPTIYIRKTNKVIALLEQIAANTKK |
Ga0335085_105449393 | 3300032770 | Soil | MWAMSVPIACLVLIALLAIYVPTIYIRKTNKMIHILEEIAANSRK |
Ga0335070_102587631 | 3300032829 | Soil | MTVILPVASLVVLALLALYVPTIYIRKTNKVIQLLEQIAANTRK |
Ga0335070_106210141 | 3300032829 | Soil | MWAMALPVACLIVIALLAIYVPTIYIRKTNKVLAVLEQIATNTRK |
Ga0335081_100260674 | 3300032892 | Soil | MYLAVVGTCVVVIALLAIYVPTIYIRKTNNVLRLLEQIAANTRK |
Ga0335081_101224873 | 3300032892 | Soil | MYWLSFVIGSCLVVTALLAIYVPTVYIRKTNVMIHLLEQIAANGHK |
Ga0335069_120569592 | 3300032893 | Soil | MYWSSLVVGVCLAVIALLAIYTPTIYIRKTNAMIKLLEQIAANTRK |
Ga0335069_127021821 | 3300032893 | Soil | MYWPSLIVGVCLVVIALIALYVPTVYIRKTNAMIKLLEQIAANTRK |
Ga0316628_1040609451 | 3300033513 | Soil | SFALTITGIVVIALLAIYVPTIYIRKTNKMLKLLEQIEANTRK |
Ga0370484_0138741_443_598 | 3300034125 | Untreated Peat Soil | MIGGIMTPSILVLSASLIVVALLAIYVPTVYIRKTNKITHLLEQIEVNTRK |
Ga0370515_0082152_182_328 | 3300034163 | Untreated Peat Soil | MVMYWCIVVPAACLIVIALLALYVPTIYIRKTNKLIHLLEEIVANTRK |
⦗Top⦘ |