Basic Information | |
---|---|
Family ID | F066552 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 126 |
Average Sequence Length | 47 residues |
Representative Sequence | DIYNLLNSDAVTAYNNGYSPTGAWLTPTAILPARYVRLNLQLDF |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 126 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 96.83 % |
% of genes from short scaffolds (< 2000 bps) | 95.24 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.778 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.698 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.683 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.873 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.44% β-sheet: 5.56% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 126 Family Scaffolds |
---|---|---|
PF07883 | Cupin_2 | 15.87 |
PF13620 | CarboxypepD_reg | 12.70 |
PF01177 | Asp_Glu_race | 5.56 |
PF07399 | Na_H_antiport_3 | 5.56 |
PF12867 | DinB_2 | 3.17 |
PF01555 | N6_N4_Mtase | 1.59 |
PF11412 | DsbC | 1.59 |
PF01699 | Na_Ca_ex | 0.79 |
PF01186 | Lysyl_oxidase | 0.79 |
PF02311 | AraC_binding | 0.79 |
PF07637 | PSD5 | 0.79 |
PF00135 | COesterase | 0.79 |
PF02720 | DUF222 | 0.79 |
PF03737 | RraA-like | 0.79 |
PF00775 | Dioxygenase_C | 0.79 |
PF01569 | PAP2 | 0.79 |
PF00069 | Pkinase | 0.79 |
PF00753 | Lactamase_B | 0.79 |
COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.17 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.59 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.59 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.59 |
COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.79 |
COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.79 |
COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.79 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.79 |
COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.78 % |
Unclassified | root | N/A | 22.22 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_100695139 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300000891|JGI10214J12806_10754833 | Not Available | 1423 | Open in IMG/M |
3300004463|Ga0063356_101799075 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300004463|Ga0063356_101908510 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300004463|Ga0063356_106468354 | Not Available | 502 | Open in IMG/M |
3300005328|Ga0070676_10750869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300005330|Ga0070690_100754323 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300005334|Ga0068869_100180554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1654 | Open in IMG/M |
3300005339|Ga0070660_101031756 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300005354|Ga0070675_101152100 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300005355|Ga0070671_101552638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300005364|Ga0070673_101183368 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300005438|Ga0070701_11234057 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300005459|Ga0068867_101704412 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005466|Ga0070685_10557154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
3300005471|Ga0070698_100958298 | Not Available | 802 | Open in IMG/M |
3300005544|Ga0070686_100241718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1315 | Open in IMG/M |
3300005546|Ga0070696_101844754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
3300005549|Ga0070704_101423591 | Not Available | 636 | Open in IMG/M |
3300005615|Ga0070702_100469562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
3300005719|Ga0068861_101690743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300005840|Ga0068870_11386359 | Not Available | 515 | Open in IMG/M |
3300005841|Ga0068863_101731725 | Not Available | 635 | Open in IMG/M |
3300005841|Ga0068863_102146198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300005844|Ga0068862_100546184 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300005844|Ga0068862_102648820 | Not Available | 513 | Open in IMG/M |
3300006844|Ga0075428_100430048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium halotolerans | 1414 | Open in IMG/M |
3300006844|Ga0075428_100527904 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
3300006845|Ga0075421_102519145 | Not Available | 536 | Open in IMG/M |
3300006876|Ga0079217_10904219 | Not Available | 630 | Open in IMG/M |
3300006880|Ga0075429_101537992 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300006894|Ga0079215_10051658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1598 | Open in IMG/M |
3300006894|Ga0079215_10537840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
3300006894|Ga0079215_11072641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300006904|Ga0075424_101543431 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300009094|Ga0111539_11563811 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300009098|Ga0105245_11837757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
3300009100|Ga0075418_11763074 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300009147|Ga0114129_10013273 | All Organisms → cellular organisms → Bacteria | 11736 | Open in IMG/M |
3300009147|Ga0114129_11675444 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300009148|Ga0105243_11180870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
3300009156|Ga0111538_10041090 | All Organisms → cellular organisms → Bacteria | 5956 | Open in IMG/M |
3300009156|Ga0111538_10569856 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300009156|Ga0111538_13381135 | Not Available | 554 | Open in IMG/M |
3300009162|Ga0075423_10058550 | All Organisms → cellular organisms → Bacteria | 3983 | Open in IMG/M |
3300009176|Ga0105242_12664940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300010040|Ga0126308_11235232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300010047|Ga0126382_11534481 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300010397|Ga0134124_10162067 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
3300010397|Ga0134124_12555491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300010400|Ga0134122_10548577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium halotolerans | 1057 | Open in IMG/M |
3300010401|Ga0134121_10711512 | Not Available | 954 | Open in IMG/M |
3300010403|Ga0134123_11709525 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300011119|Ga0105246_10499228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
3300011119|Ga0105246_12052827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300011119|Ga0105246_12148356 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300011398|Ga0137348_1050312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300011415|Ga0137325_1030674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
3300011441|Ga0137452_1246940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300011443|Ga0137457_1112470 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300011443|Ga0137457_1205987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300012510|Ga0157316_1040782 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300012511|Ga0157332_1049129 | Not Available | 600 | Open in IMG/M |
3300012907|Ga0157283_10085273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300012908|Ga0157286_10130121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
3300013307|Ga0157372_11770745 | Not Available | 710 | Open in IMG/M |
3300014969|Ga0157376_11190280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
3300014969|Ga0157376_12478467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300015200|Ga0173480_10564262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300015372|Ga0132256_103496263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300015373|Ga0132257_101785727 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300015373|Ga0132257_101810471 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300015373|Ga0132257_103407616 | Not Available | 579 | Open in IMG/M |
3300015374|Ga0132255_101499356 | Not Available | 1020 | Open in IMG/M |
3300018469|Ga0190270_12112391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300018476|Ga0190274_10125181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2110 | Open in IMG/M |
3300018476|Ga0190274_10246032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 1617 | Open in IMG/M |
3300018476|Ga0190274_10615545 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300018476|Ga0190274_12717167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300018476|Ga0190274_13766423 | Not Available | 513 | Open in IMG/M |
3300018481|Ga0190271_13146494 | Not Available | 553 | Open in IMG/M |
3300019356|Ga0173481_10047090 | Not Available | 1467 | Open in IMG/M |
3300020034|Ga0193753_10067415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1863 | Open in IMG/M |
3300022911|Ga0247783_1094435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
3300025907|Ga0207645_10802856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300025907|Ga0207645_10911388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300025920|Ga0207649_10400064 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300025923|Ga0207681_10798921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
3300025923|Ga0207681_10986316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
3300025926|Ga0207659_10224802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1511 | Open in IMG/M |
3300025930|Ga0207701_11269924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300025931|Ga0207644_11269248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300025933|Ga0207706_10442476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1125 | Open in IMG/M |
3300025935|Ga0207709_10819823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300025940|Ga0207691_10997255 | Not Available | 699 | Open in IMG/M |
3300025945|Ga0207679_11173952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
3300025949|Ga0207667_11904476 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300025972|Ga0207668_11042244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
3300026089|Ga0207648_10333233 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300026089|Ga0207648_10462509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
3300026089|Ga0207648_11040417 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300026116|Ga0207674_11129972 | Not Available | 753 | Open in IMG/M |
3300026118|Ga0207675_100151568 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
3300027665|Ga0209983_1122370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 594 | Open in IMG/M |
3300027840|Ga0209683_10084675 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300027873|Ga0209814_10061364 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
3300027880|Ga0209481_10646320 | Not Available | 549 | Open in IMG/M |
3300027886|Ga0209486_10354146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 879 | Open in IMG/M |
3300027909|Ga0209382_11972685 | Not Available | 561 | Open in IMG/M |
3300031184|Ga0307499_10132318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300031538|Ga0310888_10069364 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
3300031538|Ga0310888_10592307 | Not Available | 672 | Open in IMG/M |
3300031538|Ga0310888_10672695 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300031562|Ga0310886_10379006 | Not Available | 829 | Open in IMG/M |
3300031720|Ga0307469_12334752 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300031908|Ga0310900_11120115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 652 | Open in IMG/M |
3300031913|Ga0310891_10363672 | Not Available | 521 | Open in IMG/M |
3300031943|Ga0310885_10087224 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300031943|Ga0310885_10329572 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300032003|Ga0310897_10597980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300032013|Ga0310906_10114477 | Not Available | 1508 | Open in IMG/M |
3300032075|Ga0310890_10135765 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
3300032144|Ga0315910_11441131 | Not Available | 537 | Open in IMG/M |
3300032157|Ga0315912_10737386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 784 | Open in IMG/M |
3300033551|Ga0247830_11525225 | Not Available | 535 | Open in IMG/M |
3300034672|Ga0314797_106567 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.70% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 10.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.76% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.97% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.97% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.97% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.97% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.17% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.17% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.17% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.38% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.59% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.79% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1006951392 | 3300000559 | Soil | YNLLNNDAVTSYNNGYTAPTATRPSIWLTPTAILPARYVRLNMQLDF* |
JGI10214J12806_107548331 | 3300000891 | Soil | LLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF* |
Ga0063356_1017990751 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AQFGVDVYNLTNTDVVTAYNTGYTAPTATAGSNWLTPTGILPARYVRLNMQLDF* |
Ga0063356_1019085102 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AKILRIRGTRAQFGVDVYNLLNTDVVTTYNEGYTAPTATTGSIWLTPNSILPARYVRLNMQLDF* |
Ga0063356_1064683541 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AQFGVDVYNLTNTDVVTAYNAGYIAPTATAGSNWLTPTGILPARYVRLNMQIDF* |
Ga0070676_107508691 | 3300005328 | Miscanthus Rhizosphere | RTQVGIDLYNILNNDAVTTYNNGYSPTGAWLTPTAILPARYVRFNLQLDF* |
Ga0070690_1007543231 | 3300005330 | Switchgrass Rhizosphere | TQFGVDLYNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF* |
Ga0068869_1001805541 | 3300005334 | Miscanthus Rhizosphere | DLYNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF* |
Ga0070660_1010317562 | 3300005339 | Corn Rhizosphere | TRAQIGVDIYNLLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF* |
Ga0070675_1011521001 | 3300005354 | Miscanthus Rhizosphere | GVDLYNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF* |
Ga0070671_1015526381 | 3300005355 | Switchgrass Rhizosphere | GMDVYNLLNTDVVTAYNQGYSAPTATRGSIWLTPTAILPARYVRLNVQIDF* |
Ga0070673_1011833682 | 3300005364 | Switchgrass Rhizosphere | VDVYNLLNTDVVTGYNNGYSPTGAWLTPTTIQPARYARLNLELNF* |
Ga0070701_112340572 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVDIYNVLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF* |
Ga0068867_1017044122 | 3300005459 | Miscanthus Rhizosphere | VDVYNLLNTDVVTGYNNGYSATGAWLTPTAIQPARYARLNLEVNF* |
Ga0070685_105571542 | 3300005466 | Switchgrass Rhizosphere | DLYNLLNTDVVTAYNNGYTAPTATQGSIWLTPTAILPARYVRLNVQIDF* |
Ga0070698_1009582982 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TQVGMDVYNVVNNDAVTMYNNGYTAPVAGRSSVWLTPTTILPARYIRLNMQFDF* |
Ga0070686_1002417183 | 3300005544 | Switchgrass Rhizosphere | VDVYNLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELNF* |
Ga0070696_1018447542 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ILHFGQTRAQFGVDIYNLTNTDVVTQYNNGYIAPSATQGSVWLTPNAILPARYVRLNMQIDF* |
Ga0070704_1014235911 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | YNLLNTDVVTAYNNGYTAPTATQGSIWLTPTAILPARYVRLNMQLDF* |
Ga0070702_1004695621 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | TRAQFGVDVYNLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELNF* |
Ga0068861_1016907432 | 3300005719 | Switchgrass Rhizosphere | ILRFGKTRAQFGVDVYNLLNTDVVTGYNNGYSATGAWLTPTTIQPARYARLNLEVNF* |
Ga0068870_113863591 | 3300005840 | Miscanthus Rhizosphere | VTAYNNGYTAPTATQGSIWLTPTAILPARYVRLNMQLDF* |
Ga0068863_1017317251 | 3300005841 | Switchgrass Rhizosphere | RAQLGVDIYNVLNTDVVTLYNNGYSPTGTWLTPTAILPARYARFNMQFDF* |
Ga0068863_1021461982 | 3300005841 | Switchgrass Rhizosphere | QFGVDVYNLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELSF* |
Ga0068862_1005461841 | 3300005844 | Switchgrass Rhizosphere | GVDVYNLLNTDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNLQLDF* |
Ga0068862_1026488202 | 3300005844 | Switchgrass Rhizosphere | YNNGYTAPAAGRSSVWLTPTTILPARYIRLNMQVDF* |
Ga0075428_1004300483 | 3300006844 | Populus Rhizosphere | AVTMYNNGYSPTGAWLTPTAILPARYVRLNMQLDF* |
Ga0075428_1005279041 | 3300006844 | Populus Rhizosphere | DVVTLYNNGYSAPTATRGSIWLTPTAILPARYVRLNMQMDF* |
Ga0075421_1025191451 | 3300006845 | Populus Rhizosphere | NLLNTDVVTSYNNGYSAPTATGGSIWLTPTAILPARYVRLNMQFDF* |
Ga0079217_109042192 | 3300006876 | Agricultural Soil | FRFRGARAQIGVDIYNVLNNDVVTAYNNGYSPTGAWLTPTAILPARYARFNLQFDF* |
Ga0075429_1015379922 | 3300006880 | Populus Rhizosphere | LLNTDVVTLYNNGYSAPTATRGSIWLTPTAILPARYVRLNMQMDF* |
Ga0079215_100516581 | 3300006894 | Agricultural Soil | NLLNNDVVTTYNNGYTAPVAGRGSIWLTPTAILPARYARINLQVDF* |
Ga0079215_105378401 | 3300006894 | Agricultural Soil | KVLRIAGTRTQVGVDVYNLMNTDAVTGFNAGYSPTGAWLTPTAIVPARYARFNMQVDF* |
Ga0079215_110726412 | 3300006894 | Agricultural Soil | NIGVRVARVLRCGGTRAQVGVDVYNVMNTDAVTSFNNGYSPTGAWLTPTGIAPARYARINVQLDF* |
Ga0075424_1015434311 | 3300006904 | Populus Rhizosphere | TQYNNGYIAPNAQTGAPSTWLTPNAILPARYVRLNMQIDF* |
Ga0111539_115638111 | 3300009094 | Populus Rhizosphere | TTYNEGYTAPTATSGSIWLTPNSILPARYVRLNLQLDF* |
Ga0105245_118377571 | 3300009098 | Miscanthus Rhizosphere | KTRAQFGVDVYNLLNTDVVTGYNNGYSATGAWLTPTTIQPARYARLNLEVNF* |
Ga0075418_117630742 | 3300009100 | Populus Rhizosphere | YNNGYIAPTATSGSVWLTPTTILPARYVRLNMQIDF* |
Ga0114129_100132731 | 3300009147 | Populus Rhizosphere | RFRGYRTQIGVDIYNVVNTDVVTAYNNGYSPTGAWLTPTAILPARYARFNLQFDF* |
Ga0114129_116754442 | 3300009147 | Populus Rhizosphere | FGVDIYNLTNNDVVTGYNNGYIAPTATSGSVWLTPTSILPARYVRLNMQIDF* |
Ga0105243_111808701 | 3300009148 | Miscanthus Rhizosphere | LLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELSF* |
Ga0111538_100410901 | 3300009156 | Populus Rhizosphere | YNEGYTAPTATSGSIWLTPNSILPARYVRLNMQLDF* |
Ga0111538_105698562 | 3300009156 | Populus Rhizosphere | RGTRAQFGVDVYNLLNTDVVTMYNEGYTAPTATSGSIWLTPNSILPARYVRLNLQLDF* |
Ga0111538_133811351 | 3300009156 | Populus Rhizosphere | TDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNMQLDF* |
Ga0075423_100585503 | 3300009162 | Populus Rhizosphere | LTNTDVVTQYNNGYIAPNAQTGAPSTWLTPNAILPARYVRLNMQIDF* |
Ga0105242_126649401 | 3300009176 | Miscanthus Rhizosphere | RAQFGVDVYNLLNTDVVTGYNNGYSATGAWLTPTAIQPARYARLNLEVNF* |
Ga0126308_112352321 | 3300010040 | Serpentine Soil | DVVTGYNNGYSATGAWLTPTSIQPARYARLNLEVNF* |
Ga0126382_115344812 | 3300010047 | Tropical Forest Soil | FGGTRAQFGADVYNLLNTDVTTLYNNGYTAPTATSPSIWLTPNAILPARYVRLNMQLDF* |
Ga0134124_101620671 | 3300010397 | Terrestrial Soil | GHTRAQFGVDVYNLLNSDVVTGYNNGYSATGAWLTPTSITPARYARLNLEMNF* |
Ga0134124_125554912 | 3300010397 | Terrestrial Soil | LNSDVVTGYNNGYSATGAWLTPTSITPARYARLNLEVSF* |
Ga0134122_105485773 | 3300010400 | Terrestrial Soil | GIDLYNILNNDAVTTYNNGYSPTGAWLTPTAILPARYVRFNLQLDF* |
Ga0134121_107115121 | 3300010401 | Terrestrial Soil | KIFRFSGTRAQIGVDIYNLLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF* |
Ga0134123_117095252 | 3300010403 | Terrestrial Soil | RAQFGVDIYNVTNTDVVTLYNNGYIAPTGTNPSVWLTPNAILTARYARLNMQIDF* |
Ga0105246_104992281 | 3300011119 | Miscanthus Rhizosphere | RAQFGVDVYNLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELNF* |
Ga0105246_120528271 | 3300011119 | Miscanthus Rhizosphere | VYNLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELSF* |
Ga0105246_121483561 | 3300011119 | Miscanthus Rhizosphere | GTRINNLLNSDAVTSYDNGDSHNNGYTRPTVNRRLGSTWLTPTAILPARCVRLNLQLDF* |
Ga0137348_10503122 | 3300011398 | Soil | QFGVDVYNMLNTDVVTGYNNGYSPTGAWLTPTSIQPARYARLNLELNF* |
Ga0137325_10306744 | 3300011415 | Soil | GLDLYNLLNNDVVTAYNNGYNPTGAWLIPNTILPARYVRLNLQLDF* |
Ga0137452_12469402 | 3300011441 | Soil | KILRFRGYRTQIGVDIYNVVNTDVVTAYNTGYSPTGAWLTPTAILPARYARFNLQFDF* |
Ga0137457_11124702 | 3300011443 | Soil | AQFGVDVYNLLNTDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNMQLDF* |
Ga0137457_12059871 | 3300011443 | Soil | MDVYNLLNTDVVTAYNQGYSAPTATRGSIWLTPTAILPARYVRLNVQIDF* |
Ga0157316_10407822 | 3300012510 | Arabidopsis Rhizosphere | LNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF* |
Ga0157332_10491292 | 3300012511 | Soil | QFGVDLYNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF* |
Ga0157283_100852733 | 3300012907 | Soil | GVDVYNLLNTDVVTGYNNGYSPTGAWLTPTTIQPARYARLNMELNF* |
Ga0157286_101301212 | 3300012908 | Soil | VDVYNLLNTDVVTGYNNGYSPTGAWLTPTTIQPARYARLNMELNF* |
Ga0157372_117707452 | 3300013307 | Corn Rhizosphere | VTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF* |
Ga0157376_111902802 | 3300014969 | Miscanthus Rhizosphere | VDVYNLLNTDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNMQLDF* |
Ga0157376_124784672 | 3300014969 | Miscanthus Rhizosphere | VTGYNNGYSPTGAWLTPTAIQPARYVRLNLEVNF* |
Ga0173480_105642622 | 3300015200 | Soil | YNILNNDAVTTYNNGYSPTGAWLTPTAILPARYVRFNLQLDF* |
Ga0132256_1034962631 | 3300015372 | Arabidopsis Rhizosphere | TQFGVDVHNLLNSDVVTGYKNGYSATGAWLTPTAITPARYARLSLELSF* |
Ga0132257_1017857271 | 3300015373 | Arabidopsis Rhizosphere | DIYNLLNSDAVTAYNNGYSPTGAWLTPTAILPARYVRLNLQLDF* |
Ga0132257_1018104711 | 3300015373 | Arabidopsis Rhizosphere | TNTDVVTAYNNGYTPPTATQPSNWLTPTAILPARYVRLNMQIDF* |
Ga0132257_1034076162 | 3300015373 | Arabidopsis Rhizosphere | FGGTRAQFGADVYNLLNTDVVTTYNTGYTAPTATNPSIWLTPNAILPARYVRLNLQVDF* |
Ga0132255_1014993561 | 3300015374 | Arabidopsis Rhizosphere | GMDVYNVMNNDAVTAYNNGYTAPTAGRPSVWLTPTTILPARYIRLNMQIDF* |
Ga0190270_121123911 | 3300018469 | Soil | VVTAYNTGYSPTGAWLTPTAILPARYARFNLQLDF |
Ga0190274_101251811 | 3300018476 | Soil | RFRGTRAQVGMDVYNLLNTDVVTAYNQGYSAPTATQGSIWLTPTAILPARYVRLNVQIDF |
Ga0190274_102460321 | 3300018476 | Soil | AQFGVDVYNLLNTDVVTGYNNGYSPTGAWLTPTAIQPARYARLNLELNF |
Ga0190274_106155451 | 3300018476 | Soil | TTYNNGYSAPTVTQGSIWLTPNAILPARYVRLNMQLDF |
Ga0190274_127171672 | 3300018476 | Soil | VDVYNLLNTDVVTGYNNGYSPTGAWLTPTAIQPARYARLNLELDF |
Ga0190274_137664231 | 3300018476 | Soil | NLLNTDVVTMYNNGYSAPTATGGSLWLTPTAILPARYVRLNMQIDF |
Ga0190271_131464942 | 3300018481 | Soil | AYNQGYSAPTATQGSIWLTPNAILPARYVRLNMQIDF |
Ga0173481_100470902 | 3300019356 | Soil | YNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF |
Ga0193753_100674151 | 3300020034 | Soil | LLNTDVVTGYNNGYSPTGAWLTPTAIQPARYARLNLEINF |
Ga0247783_10944351 | 3300022911 | Plant Litter | QFGVDVYNLLNTDVVTGYNNGYSPTGAWLTPTTIQPARYARLNMELNF |
Ga0207645_108028562 | 3300025907 | Miscanthus Rhizosphere | QFGVDVYNLLNTDVVTGYNNGYSPTGAWLTPTAIQPARYARLNLEVNF |
Ga0207645_109113881 | 3300025907 | Miscanthus Rhizosphere | FRGTRAQVGMDVYNLLNTDVVTAYNQGYSAPTATQGSIWLTPTAILPARYVRLNVQVDF |
Ga0207649_104000642 | 3300025920 | Corn Rhizosphere | LLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF |
Ga0207681_107989212 | 3300025923 | Switchgrass Rhizosphere | NILNNDAVTTYNNGYSPTGAWLTPTAILPARYVRFNLQLDF |
Ga0207681_109863162 | 3300025923 | Switchgrass Rhizosphere | LLNTDVVTGYNNGYSPTGSWLTPTSIQPARYARLNLELNF |
Ga0207659_102248021 | 3300025926 | Miscanthus Rhizosphere | LLNTDVVTGYNNGYSATGAWLTPTAIQPARYARLNLELNF |
Ga0207701_112699242 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RAQVGMDVYNLLNTDVVTAYNQGYSAPTATQGSIWLTPTAILPARYVRLNVQIDF |
Ga0207644_112692482 | 3300025931 | Switchgrass Rhizosphere | QVGMDVYNLLNTDVVTAYNQGYSAPTATRGSIWLTPTAILPARYVRLNVQIDF |
Ga0207706_104424763 | 3300025933 | Corn Rhizosphere | QVGIDLYNILNNDAVTTYNNGYSPTGAWLTPTAILPARYVRFNLQLDF |
Ga0207709_108198231 | 3300025935 | Miscanthus Rhizosphere | LLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELSF |
Ga0207691_109972552 | 3300025940 | Miscanthus Rhizosphere | MDVYNLTNTDVVTGYNQNYTAPTGGRGSVWLTPTTIQPARYIRLNLQIDF |
Ga0207679_111739522 | 3300025945 | Corn Rhizosphere | NVLNTDVVTLYNNGYSPTGTWLTPTAILPARYARFNMQFDF |
Ga0207667_119044762 | 3300025949 | Corn Rhizosphere | RAQIGVDIYNLLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF |
Ga0207668_110422441 | 3300025972 | Switchgrass Rhizosphere | ILRFRGTRAQFGVDVYNLLNTDVVTTYNEGYTAPTATSGSIWLTPNAILPARYVRLNLQVDF |
Ga0207648_103332333 | 3300026089 | Miscanthus Rhizosphere | GTRAQLGVDIYNVLNTDVVTLYNNGYSPTGTWLTPTAILPARYARFNMQFDF |
Ga0207648_104625091 | 3300026089 | Miscanthus Rhizosphere | VDVYNLLNTDVVTGYNNGYSATGAWLTPTAIQPARYARLNLEVNF |
Ga0207648_110404172 | 3300026089 | Miscanthus Rhizosphere | LNTDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNLQLDF |
Ga0207674_111299721 | 3300026116 | Corn Rhizosphere | NVLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF |
Ga0207675_1001515683 | 3300026118 | Switchgrass Rhizosphere | TRAQIGVDIYNLLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF |
Ga0209983_11223701 | 3300027665 | Arabidopsis Thaliana Rhizosphere | YNLINTDVVTAYNNGYSPTGAWLTPTAILPARYARFNVQFDF |
Ga0209683_100846751 | 3300027840 | Wetland Sediment | DIYNLMNSDVVTTYNNGYTPPNPVTGAGSTWLTPTAITPARYARLNLQFDF |
Ga0209814_100613642 | 3300027873 | Populus Rhizosphere | NTGYSAPQADRGSIWLTPNAILPARYVRLNMQIDF |
Ga0209481_106463201 | 3300027880 | Populus Rhizosphere | VTTYNEGYSAPTATSGSIWLTPNAILPARYVRLNMQLDF |
Ga0209486_103541463 | 3300027886 | Agricultural Soil | TDAVTGFNNGYSPTGAWLTPTSIVPARYARFNMQVDF |
Ga0209382_119726851 | 3300027909 | Populus Rhizosphere | VVTAYNNGYSPTGAWLTPTAILPARYARFNLQFDF |
Ga0307499_101323182 | 3300031184 | Soil | GTRAQVGMDVYNLLNTDVVTAYNQGYSAPTATRGSIWLTPTAILPARYVRLNVQIDF |
Ga0310888_100693643 | 3300031538 | Soil | LRFRGVRTQVGVDIYNVLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF |
Ga0310888_105923072 | 3300031538 | Soil | VYNLLNTDVVTTYNQGYTAPTATTGSIWLTPNAIQPARYVPLNMQLDF |
Ga0310888_106726951 | 3300031538 | Soil | GVDLYNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNMQLDF |
Ga0310886_103790062 | 3300031562 | Soil | YNQGYTAPTATTGSIWLTPNAIQPARYVPLNMQLDF |
Ga0307469_123347521 | 3300031720 | Hardwood Forest Soil | VTAYNNGYSAPTATQGSIWLTPTAILPARYVRLNMQIDF |
Ga0310900_111201152 | 3300031908 | Soil | LRFRGTRAQVGVDIYNVLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNMQFDF |
Ga0310891_103636721 | 3300031913 | Soil | VDVYNLLNTDVVTTYNQGYTAPTATTGSIWLTPNAIQPARYVPLNMQLDF |
Ga0310885_100872241 | 3300031943 | Soil | IGVDIYNVVNTDVVTAYNNGYSPTGAWLTPTAILPARYARFNLQFDF |
Ga0310885_103295722 | 3300031943 | Soil | VTTYNEGYTAPTATTGSIWLTPNSILPARYVRLNMQLDF |
Ga0310897_105979802 | 3300032003 | Soil | TQFGVDVYNLLNTDVVTGYNNGYSATGAWLTPTSITPARYARLNLELNF |
Ga0310906_101144771 | 3300032013 | Soil | LNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF |
Ga0310890_101357652 | 3300032075 | Soil | RAQFGVDVYNLLNTDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNLQLDF |
Ga0315910_114411311 | 3300032144 | Soil | RMQFGADVYNLLNTDVVTMYNNGYSAPTATRGSIWLTPTAILPARYVRLNMQLDF |
Ga0315912_107373861 | 3300032157 | Soil | YNLLNNDAVTLYNNGYSPTGAWLTPTAILPARYVRLNLQLDF |
Ga0247830_115252252 | 3300033551 | Soil | YNQGYSAPTATQGSIWLTPNAILPARYVRLNMQIDF |
Ga0314797_106567_420_581 | 3300034672 | Soil | GQTRTQFGVDLYNLLNSDAVTMYNNGYSATGAWLTPTAILPARYVRLNLQLDF |
⦗Top⦘ |